F402867

General Info

Members Datasets Scaffolds Average Seq Length
314 203 628 305

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0008543|Ga0496100_0008543_275_1279
Length 334
Sequence MLFVVLSSTATAISLAGLPSLRWTTMQLDGIHHVTAITGEAQPNVDFYAGVLGLRLVKKTVNQDSPTVYHLFYADEKGDPGSDITFFEYPGIGPGRAGDGMVHRILWRVASADSLDFWARRLGEHGIETAELDGGRLRFSDPEGLEHELLVPDTDDEPMTAEHPEIPAEHALQGFEGVRAYSSNPDASRSLLEETMGFEPRGELFWESRGDIRGSTYAYDEPPEKVGVQGAGTVHHVAWASPAEEHEAWRDRVLAAGMHATPVIDRFYFRSVYYREPSGVLFEIATLGGPGFAIDEPVEHLGEKLSLPPFIEHLRPEIEPRLRPITNPRQVAAG

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
97 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
98 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
99 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 9.87
Rhizosphere 78.66
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0008543 3300048903 Bacteria 5715
2 Ga0070690_100162839 3300005330 Bacteria 1530
3 Ga0068869_100155210 3300005334 Unclassified 1778
4 Ga0070680_100070238 3300005336 Bacteria 2877
5 Ga0070682_100013950 3300005337 Bacteria 4635
6 Ga0068868_100037616 3300005338 Bacteria 3753
7 Ga0070691_10193752 3300005341 Bacteria 1064
8 Ga0070692_10018159 3300005345 Bacteria 3376
9 Ga0070674_100206481 3300005356 Unclassified 1520
10 Ga0070709_10114502 3300005434 Unclassified 1818
11 Ga0070714_100005210 3300005435 Bacteria 9895
12 Ga0070714_100064610 3300005435 Bacteria 3150
13 Ga0070714_100073220 3300005435 Bacteria 2968
14 Ga0070713_100112703 3300005436 Bacteria 2373
15 Ga0070713_100197690 3300005436 Unclassified 1814
16 Ga0070711_100051655 3300005439 Bacteria 2824
17 Ga0070711_100082725 3300005439 Bacteria 2291
18 Ga0070711_100100043 3300005439 Unclassified 2108
19 Ga0070711_100168673 3300005439 Bacteria 1666
20 Ga0070700_100130373 3300005441 Unclassified 1696
21 Ga0070694_100066174 3300005444 Bacteria 2478
22 Ga0070708_100007055 3300005445 Bacteria 8966
23 Ga0070708_100026799 3300005445 Bacteria 4938
24 Ga0070708_100201790 3300005445 Unclassified 1862
25 Ga0070708_100273277 3300005445 Bacteria 1590
26 Ga0070678_100071875 3300005456 Bacteria 2591
27 Ga0070678_100096497 3300005456 Unclassified 2281
28 Ga0070662_100146053 3300005457 Bacteria 1837
29 Ga0070681_10166256 3300005458 Bacteria 2129
30 Ga0070707_100010491 3300005468 Bacteria 8631
31 Ga0070707_100018741 3300005468 Bacteria 6516
32 Ga0070698_100003138 3300005471 Bacteria 18207
33 Ga0070699_100034396 3300005518 Bacteria 4379
34 Ga0070699_100387413 3300005518 Unclassified 1263
35 Ga0070697_100101962 3300005536 Bacteria 2385
36 Ga0070693_100053816 3300005547 Bacteria 2312
37 Ga0070665_100077064 3300005548 Bacteria 3340
38 Ga0070704_100259209 3300005549 Bacteria 1432
39 Ga0070704_100521983 3300005549 Unclassified 1034
40 Ga0068855_100103731 3300005563 Bacteria 3271
41 Ga0070702_100021387 3300005615 Bacteria 3403
42 Ga0070702_100068017 3300005615 Bacteria 2095
43 Ga0070702_100070399 3300005615 Bacteria 2065
44 Ga0068861_100009634 3300005719 Bacteria 6673
45 Ga0081455_10005423 3300005937 Bacteria 13991
