F402372

General Info

Members Datasets Scaffolds Average Seq Length
313 220 626 123

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0957881|Ga0496111_0957881_118_540
Length 140
Sequence MIHSSRGGSKGNKMQSGLKQQHGISLIGLIIVLAALGFVGVLGMKIVPTYTEFRAINNAITTAKASGGSVVEMQKSFDASATASYISSISGRDLIIGKENGETEISFAYEKKIPLVGPASLLLEYEGTTAKAGAKPAKTE

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
161 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
162 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
163 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
166 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
173 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
174 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
175 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 2643221664 Massilia sp. Root418 Isolate Unclassified
205 2738541280 Massilia sp. GV090 Isolate Unclassified
206 2738541297 Duganella sp. GV083 Isolate Unclassified
207 2738541300 Massilia sp. GV016 Isolate Unclassified
208 2738541357 Duganella sp. GV053 Isolate Unclassified
209 2738543003 Duganella sp. GV066 Isolate Unclassified
210 2738543018 Massilia sp. GV045 Isolate Unclassified
211 2738543026 Duganella sp. GV089 Isolate Unclassified
212 2738543029 Duganella sp. GV039 Isolate Unclassified
213 2738543030 Massilia sp. GV097 Isolate Unclassified
214 2818991436 Collimonas arenae 515 Isolate Unclassified
215 2821131069 Duganella sp. 1224 Isolate Unclassified
216 2842711865 Duganella sp. R-73148 Isolate Unclassified
217 2857558681 Duganella sp. R-74565 Isolate Unclassified
218 2857564685 Duganella sp. R-74599 Isolate Unclassified
219 2904424332 Duganella sp. 1411 Isolate Rhizosphere
220 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.32
Metatranscriptomes 17.25
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.93
Nodule 0
Rhizoplane 2.24
Rhizosphere 70.93
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0957881 3300048914 Bacteria 614
2 JGI25162J39368_1000036 3300002737 Bacteria 180433
3 JGI25154J39366_1000851 3300002738 Bacteria 13237
4 JGI25158J39367_1031273 3300002739 Bacteria 599
5 JGI25150J39212_1001679 3300002774 Bacteria 5992
6 JGI25159J45721_1006899 3300002987 Bacteria 3323
7 Ga0006759J45824_1093900 3300003163 Bacteria 1453
8 JGI25151J46595_10070095 3300003187 Bacteria 1066
9 JGI25165J46597_1000022 3300003214 Bacteria 357959
10 JGI25153J46596_10030988 3300003215 Bacteria 1809
11 Ga0006758J48902_1044058 3300003300 Bacteria 580
12 Ga0006777J48905_1010541 3300003308 Bacteria 1257
13 rootH1_10077238 3300003316 Bacteria 1017
14 rootH2_10157657 3300003320 Bacteria 1237
15 rootL2_10085282 3300003322 Bacteria 1434
16 JGI25161J50226_1014672 3300003374 Bacteria 871
17 Ga0007417J51691_1049396 3300003544 Bacteria 1814
18 Ga0007417J51691_1057632 3300003544 Bacteria 2960
19 Ga0007410J51695_1053680 3300003574 Bacteria 4218
20 Ga0007410J51695_1058877 3300003574 Bacteria 1537
21 Ga0007409J51694_1024066 3300003575 Bacteria 1617
22 Ga0007416J51690_1045476 3300003577 Bacteria 6861
23 Ga0007429J51699_1036128 3300003579 Bacteria 1196
24 Ga0032354_1059770 3300003693 Bacteria 2436