46 Ga0081455_10008074 3300005937 Bacteria 10990
47 Ga0081455_10096967 3300005937 Bacteria 2377
48 Ga0075365_10001602 3300006038 Bacteria 10416
49 Ga0075365_10002630 3300006038 Bacteria 8902
50 Ga0075365_10004043 3300006038 Bacteria 7696
51 Ga0075365_10068338 3300006038 Bacteria 2387
52 Ga0070712_100002182 3300006175 Bacteria 12028
53 Ga0070712_100043101 3300006175 Bacteria 3105
54 Ga0070712_100119834 3300006175 Bacteria 1978
55 Ga0075428_100051093 3300006844 Bacteria 4533
56 Ga0075428_100080093 3300006844 Bacteria 3564
57 Ga0075431_100002597 3300006847 Bacteria 17458
58 Ga0075431_100049096 3300006847 Bacteria 4352
59 Ga0075433_10009373 3300006852 Bacteria 7823
60 Ga0075433_10138238 3300006852 Bacteria 2165
61 Ga0075434_100138964 3300006871 Bacteria 2449
62 Ga0075429_100002416 3300006880 Bacteria 15736
63 Ga0068865_100032387 3300006881 Unclassified 3491
64 Ga0075436_100016452 3300006914 Bacteria 5062
65 Ga0075435_100006670 3300007076 Bacteria 8184
66 Ga0075435_100146792 3300007076 Bacteria 1981
67 Ga0111539_10016128 3300009094 Bacteria 9271
68 Ga0111539_10127025 3300009094 Bacteria 2987
69 Ga0105245_10005290 3300009098 Bacteria 11340
70 Ga0105245_10025395 3300009098 Bacteria 5211
71 Ga0114129_10003391 3300009147 Bacteria 22391
72 Ga0114129_10024298 3300009147 Bacteria 8585
73 Ga0114129_10181444 3300009147 Bacteria 2863
74 Ga0114129_10227722 3300009147 Bacteria 2511
75 Ga0114129_10345963 3300009147 Bacteria 1971
76 Ga0114129_10354681 3300009147 Bacteria 1942
77 Ga0114129_10409159 3300009147 Bacteria 1787
78 Ga0105243_10030403 3300009148 Bacteria 4158
79 Ga0105243_10043494 3300009148 Unclassified 3520
80 Ga0105241_10227414 3300009174 Bacteria 1571
81 Ga0105237_10488228 3300009545 Bacteria 1238
82 Ga0105249_10007134 3300009553 Bacteria 9754
83 Ga0105249_10260803 3300009553 Bacteria 1722
84 Ga0105239_10098792 3300010375 Bacteria 3227
85 Ga0157371_10121261 3300013102 Bacteria 1859
86 Ga0157378_10067214 3300013297 Unclassified 3211
87 Ga0163162_10280861 3300013306 Bacteria 1797
88 Ga0157375_10188248 3300013308 Unclassified 2218
89 Ga0207653_10004076 3300025885 Bacteria 4596
90 Ga0207688_10127190 3300025901 Bacteria 1491
91 Ga0207645_10291363 3300025907 Bacteria 1085
92 Ga0207684_10050117 3300025910 Bacteria 3542
93 Ga0207684_10344939 3300025910 Bacteria 1282
94 Ga0207671_10240742 3300025914 Bacteria 1421
95 Ga0207693_10001746 3300025915 Bacteria 19070
96 Ga0207693_10002056 3300025915 Bacteria 17601
97 Ga0207693_10003438 3300025915 Bacteria 13513
98 Ga0207693_10014973 3300025915 Bacteria 6229
99 Ga0207663_10041162 3300025916 Bacteria 2813
100 Ga0207663_10232206 3300025916 Bacteria 1348
101 Ga0207660_10192135 3300025917 Bacteria 1590
102 Ga0207646_10002821 3300025922 Bacteria 20211
103 Ga0207646_10030022 3300025922 Bacteria 4934
104 Ga0207687_10019056 3300025927 Bacteria 4542
105 Ga0207700_10075205 3300025928 Bacteria 2616
106 Ga0207664_10000258 3300025929 Bacteria 39880
107 Ga0207664_10059808 3300025929 Bacteria 3036
108 Ga0207706_10009659 3300025933 Bacteria 8855
109 Ga0207665_10007050 3300025939 Bacteria 7442