25 Ga0055538_1000011 3300003751 Bacteria 357959
26 Ga0055539_1000016 3300003752 Bacteria 358248
27 Ga0055533_1000019 3300003756 Bacteria 357959
28 Ga0055525_1000042 3300003759 Bacteria 279804
29 Ga0055527_1022447 3300003760 Bacteria 652
30 Ga0055529_1000403 3300003763 Bacteria 45873
31 Ga0055526_1000018 3300003771 Bacteria 198838
32 Ga0055526_1000029 3300003771 Bacteria 148855
33 Ga0055526_1072066 3300003771 Bacteria 697
34 Ga0055537_1014307 3300003773 Bacteria 1447
35 Ga0055524_1064410 3300003775 Bacteria 740
36 Ga0055541_1000017 3300003841 Bacteria 286811
37 Ga0055543_1002731 3300004625 Bacteria 5632
38 Ga0065165_1007084 3300005262 Bacteria 5632
39 Ga0065165_1100268 3300005262 Bacteria 725
40 Ga0065704_10281781 3300005289 Bacteria 921
41 Ga0070660_100007425 3300005339 Bacteria 7639
42 Ga0070661_100003540 3300005344 Bacteria 10762
43 Ga0070659_100000834 3300005366 Bacteria 22483
44 Ga0070662_100232795 3300005457 Bacteria 1474
45 Ga0070664_100009402 3300005564 Bacteria 7926
46 Ga0070717_10252286 3300006028 Bacteria 1559
47 Ga0105244_10016627 3300009036 Bacteria 4185
48 Ga0105244_10060808 3300009036 Bacteria 1903
49 Ga0157378_10783453 3300013297 Bacteria 978
50 Ga0163162_10368723 3300013306 Bacteria 1569
51 Ga0182006_1006909 3300015261 Bacteria 5229
52 Ga0182007_10027580 3300015262 Bacteria 1956
53 Ga0182007_10151892 3300015262 Bacteria 788
54 Ga0182007_10367134 3300015262 Bacteria 544
55 Ga0182005_1001336 3300015265 Bacteria 10073
56 Ga0213872_10001009 3300021361 Bacteria 19647
57 Ga0209760_101383 3300025207 Bacteria 2594
58 Ga0209436_102802 3300025208 Bacteria 4962
59 Ga0209784_100019 3300025224 Bacteria 453558
60 Ga0209566_100017 3300025225 Bacteria 453558
61 Ga0209674_100031 3300025226 Bacteria 453558
62 Ga0209672_105257 3300025228 Bacteria 2249
63 Ga0209563_100035 3300025230 Bacteria 453558
64 Ga0207427_100255 3300025231 Bacteria 41856
65 Ga0209437_100038 3300025233 Bacteria 453558
66 Ga0209437_110164 3300025233 Bacteria 1446
67 Ga0207425_1000823 3300025245 Bacteria 15507
68 Ga0209646_1000174 3300025246 Bacteria 84479
69 Ga0209677_100020 3300025253 Bacteria 453558
70 Ga0209233_1000049 3300025261 Bacteria 453558
71 Ga0209565_1005128 3300025263 Bacteria 3852
72 Ga0209455_1000037 3300025272 Bacteria 464097
73 Ga0209130_1002124 3300025284 Bacteria 10543
74 Ga0209025_1005680 3300025294 Bacteria 10050
75 Ga0209564_1000009 3300025295 Bacteria 950196
76 Ga0209564_1000068 3300025295 Bacteria 311171
77 Ga0209564_1000124 3300025295 Bacteria 202046
78 Ga0209758_1002044 3300025297 Bacteria 21637
79 Ga0209256_1006340 3300025299 Bacteria 6313
80 Ga0207655_1016744 3300025728 Bacteria 3994
81 Ga0207655_1045144 3300025728 Bacteria 1843
82 Ga0207705_11404675 3300025909 Bacteria 531
83 Ga0207657_10004625 3300025919 Bacteria 14536
84 Ga0207649_10024297 3300025920 Bacteria 3521
85 Ga0207690_10002865 3300025932 Bacteria 10389
86 Ga0207679_10003527 3300025945 Bacteria 9684
87 Ga0316181_1030416 3300030744 Bacteria 1890
88 Ga0307408_100001605 3300031548 Bacteria 16725
89 Ga0307408_100415518 3300031548 Bacteria 1158
90 Ga0307416_100091281 3300032002 Bacteria 2615