110 Ga0207712_10010261 3300025961 Bacteria 5942
111 Ga0207658_10003057 3300025986 Bacteria 11974
112 Ga0207677_10197649 3300026023 Unclassified 1596
113 Ga0207708_10167631 3300026075 Unclassified 1737
114 Ga0207675_100003285 3300026118 Bacteria 15838
115 Ga0207675_100057954 3300026118 Bacteria 3615
116 Ga0207683_10026200 3300026121 Bacteria 5032
117 Ga0207683_10036562 3300026121 Bacteria 4277
118 Ga0207428_10003830 3300027907 Bacteria 14427
119 Ga0268266_10000781 3300028379 Bacteria 42591
120 Ga0265336_10002103 3300028666 Bacteria 8455
121 Ga0265338_10024201 3300028800 Bacteria 6212
122 Ga0265338_10046427 3300028800 Bacteria 3980
123 Ga0265338_10171752 3300028800 Bacteria 1662
124 Ga0373950_0011601 3300034818 Bacteria 1442
125 Ga0373940_0001106 3300035088 Bacteria 4688
126 Ga0373944_0009700 3300035089 Bacteria 2615
127 Ga0373949_0005659 3300035090 Bacteria 2781
128 Ga0373923_0032506 3300035111 Bacteria 2108
129 Ga0373953_0043230 3300035117 Bacteria 1798
130 Ga0373954_0054734 3300035118 Bacteria 1877
131 Ga0373943_0007183 3300035170 Bacteria 4997
132 Ga0373943_0080276 3300035170 Bacteria 1671
133 Ga0373946_0004634 3300035171 Bacteria 4932
134 Ga0373961_0004486 3300035241 Bacteria 3374
135 Ga0373937_0061174 3300036401 Unclassified 3461
136 Ga0316582_0125055 3300036647 Bacteria 1724
137 Ga0373925_0154244 3300037068 Bacteria 1805
138 Ga0395899_0177768 3300037312 Bacteria 1495
139 Ga0395900_0020570 3300037418 Bacteria 6739
140 Ga0395898_0026190 3300037466 Bacteria 5870
141 Ga0395905_0024363 3300037471 Bacteria 5712
142 Ga0436364_0489596 3300037853 Bacteria 1187
143 Ga0395901_0005750 3300038443 Bacteria 12560
144 Ga0395901_0150599 3300038443 Bacteria 2444
145 Ga0395901_0166043 3300038443 Bacteria 2318
146 Ga0451839_0247785 3300041496 Bacteria 2160
147 Ga0451841_0952119 3300041498 Bacteria 2527
148 Ga0451849_0096075 3300041505 Bacteria 1566
149 Ga0451855_0811157 3300041511 Bacteria 964
150 Ga0451853_2698041 3300041512 Bacteria 2173
151 Ga0439463_034144 3300042016 Bacteria 1287
152 Ga0466969_0026226 3300044656 Bacteria 2990
153 Ga0466966_0019219 3300044684 Bacteria 4496
154 Ga0466961_0001142 3300044693 Bacteria 16299
155 Ga0466963_0063475 3300044694 Bacteria 2472
156 Ga0466963_0217414 3300044694 Bacteria 1338
157 Ga0466971_0064181 3300044719 Bacteria 1662
158 Ga0466957_0028973 3300044842 Bacteria 3298
159 Ga0466960_0074879 3300044901 Bacteria 1693
160 Ga0466959_0059201 3300045049 Bacteria 2789
161 Ga0466958_0041286 3300045836 Bacteria 2774
162 Ga0495603_0049473 3300046455 Bacteria 2502
163 Ga0495641_0006154 3300046461 Bacteria 7848
164 Ga0495653_0012733 3300046463 Bacteria 6870
165 Ga0495582_0001452 3300046473 Bacteria 13391
166 Ga0495582_0020655 3300046473 Bacteria 3606
167 Ga0495582_0031088 3300046473 Bacteria 2934
168 Ga0495639_0015051 3300046475 Bacteria 3353
169 Ga0495662_0002947 3300046476 Bacteria 8590
170 Ga0495584_0036274 3300046491 Bacteria 2491
171 Ga0495596_0051004 3300046500 Bacteria 1621
172 Ga0495608_0054921 3300046511 Bacteria 2632