91 Ga0373939_0031884 3300035114 Bacteria 1527
92 Ga0395899_0001365 3300037312 Bacteria 20926
93 Ga0395900_0173772 3300037418 Bacteria 2192
94 Ga0395905_0089253 3300037471 Bacteria 2889
95 Ga0395901_0000740 3300038443 Bacteria 36904
96 Ga0436361_0621103 3300039447 Bacteria 13225
97 Ga0439448_0191015 3300042005 Bacteria 717
98 Ga0466972_0068893 3300044658 Bacteria 1690
99 Ga0466965_0324456 3300044683 Bacteria 839
100 Ga0466966_0019707 3300044684 Bacteria 4438
101 Ga0466968_0303532 3300044735 Bacteria 768
102 Ga0466970_0001713 3300044765 Bacteria 10550
103 Ga0466959_0064409 3300045049 Bacteria 2661
104 Ga0495617_000041 3300046452 Bacteria 124027
105 Ga0495592_0172768 3300046454 Bacteria 1478
106 Ga0495590_0000001 3300046457 Bacteria 762984
107 Ga0495638_0000086 3300046460 Bacteria 152781
108 Ga0495638_0152616 3300046460 Bacteria 1339
109 Ga0495638_0404043 3300046460 Bacteria 708
110 Ga0495651_0047912 3300046462 Bacteria 3301
111 Ga0495651_0117910 3300046462 Bacteria 1953
112 Ga0495651_0388014 3300046462 Bacteria 914
113 Ga0495653_0000002 3300046463 Bacteria 507262
114 Ga0495653_0199141 3300046463 Bacteria 1360
115 Ga0495650_0000118 3300046471 Bacteria 187358
116 Ga0495650_0000417 3300046471 Bacteria 69289
117 Ga0495650_0001088 3300046471 Bacteria 29834
118 Ga0495650_0003310 3300046471 Bacteria 11889
119 Ga0495650_0005924 3300046471 Bacteria 7767
120 Ga0495605_0000168 3300046474 Bacteria 82889
121 Ga0495585_0002371 3300046492 Bacteria 13522
122 Ga0495607_0008915 3300046501 Bacteria 6830
123 Ga0495607_0009020 3300046501 Bacteria 6781
124 Ga0495583_0001635 3300046506 Bacteria 21854
125 Ga0495606_0000001 3300046507 Bacteria 592123
126 Ga0495606_0000011 3300046507 Bacteria 296816
127 Ga0495606_0000566 3300046507 Bacteria 58661
128 Ga0495606_0000679 3300046507 Bacteria 53237
129 Ga0495606_0011407 3300046507 Bacteria 7249
130 Ga0495606_0012354 3300046507 Bacteria 6857
131 Ga0495606_0066027 3300046507 Bacteria 2296
132 Ga0495606_0320183 3300046507 Bacteria 833
133 Ga0495608_0021284 3300046511 Bacteria 4451
134 Ga0495610_0000003 3300046512 Bacteria 1203910
135 Ga0495610_0002439 3300046512 Bacteria 15641
136 Ga0495610_0007492 3300046512 Bacteria 7252
137 Ga0495610_0016268 3300046512 Bacteria 4290
138 Ga0495610_0018981 3300046512 Bacteria 3862
139 Ga0495610_0053205 3300046512 Bacteria 1962
140 Ga0495610_0074750 3300046512 Bacteria 1571
141 Ga0495628_0001337 3300046516 Bacteria 22626
142 Ga0495628_0008867 3300046516 Bacteria 8604
143 Ga0495628_0060305 3300046516 Bacteria 2977
144 Ga0495637_0003140 3300046520 Bacteria 8818
145 Ga0495643_0000123 3300046522 Bacteria 124936
146 Ga0495643_0006977 3300046522 Bacteria 7346
147 Ga0495648_0000001 3300046524 Bacteria 696872
148 Ga0495648_0032206 3300046524 Bacteria 3443
149 Ga0495648_0078165 3300046524 Bacteria 1893
150 Ga0495648_0143904 3300046524 Bacteria 1251
151 Ga0495642_0003277 3300046528 Bacteria 6402
152 Ga0495642_0042564 3300046528 Bacteria 1850
153 Ga0495642_0074959 3300046528 Bacteria 1419
154 Ga0495652_0047737 3300046529 Bacteria 3671
155 Ga0495652_0194995 3300046529 Bacteria 1542
156 Ga0495654_0000038 3300046530 Bacteria 185693