173 Ga0495608_0153262 3300046511 Bacteria 1468
174 Ga0495637_0172718 3300046520 Bacteria 805
175 Ga0495666_0001478 3300046526 Bacteria 11481
176 Ga0495665_0007439 3300046531 Bacteria 5925
177 Ga0495587_0052193 3300046536 Bacteria 2413
178 Ga0495587_0161886 3300046536 Bacteria 1273
179 Ga0495656_0042539 3300046615 Bacteria 1903
180 Ga0495634_0004107 3300046642 Bacteria 11530
181 Ga0495635_0000984 3300046663 Bacteria 18764
182 Ga0495588_0000647 3300046674 Bacteria 16200
183 Ga0495588_0007504 3300046674 Bacteria 4967
184 Ga0495657_0026672 3300046675 Bacteria 4089
185 Ga0495647_0030560 3300046681 Bacteria 1999
186 Ga0495647_0035415 3300046681 Bacteria 1874
187 Ga0495658_0024904 3300046683 Bacteria 3194
188 Ga0495658_0121497 3300046683 Bacteria 1580
189 Ga0495613_0097671 3300046689 Bacteria 2122
190 Ga0495624_0046564 3300046690 Bacteria 2757
191 Ga0495600_0002275 3300046809 Bacteria 10941
192 Ga0495581_0082282 3300047315 Bacteria 1864
193 Ga0495604_0050122 3300047317 Bacteria 3242
194 Ga0495676_0038774 3300047321 Bacteria 3954
195 Ga0495676_0058120 3300047321 Bacteria 3045
196 Ga0495684_0002326 3300047471 Bacteria 15207
197 Ga0495593_0111204 3300047673 Bacteria 1399
198 Ga0495614_0007109 3300048089 Bacteria 4991
199 Ga0495615_0022397 3300048090 Bacteria 1437
200 Ga0496100_0063929 3300048903 Bacteria 2433
201 Ga0496101_0277699 3300048904 Bacteria 1309
202 Ga0496102_0184294 3300048905 Bacteria 1967
203 Ga0496103_0013739 3300048906 Bacteria 4805
204 Ga0496103_0026335 3300048906 Bacteria 3521
205 Ga0496103_0032720 3300048906 Bacteria 3174
206 Ga0496104_0011327 3300048907 Bacteria 7983
207 Ga0496104_0011816 3300048907 Bacteria 7834
208 Ga0496104_0156123 3300048907 Bacteria 2189
209 Ga0496105_0089009 3300048908 Bacteria 2550
210 Ga0496106_0005383 3300048909 Bacteria 9467
211 Ga0496106_0122477 3300048909 Bacteria 2034
212 Ga0496106_0286154 3300048909 Bacteria 1321
213 Ga0496107_0004361 3300048910 Bacteria 9580
214 Ga0496107_0213637 3300048910 Bacteria 1434
215 Ga0496108_0005600 3300048911 Bacteria 10164
216 Ga0496109_0008754 3300048912 Bacteria 8617
217 Ga0496109_0016070 3300048912 Bacteria 6540
218 Ga0496109_0100649 3300048912 Bacteria 2681
219 Ga0496109_0184409 3300048912 Bacteria 1961
220 Ga0496110_0023075 3300048913 Bacteria 5291
221 Ga0496110_0266892 3300048913 Bacteria 1558
222 Ga0496110_0418001 3300048913 Bacteria 1222
223 Ga0496111_0151575 3300048914 Unclassified 1719
224 Ga0496112_0005178 3300048915 Bacteria 11212
225 Ga0496112_0007430 3300048915 Bacteria 9726
226 Ga0496113_0066489 3300048916 Bacteria 2731
227 Ga0496113_0194768 3300048916 Bacteria 1609
228 Ga0496114_0015820 3300048917 Bacteria 6070
229 Ga0496115_0016446 3300048918 Bacteria 5634
230 Ga0496116_0000120 3300048919 Bacteria 166804
231 Ga0496118_0001146 3300048921 Bacteria 40888
232 Ga0496118_0122914 3300048921 Bacteria 1687
233 Ga0496119_0003031 3300048922 Bacteria 17784
234 Ga0496119_0008829 3300048922 Bacteria 8768
235 Ga0496119_0015732 3300048922 Bacteria 5801
236 Ga0496119_0077524 3300048922 Unclassified 1925
237 Ga0496120_0019679 3300048923 Unclassified 4311
238 Ga0496121_0010929 3300048924 Bacteria 10140
239 Ga0496121_0022712 3300048924 Bacteria 6072
240 Ga0496121_0200271 3300048924 Bacteria 1424
241 Ga0496124_0241522 3300048927 Bacteria 1343
242 Ga0496124_0266405 3300048927 Bacteria 1257
243 Ga0496125_0022786 3300048928 Bacteria 5806
244 Ga0496125_0045398 3300048928 Bacteria 3698
245 Ga0496126_0022414 3300048929 Bacteria 6147
246 Ga0496126_0143800 3300048929 Bacteria 2050
247 Ga0496126_0189525 3300048929 Bacteria 1743
248 Ga0501031_0039722 3300049568 Bacteria 3071
249 Ga0501032_0041643 3300049569 Bacteria 3118
250 Ga0501033_0114494 3300049570 Bacteria 1960
251 Ga0501034_0138148 3300049571 Bacteria 2417
252 Ga0501036_0048692 3300049572 Bacteria 3588
253 Ga0501039_0179907 3300049575 Bacteria 1663
254 Ga0501043_0002140 3300049579 Bacteria 16870
255 Ga0501046_0001831 3300049580 Bacteria 20273
256 Ga0501047_0023553 3300049581 Bacteria 5909
257 Ga0501047_0039258 3300049581 Bacteria 4579
258 Ga0501067_0155675 3300049583 Bacteria 1273
259 Ga0501069_0149664 3300049585 Bacteria 1341
260 Ga0501070_0004723 3300049586 Bacteria 11667
261 Ga0501070_0103897 3300049586 Bacteria 2349
262 Ga0501070_0145598 3300049586 Bacteria 1955
263 Ga0501070_0218981 3300049586 Bacteria 1561
264 Ga0501071_0213933 3300049587 Bacteria 1450
265 Ga0501072_0099745 3300049588 Bacteria 2308
266 Ga0501072_0196370 3300049588 Bacteria 1609
267 Ga0501073_0058473 3300049589 Bacteria 2694
268 Ga0501073_0060247 3300049589 Bacteria 2649
269 Ga0501074_0071676 3300049590 Bacteria 2490
270 Ga0501074_0077228 3300049590 Bacteria 2390
271 Ga0501079_0072398 3300049741 Bacteria 2663
272 Ga0501079_0230634 3300049741 Bacteria 1446
273 Ga0501080_0010978 3300049742 Bacteria 8291
274 Ga0501083_0007397 3300049744 Bacteria 7789
275 Ga0501083_0215446 3300049744 Bacteria 1251
276 Ga0501035_0028315 3300049822 Bacteria 5115
277 Ga0501044_0035974 3300049823 Bacteria 5182
278 Ga0501044_0205248 3300049823 Bacteria 1927
279 Ga0501044_0359073 3300049823 Bacteria 1375
280 Ga0501045_0137311 3300049824 Bacteria 1818
281 nmdc:mga0yw44_141619_c1 3300050492 Unclassified 1563
282 nmdc:mga0yw44_14400_c1 3300050492 Bacteria 4200
283 nmdc:mga0yw44_14432_c1 3300050492 Bacteria 4196
284 nmdc:mga0yw44_9919_c1 3300050492 Bacteria 4841
285 nmdc:mga05p37_142808_c1 3300050507 Bacteria 2932
286 nmdc:mga05p37_186171_c1 3300050507 Bacteria 2524
287 nmdc:mga05p37_349809_c1 3300050507 Bacteria 1740
288 nmdc:mga05p37_441775_c1 3300050507 Bacteria 1508
289 nmdc:mga09592_685_c1 3300050508 Bacteria 25881
290 nmdc:mga06r32_28791_c1 3300050510 Bacteria 5201
291 nmdc:mga06r32_86333_c1 3300050510 Bacteria 3060
292 nmdc:mga08y16_45111_c1 3300050511 Bacteria 4618
293 nmdc:mga08y16_59219_c1 3300050511 Bacteria 4001
294 nmdc:mga0n895_348063_c1 3300050512 Bacteria 1501
295 nmdc:mga0n895_67292_c1 3300050512 Bacteria 3548
296 nmdc:mga0rr50_10463_c1 3300050513 Bacteria 5887
297 nmdc:mga08x19_19844_c1 3300050514 Bacteria 4131
298 nmdc:mga08x19_8800_c1 3300050514 Bacteria 6023