157 Ga0495654_0024615 3300046530 Bacteria 3109
158 Ga0495654_0090790 3300046530 Bacteria 1418
159 Ga0495609_0054963 3300046538 Bacteria 1766
160 Ga0495597_0013492 3300046542 Bacteria 3910
161 Ga0495597_0028014 3300046542 Bacteria 2580
162 Ga0495597_0322549 3300046542 Bacteria 596
163 Ga0495645_0065889 3300046543 Bacteria 2620
164 Ga0495645_0111408 3300046543 Bacteria 1936
165 Ga0495622_0000028 3300046557 Bacteria 133197
166 Ga0495622_0019962 3300046557 Bacteria 3119
167 Ga0495633_0000096 3300046558 Bacteria 118933
168 Ga0495633_0004540 3300046558 Bacteria 8766
169 Ga0495633_0029092 3300046558 Bacteria 2688
170 Ga0495633_0074524 3300046558 Bacteria 1581
171 Ga0495633_0139373 3300046558 Bacteria 1121
172 Ga0495668_0000095 3300046616 Bacteria 141321
173 Ga0495668_0000151 3300046616 Bacteria 105466
174 Ga0495668_0003887 3300046616 Bacteria 10905
175 Ga0495668_0008497 3300046616 Bacteria 6399
176 Ga0495668_0617633 3300046616 Bacteria 599
177 Ga0495625_0000065 3300046660 Bacteria 173230
178 Ga0495625_0008774 3300046660 Bacteria 8566
179 Ga0495625_0046113 3300046660 Bacteria 3146
180 Ga0495625_0053391 3300046660 Bacteria 2890
181 Ga0495635_0977516 3300046663 Bacteria 539
182 Ga0495659_0001352 3300046664 Bacteria 8413
183 Ga0495657_0061770 3300046675 Bacteria 2478
184 Ga0495599_0080240 3300046678 Bacteria 2037
185 Ga0495623_0032914 3300046679 Bacteria 3330
186 Ga0495646_0004212 3300046680 Bacteria 9044
187 Ga0495624_0027889 3300046690 Bacteria 3693
188 Ga0495670_0057186 3300046691 Bacteria 1958
189 Ga0495671_0000001 3300046692 Bacteria 1169494
190 Ga0495671_0004607 3300046692 Bacteria 8196
191 Ga0495671_0024792 3300046692 Bacteria 3120
192 Ga0495671_0596076 3300046692 Bacteria 525
193 Ga0495649_0018739 3300046694 Bacteria 3889
194 Ga0495589_0198664 3300046794 Bacteria 947
195 Ga0495600_0174651 3300046809 Bacteria 1385
196 Ga0495660_0004503 3300046810 Bacteria 8427
197 Ga0495660_0055347 3300046810 Bacteria 2148
198 Ga0495660_0059594 3300046810 Bacteria 2052
199 Ga0495604_0052157 3300047317 Bacteria 3169
200 Ga0495674_0013247 3300047319 Bacteria 7753
201 Ga0495672_0000181 3300047320 Bacteria 91278
202 Ga0495672_0000366 3300047320 Bacteria 57469
203 Ga0495672_0000381 3300047320 Bacteria 54971
204 Ga0495687_004995 3300047443 Bacteria 8667
205 Ga0495677_0066144 3300047445 Bacteria 1344
206 Ga0495673_0000003 3300047469 Bacteria 1491337
207 Ga0495673_0000016 3300047469 Bacteria 580643
208 Ga0495673_0000188 3300047469 Bacteria 99425
209 Ga0495686_0000380 3300047472 Bacteria 71038
210 Ga0495686_0007663 3300047472 Bacteria 8058
211 Ga0495686_0012362 3300047472 Bacteria 5974
212 Ga0495602_0401382 3300048088 Bacteria 977
213 Ga0495614_0124185 3300048089 Bacteria 1140
214 Ga0495615_0013416 3300048090 Bacteria 1711
215 Ga0496101_0674052 3300048904 Bacteria 817
216 Ga0496103_0048626 3300048906 Bacteria 2621
217 Ga0496107_0097473 3300048910 Bacteria 2153
218 Ga0496114_0127799 3300048917 Bacteria 2192
219 Ga0496115_0002468 3300048918 Bacteria 13291
220 Ga0496115_0195718 3300048918 Bacteria 1670
221 Ga0496116_0116576 3300048919 Bacteria 1556