299 nmdc:mga0a205_119138_c1 3300050515 Unclassified 2538
300 nmdc:mga0a205_119449_c1 3300050515 Bacteria 2535
301 Ga0495601_0008638 3300053077 Bacteria 6011
302 Ga0495601_0033372 3300053077 Bacteria 3207
303 Ga0495612_0000101 3300053078 Bacteria 36451
304 Ga0495612_0026680 3300053078 Bacteria 2321
305 Ga0495595_0025759 3300053084 Bacteria 2608
306 Ga0495619_0002373 3300053085 Bacteria 12385
307 Ga0495619_0028825 3300053085 Bacteria 3582
308 Ga0495619_0152645 3300053085 Bacteria 1593
309 Ga0495619_0281587 3300053085 Bacteria 1152
310 Ga0500556_0000288 3300053104 Bacteria 39530
311 Ga0500595_023607 3300053119 Bacteria 2158
312 Ga0500616_0000637 3300053153 Bacteria 42393
313 Ga0500599_034515 3300053736 Bacteria 762
314 Ga0466962_0018847 3300061719 Bacteria 3316
315 Ga0496100_0008543
316 Ga0070690_100162839
317 Ga0068869_100155210
318 Ga0070680_100070238
319 Ga0070682_100013950
320 Ga0068868_100037616
321 Ga0070691_10193752
322 Ga0070692_10018159
323 Ga0070674_100206481
324 Ga0070709_10114502
325 Ga0070714_100005210
326 Ga0070714_100064610
327 Ga0070714_100073220
328 Ga0070713_100112703
329 Ga0070713_100197690
330 Ga0070711_100051655
331 Ga0070711_100082725
332 Ga0070711_100100043
333 Ga0070711_100168673
334 Ga0070700_100130373
335 Ga0070694_100066174
336 Ga0070708_100007055
337 Ga0070708_100026799
338 Ga0070708_100201790
339 Ga0070708_100273277
340 Ga0070678_100071875
341 Ga0070678_100096497
342 Ga0070662_100146053
343 Ga0070681_10166256
344 Ga0070707_100010491
345 Ga0070707_100018741
346 Ga0070698_100003138
347 Ga0070699_100034396
348 Ga0070699_100387413
349 Ga0070697_100101962
350 Ga0070693_100053816
351 Ga0070665_100077064
352 Ga0070704_100259209
353 Ga0070704_100521983
354 Ga0068855_100103731
355 Ga0070702_100021387
356 Ga0070702_100068017
357 Ga0070702_100070399
358 Ga0068861_100009634
359 Ga0081455_10005423
360 Ga0081455_10008074
361 Ga0081455_10096967
362 Ga0075365_10001602
363 Ga0075365_10002630
364 Ga0075365_10004043
365 Ga0075365_10068338
366 Ga0070712_100002182
367 Ga0070712_100043101
368 Ga0070712_100119834
369 Ga0075428_100051093
370 Ga0075428_100080093
371 Ga0075431_100002597
372 Ga0075431_100049096
373 Ga0075433_10009373
374 Ga0075433_10138238
375 Ga0075434_100138964
376 Ga0075429_100002416
377 Ga0068865_100032387
378 Ga0075436_100016452
379 Ga0075435_100006670
380 Ga0075435_100146792
381 Ga0111539_10016128
382 Ga0111539_10127025
383 Ga0105245_10005290
384 Ga0105245_10025395
385 Ga0114129_10003391
386 Ga0114129_10024298
387 Ga0114129_10181444
388 Ga0114129_10227722
389 Ga0114129_10345963
390 Ga0114129_10354681
391 Ga0114129_10409159
392 Ga0105243_10030403
393 Ga0105243_10043494
394 Ga0105241_10227414
395 Ga0105237_10488228
396 Ga0105249_10007134
397 Ga0105249_10260803
398 Ga0105239_10098792
399 Ga0157371_10121261
400 Ga0157378_10067214
401 Ga0163162_10280861
402 Ga0157375_10188248
403 Ga0207653_10004076
404 Ga0207688_10127190
405 Ga0207645_10291363
406 Ga0207684_10050117
407 Ga0207684_10344939
408 Ga0207671_10240742
409 Ga0207693_10001746
410 Ga0207693_10002056
411 Ga0207693_10003438
412 Ga0207693_10014973
413 Ga0207663_10041162
414 Ga0207663_10232206
415 Ga0207660_10192135
416 Ga0207646_10002821
417 Ga0207646_10030022
418 Ga0207687_10019056
419 Ga0207700_10075205
420 Ga0207664_10000258
421 Ga0207664_10059808
422 Ga0207706_10009659
423 Ga0207665_10007050
424 Ga0207712_10010261
425 Ga0207658_10003057
426 Ga0207677_10197649
427 Ga0207708_10167631
428 Ga0207675_100003285
429 Ga0207675_100057954
430 Ga0207683_10026200
431 Ga0207683_10036562
432 Ga0207428_10003830
433 Ga0268266_10000781
434 Ga0265336_10002103
435 Ga0265338_10024201
436 Ga0265338_10046427
437 Ga0265338_10171752
438 Ga0373950_0011601
439 Ga0373940_0001106
440 Ga0373944_0009700
441 Ga0373949_0005659
442 Ga0373923_0032506
443 Ga0373953_0043230
444 Ga0373954_0054734
445 Ga0373943_0007183
446 Ga0373943_0080276
447 Ga0373946_0004634
448 Ga0373961_0004486
449 Ga0373937_0061174
450 Ga0316582_0125055
451 Ga0373925_0154244
452 Ga0395899_0177768
453 Ga0395900_0020570
454 Ga0395898_0026190
455 Ga0395905_0024363
456 Ga0436364_0489596
457 Ga0395901_0005750
458 Ga0395901_0150599
459 Ga0395901_0166043
460 Ga0451839_0247785
461 Ga0451841_0952119
462 Ga0451849_0096075
463 Ga0451855_0811157
464 Ga0451853_2698041
465 Ga0439463_034144
466 Ga0466969_0026226
467 Ga0466966_0019219
468 Ga0466961_0001142
469 Ga0466963_0063475
470 Ga0466963_0217414
471 Ga0466971_0064181
472 Ga0466957_0028973
473 Ga0466960_0074879
474 Ga0466959_0059201
475 Ga0466958_0041286
476 Ga0495603_0049473
477 Ga0495641_0006154
478 Ga0495653_0012733
479 Ga0495582_0001452
480 Ga0495582_0020655
481 Ga0495582_0031088
482 Ga0495639_0015051
483 Ga0495662_0002947
484 Ga0495584_0036274
485 Ga0495596_0051004
486 Ga0495608_0054921
487 Ga0495608_0153262
488 Ga0495637_0172718
489 Ga0495666_0001478
490 Ga0495665_0007439
491 Ga0495587_0052193
492 Ga0495587_0161886
493 Ga0495656_0042539
494 Ga0495634_0004107
495 Ga0495635_0000984
496 Ga0495588_0000647
497 Ga0495588_0007504
498 Ga0495657_0026672
499 Ga0495647_0030560
500 Ga0495647_0035415
501 Ga0495658_0024904
502 Ga0495658_0121497
503 Ga0495613_0097671
504 Ga0495624_0046564
505 Ga0495600_0002275
506 Ga0495581_0082282
507 Ga0495604_0050122
508 Ga0495676_0038774
509 Ga0495676_0058120
510 Ga0495684_0002326
511 Ga0495593_0111204
512 Ga0495614_0007109
513 Ga0495615_0022397
514 Ga0496100_0063929
515 Ga0496101_0277699
516 Ga0496102_0184294
517 Ga0496103_0013739
518 Ga0496103_0026335
519 Ga0496103_0032720
520 Ga0496104_0011327
521 Ga0496104_0011816
522 Ga0496104_0156123
523 Ga0496105_0089009
524 Ga0496106_0005383
525 Ga0496106_0122477
526 Ga0496106_0286154
527 Ga0496107_0004361
528 Ga0496107_0213637
529 Ga0496108_0005600
530 Ga0496109_0008754
531 Ga0496109_0016070
532 Ga0496109_0100649
533 Ga0496109_0184409
534 Ga0496110_0023075
535 Ga0496110_0266892
536 Ga0496110_0418001
537 Ga0496111_0151575
538 Ga0496112_0005178
539 Ga0496112_0007430
540 Ga0496113_0066489
541 Ga0496113_0194768
542 Ga0496114_0015820
543 Ga0496115_0016446
544 Ga0496116_0000120
545 Ga0496118_0001146
546 Ga0496118_0122914
547 Ga0496119_0003031
548 Ga0496119_0008829