222 Ga0496118_0273882 3300048921 Bacteria 944
223 Ga0496119_0298769 3300048922 Bacteria 795
224 Ga0496121_0114311 3300048924 Bacteria 2052
225 Ga0496121_0398428 3300048924 Bacteria 902
226 Ga0496122_0092597 3300048925 Bacteria 2054
227 Ga0496123_0043183 3300048926 Bacteria 3100
228 Ga0496124_0196563 3300048927 Bacteria 1538
229 Ga0496124_0246846 3300048927 Bacteria 1323
230 Ga0496126_0041395 3300048929 Bacteria 4263
231 Ga0501306_080455 3300049127 Bacteria 561
232 Ga0501310_078351 3300049130 Unclassified 515
233 Ga0495678_005831 3300049459 Bacteria 6679
234 Ga0495678_014564 3300049459 Bacteria 3652
235 Ga0495678_137420 3300049459 Bacteria 803
236 Ga0501317_112527 3300049533 Unclassified 501
237 Ga0501034_1120959 3300049571 Unclassified 667
238 Ga0501210_018614 3300049657 Bacteria 637
239 Ga0501222_012009 3300049662 Bacteria 1141
240 Ga0501223_138227 3300049663 Bacteria 523
241 Ga0501227_004317 3300049665 Bacteria 3059
242 Ga0501227_024994 3300049665 Bacteria 1398
243 Ga0501249_007886 3300049679 Bacteria 2209
244 Ga0501269_000065 3300049766 Bacteria 33080
245 Ga0501279_000435 3300049775 Bacteria 5548
246 Ga0501279_002022 3300049775 Bacteria 2681
247 Ga0495601_0022162 3300053077 Bacteria 3899
248 Ga0495619_0810991 3300053085 Bacteria 633
249 Ga0500594_0010601 3300053118 Bacteria 2142
250 Ga0500595_006797 3300053119 Bacteria 4816
251 Ga0500618_000311 3300053125 Bacteria 35976
252 Ga0500618_033088 3300053125 Bacteria 1207
253 Ga0500574_001938 3300053141 Bacteria 3257
254 Ga0500586_029995 3300053145 Bacteria 1785
255 Ga0500586_068843 3300053145 Bacteria 1238
256 Ga0500619_020231 3300053154 Bacteria 1899
257 Ga0587084_000294 3300059477 Bacteria 3617
258 Ga0587084_000577 3300059477 Bacteria 3000
259 Ga0587093_015164 3300059478 Bacteria 970
260 Ga0587066_033795 3300059490 Bacteria 927
261 Ga0587066_084312 3300059490 Bacteria 694
262 Ga0587070_064922 3300059491 Bacteria 764
263 Ga0587077_020592 3300059493 Bacteria 1161
264 Ga0587077_062924 3300059493 Bacteria 809
265 Ga0587080_021627 3300059503 Bacteria 1059
266 Ga0587082_043066 3300059504 Bacteria 835
267 Ga0587082_105679 3300059504 Bacteria 619
268 Ga0587083_0051886 3300059505 Bacteria 897
269 Ga0587085_001132 3300059506 Bacteria 2356
270 Ga0587086_010760 3300059507 Bacteria 1113
271 Ga0587086_050754 3300059507 Bacteria 668
272 Ga0587088_028049 3300059508 Bacteria 988
273 Ga0587089_058860 3300059509 Bacteria 631
274 Ga0587090_037102 3300059510 Bacteria 842
275 Ga0587091_002803 3300059511 Bacteria 2116
276 Ga0587091_012582 3300059511 Bacteria 1343
277 Ga0587092_037183 3300059512 Bacteria 832
278 Ga0587094_020097 3300059513 Bacteria 963
279 Ga0587094_109873 3300059513 Unclassified 541
280 Ga0587101_014651 3300059623 Bacteria 1050
281 Ga0587109_071442 3300059624 Bacteria 751
282 Ga0587128_089574 3300059630 Bacteria 629
283 Ga0587062_005401 3300059639 Bacteria 1409
284 Ga0587068_018358 3300059641 Bacteria 1126
285 Ga0587068_065232 3300059641 Bacteria 708
286 Ga0587072_069963 3300059643 Bacteria 740
287 Ga0587076_000785 3300059645 Bacteria 2873
288 Ga0587076_001729 3300059645 Bacteria 2300
289 Ga0587076_018521 3300059645 Bacteria 1123