549 Ga0496119_0015732
550 Ga0496119_0077524
551 Ga0496120_0019679
552 Ga0496121_0010929
553 Ga0496121_0022712
554 Ga0496121_0200271
555 Ga0496124_0241522
556 Ga0496124_0266405
557 Ga0496125_0022786
558 Ga0496125_0045398
559 Ga0496126_0022414
560 Ga0496126_0143800
561 Ga0496126_0189525
562 Ga0501031_0039722
563 Ga0501032_0041643
564 Ga0501033_0114494
565 Ga0501034_0138148
566 Ga0501036_0048692
567 Ga0501039_0179907
568 Ga0501043_0002140
569 Ga0501046_0001831
570 Ga0501047_0023553
571 Ga0501047_0039258
572 Ga0501067_0155675
573 Ga0501069_0149664
574 Ga0501070_0004723
575 Ga0501070_0103897
576 Ga0501070_0145598
577 Ga0501070_0218981
578 Ga0501071_0213933
579 Ga0501072_0099745
580 Ga0501072_0196370
581 Ga0501073_0058473
582 Ga0501073_0060247
583 Ga0501074_0071676
584 Ga0501074_0077228
585 Ga0501079_0072398
586 Ga0501079_0230634
587 Ga0501080_0010978
588 Ga0501083_0007397
589 Ga0501083_0215446
590 Ga0501035_0028315
591 Ga0501044_0035974
592 Ga0501044_0205248
593 Ga0501044_0359073
594 Ga0501045_0137311
595 nmdc:mga0yw44_141619_c1
596 nmdc:mga0yw44_14400_c1
597 nmdc:mga0yw44_14432_c1
598 nmdc:mga0yw44_9919_c1
599 nmdc:mga05p37_142808_c1
600 nmdc:mga05p37_186171_c1
601 nmdc:mga05p37_349809_c1
602 nmdc:mga05p37_441775_c1
603 nmdc:mga09592_685_c1
604 nmdc:mga06r32_28791_c1
605 nmdc:mga06r32_86333_c1
606 nmdc:mga08y16_45111_c1
607 nmdc:mga08y16_59219_c1
608 nmdc:mga0n895_348063_c1
609 nmdc:mga0n895_67292_c1
610 nmdc:mga0rr50_10463_c1
611 nmdc:mga08x19_19844_c1
612 nmdc:mga08x19_8800_c1
613 nmdc:mga0a205_119138_c1
614 nmdc:mga0a205_119449_c1
615 Ga0495601_0008638
616 Ga0495601_0033372
617 Ga0495612_0000101
618 Ga0495612_0026680
619 Ga0495595_0025759
620 Ga0495619_0002373
621 Ga0495619_0028825
622 Ga0495619_0152645
623 Ga0495619_0281587
624 Ga0500556_0000288
625 Ga0500595_023607
626 Ga0500616_0000637
627 Ga0500599_034515
628 Ga0466962_0018847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

149

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9198 1 297
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9198 2 299
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.8885 2 299
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8856 1 297
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.8721 2 293
ID Description Score Start End Superfamily
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9324 1 297 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.931 1 299 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8993 30 297 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8986 1 299 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8625 30 297 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A536JGZ0-F1-model_v4 Ring-cleaving dioxygenase 0.9824 2 256 GO:0051213
AF-A0A538G9G0-F1-model_v4 Ring-cleaving dioxygenase 0.9811 2 304 GO:0051213
AF-A0A535DKE5-F1-model_v4 Ring-cleaving dioxygenase 0.9798 1 186 GO:0051213
AF-A0A6L5G1G5-F1-model_v4 VOC domain-containing protein 0.9782 2 229
AF-A0A6J6P1J2-F1-model_v4 Unannotated protein 0.9759 1 303

Map