290 Ga0587079_035280 3300059647 Bacteria 983
291 Ga0587100_017590 3300059648 Bacteria 672
292 Ga0587102_008320 3300059649 Bacteria 984
293 Ga0587124_005555 3300059660 Bacteria 1012
294 Ga0587081_02342 3300060246 Bacteria 1146
295 Ga0587111_0012359 3300060346 Bacteria 1507
296 Ga0587111_0119439 3300060346 Bacteria 677
297 2644357848 2643221664 Bacteria 7272945
298 2738741294 2738541280 Bacteria 6630198
299 2738829164 2738541297 Bacteria 6549566
300 2738845764 2738541300 Bacteria 6675882
301 2739152960 2738541357 Bacteria 6549408
302 2739194880 2738543003 Bacteria 6549560
303 2739277572 2738543018 Bacteria 6718814
304 2739321356 2738543026 Bacteria 6549408
305 2739340088 2738543029 Bacteria 6549249
306 2739346505 2738543030 Bacteria 6719714
307 2819542532 2818991436 Bacteria 5376622
308 2821131636 2821131069 Bacteria 6108407
309 2842717730 2842711865 Bacteria 7155354
310 2857559431 2857558681 Bacteria 6617694
311 2857564703 2857564685 Bacteria 6290584
312 2904425961 2904424332 Bacteria 7633521
313 2919478406 2919476304 Bacteria 5888696
314 Ga0496111_0957881
315 JGI25162J39368_1000036
316 JGI25154J39366_1000851
317 JGI25158J39367_1031273
318 JGI25150J39212_1001679
319 JGI25159J45721_1006899
320 Ga0006759J45824_1093900
321 JGI25151J46595_10070095
322 JGI25165J46597_1000022
323 JGI25153J46596_10030988
324 Ga0006758J48902_1044058
325 Ga0006777J48905_1010541
326 rootH1_10077238
327 rootH2_10157657
328 rootL2_10085282
329 JGI25161J50226_1014672
330 Ga0007417J51691_1049396
331 Ga0007417J51691_1057632
332 Ga0007410J51695_1053680
333 Ga0007410J51695_1058877
334 Ga0007409J51694_1024066
335 Ga0007416J51690_1045476
336 Ga0007429J51699_1036128
337 Ga0032354_1059770
338 Ga0055538_1000011
339 Ga0055539_1000016
340 Ga0055533_1000019
341 Ga0055525_1000042
342 Ga0055527_1022447
343 Ga0055529_1000403
344 Ga0055526_1000018
345 Ga0055526_1000029
346 Ga0055526_1072066
347 Ga0055537_1014307
348 Ga0055524_1064410
349 Ga0055541_1000017
350 Ga0055543_1002731
351 Ga0065165_1007084
352 Ga0065165_1100268
353 Ga0065704_10281781
354 Ga0070660_100007425
355 Ga0070661_100003540
356 Ga0070659_100000834
357 Ga0070662_100232795
358 Ga0070664_100009402
359 Ga0070717_10252286
360 Ga0105244_10016627
361 Ga0105244_10060808
362 Ga0157378_10783453
363 Ga0163162_10368723
364 Ga0182006_1006909
365 Ga0182007_10027580
366 Ga0182007_10151892
367 Ga0182007_10367134
368 Ga0182005_1001336
369 Ga0213872_10001009
370 Ga0209760_101383
371 Ga0209436_102802
372 Ga0209784_100019
373 Ga0209566_100017
374 Ga0209674_100031
375 Ga0209672_105257
376 Ga0209563_100035
377 Ga0207427_100255
378 Ga0209437_100038
379 Ga0209437_110164
380 Ga0207425_1000823
381 Ga0209646_1000174
382 Ga0209677_100020
383 Ga0209233_1000049
384 Ga0209565_1005128
385 Ga0209455_1000037
386 Ga0209130_1002124
387 Ga0209025_1005680
388 Ga0209564_1000009
389 Ga0209564_1000068
390 Ga0209564_1000124
391 Ga0209758_1002044
392 Ga0209256_1006340
393 Ga0207655_1016744
394 Ga0207655_1045144
395 Ga0207705_11404675
396 Ga0207657_10004625
397 Ga0207649_10024297
398 Ga0207690_10002865
399 Ga0207679_10003527
400 Ga0316181_1030416
401 Ga0307408_100001605
402 Ga0307408_100415518
403 Ga0307416_100091281
404 Ga0373939_0031884
405 Ga0395899_0001365
406 Ga0395900_0173772
407 Ga0395905_0089253
408 Ga0395901_0000740
409 Ga0436361_0621103
410 Ga0439448_0191015
411 Ga0466972_0068893
412 Ga0466965_0324456
413 Ga0466966_0019707
414 Ga0466968_0303532
415 Ga0466970_0001713
416 Ga0466959_0064409
417 Ga0495617_000041
418 Ga0495592_0172768
419 Ga0495590_0000001
420 Ga0495638_0000086
421 Ga0495638_0152616
422 Ga0495638_0404043
423 Ga0495651_0047912
424 Ga0495651_0117910
425 Ga0495651_0388014
426 Ga0495653_0000002
427 Ga0495653_0199141
428 Ga0495650_0000118
429 Ga0495650_0000417
430 Ga0495650_0001088
431 Ga0495650_0003310
432 Ga0495650_0005924
433 Ga0495605_0000168
434 Ga0495585_0002371
435 Ga0495607_0008915
436 Ga0495607_0009020
437 Ga0495583_0001635
438 Ga0495606_0000001
439 Ga0495606_0000011
440 Ga0495606_0000566
441 Ga0495606_0000679
442 Ga0495606_0011407
443 Ga0495606_0012354
444 Ga0495606_0066027
445 Ga0495606_0320183
446 Ga0495608_0021284
447 Ga0495610_0000003
448 Ga0495610_0002439
449 Ga0495610_0007492
450 Ga0495610_0016268
451 Ga0495610_0018981
452 Ga0495610_0053205
453 Ga0495610_0074750
454 Ga0495628_0001337
455 Ga0495628_0008867
456 Ga0495628_0060305
457 Ga0495637_0003140
458 Ga0495643_0000123
459 Ga0495643_0006977
460 Ga0495648_0000001
461 Ga0495648_0032206
462 Ga0495648_0078165
463 Ga0495648_0143904
464 Ga0495642_0003277
465 Ga0495642_0042564
466 Ga0495642_0074959
467 Ga0495652_0047737
468 Ga0495652_0194995
469 Ga0495654_0000038
470 Ga0495654_0024615
471 Ga0495654_0090790
472 Ga0495609_0054963
473 Ga0495597_0013492
474 Ga0495597_0028014
475 Ga0495597_0322549
476 Ga0495645_0065889
477 Ga0495645_0111408
478 Ga0495622_0000028
479 Ga0495622_0019962
480 Ga0495633_0000096
481 Ga0495633_0004540
482 Ga0495633_0029092
483 Ga0495633_0074524
484 Ga0495633_0139373
485 Ga0495668_0000095
486 Ga0495668_0000151
487 Ga0495668_0003887
488 Ga0495668_0008497
489 Ga0495668_0617633
490 Ga0495625_0000065
491 Ga0495625_0008774
492 Ga0495625_0046113
493 Ga0495625_0053391
494 Ga0495635_0977516
495 Ga0495659_0001352
496 Ga0495657_0061770
497 Ga0495599_0080240
498 Ga0495623_0032914
499 Ga0495646_0004212
500 Ga0495624_0027889
501 Ga0495670_0057186
502 Ga0495671_0000001
503 Ga0495671_0004607
504 Ga0495671_0024792
505 Ga0495671_0596076
506 Ga0495649_0018739
507 Ga0495589_0198664
508 Ga0495600_0174651
509 Ga0495660_0004503
510 Ga0495660_0055347
511 Ga0495660_0059594
512 Ga0495604_0052157
513 Ga0495674_0013247
514 Ga0495672_0000181
515 Ga0495672_0000366
516 Ga0495672_0000381
517 Ga0495687_004995
518 Ga0495677_0066144
519 Ga0495673_0000003
520 Ga0495673_0000016
521 Ga0495673_0000188
522 Ga0495686_0000380
523 Ga0495686_0007663
524 Ga0495686_0012362
525 Ga0495602_0401382
526 Ga0495614_0124185
527 Ga0495615_0013416
528 Ga0496101_0674052
529 Ga0496103_0048626
530 Ga0496107_0097473
531 Ga0496114_0127799
532 Ga0496115_0002468
533 Ga0496115_0195718
534 Ga0496116_0116576
535 Ga0496118_0273882
536 Ga0496119_0298769
537 Ga0496121_0114311
538 Ga0496121_0398428
539 Ga0496122_0092597
540 Ga0496123_0043183
541 Ga0496124_0196563
542 Ga0496124_0246846
543 Ga0496126_0041395
544 Ga0501306_080455
545 Ga0501310_078351
546 Ga0495678_005831
547 Ga0495678_014564
548 Ga0495678_137420
549 Ga0501317_112527
550 Ga0501034_1120959
551 Ga0501210_018614
552 Ga0501222_012009
553 Ga0501223_138227
554 Ga0501227_004317
555 Ga0501227_024994
556 Ga0501249_007886
557 Ga0501269_000065
558 Ga0501279_000435
559 Ga0501279_002022
560 Ga0495601_0022162
561 Ga0495619_0810991
562 Ga0500594_0010601
563 Ga0500595_006797
564 Ga0500618_000311
565 Ga0500618_033088
566 Ga0500574_001938
567 Ga0500586_029995
568 Ga0500586_068843
569 Ga0500619_020231
570 Ga0587084_000294
571 Ga0587084_000577
572 Ga0587093_015164
573 Ga0587066_033795
574 Ga0587066_084312
575 Ga0587070_064922
576 Ga0587077_020592
577 Ga0587077_062924
578 Ga0587080_021627
579 Ga0587082_043066
580 Ga0587082_105679
581 Ga0587083_0051886
582 Ga0587085_001132
583 Ga0587086_010760
584 Ga0587086_050754
585 Ga0587088_028049
586 Ga0587089_058860
587 Ga0587090_037102
588 Ga0587091_002803
589 Ga0587091_012582
590 Ga0587092_037183
591 Ga0587094_020097
592 Ga0587094_109873
593 Ga0587101_014651
594 Ga0587109_071442
595 Ga0587128_089574
596 Ga0587062_005401
597 Ga0587068_018358
598 Ga0587068_065232
599 Ga0587072_069963
600 Ga0587076_000785
601 Ga0587076_001729
602 Ga0587076_018521
603 Ga0587079_035280
604 Ga0587100_017590
605 Ga0587102_008320
606 Ga0587124_005555
607 Ga0587081_02342
608 Ga0587111_0012359
609 Ga0587111_0119439
610 2644357848
611 2738741294
612 2738829164
613 2738845764
614 2739152960
615 2739194880
616 2739277572
617 2739321356
618 2739340088
619 2739346505
620 2819542532
621 2821131636
622 2842717730
623 2857559431
624 2857564703
625 2904425961
626 2919478406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

45

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yfa-assembly1.cif.gz_AA virus-like particle of bacteriophage ave015 0.7559 93 119
4oqe-assembly1.cif.gz_A crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme 0.7534 84 118
7f25-assembly1.cif.gz_B crystal structure of ssb from salmonella enterica serovar typhimurium lt2. 0.7269 83 118
8huc-assembly2.cif.gz_B crystal structure of paich (pec1) 0.6942 84 118
3udg-assembly1.cif.gz_A-2 structure of deinococcus radiodurans ssb bound to ssdna 0.6699 83 118
ID Description Score Start End Superfamily
af_A0A1D6EXE4_72_173_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8164 93 118 2.60.40.10
af_I1N3D0_30_174_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7802 93 118 2.60.40.1820
af_Q9M386_71_218_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7634 93 118 2.60.40.1820
af_A0A1D6K9H6_29_160_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7615 93 118 2.60.40.10
4oqeB02 Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains 0.7376 84 118 2.20.130.10
ID Description Score Start End GO Terms
AF-A0A7Y8J8A5-F1-model_v4 DUF4845 domain-containing protein 0.9508 15 118
AF-A0A1E7WFQ0-F1-model_v4 deleted 0.9432 11 121
AF-A0A0Q4NNT7-F1-model_v4 deleted 0.9431 11 120
AF-A0A0J1D8K0-F1-model_v4 Membrane protein 0.9421 1 120 GO:0016020
AF-A0A254T9S0-F1-model_v4 DUF4845 domain-containing protein 0.9404 12 122

Map