F402368

General Info

Members Datasets Scaffolds Average Seq Length
313 190 313 153

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0426296|Ga0496105_0426296_177_701
Length 174
Sequence MLHVSCQRLHRQHLEVPIMRKRIVGSPELETAFSDDWLDLETLADVEVTSEDATHPIEAALLPGHGSGWSAATPGKQTIRLLFTRPQRLKRICLVYEEPVTVRTQEYVLRWSADGGQSYREITRQQWNFSPHGAISEAEDHRVDLNAVTALELSIIPDISGGDAVASLARLRVA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.56
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10182817 3300005295 Bacteria 1407
2 Ga0070676_10463344 3300005328 Unclassified 893
3 Ga0070683_100064338 3300005329 Bacteria 3414
4 Ga0070683_100106224 3300005329 Bacteria 2647
5 Ga0070690_100358690 3300005330 Bacteria 1060
6 Ga0070670_100056285 3300005331 Bacteria 3375
7 Ga0068869_100009065 3300005334 Bacteria 6448
8 Ga0068869_100563201 3300005334 Bacteria 959
9 Ga0070680_100027156 3300005336 Bacteria 4584
10 Ga0070680_100467763 3300005336 Bacteria 1077
11 Ga0070682_100858495 3300005337 Unclassified 742
12 Ga0070682_101741060 3300005337 Unclassified 542
13 Ga0068868_100009275 3300005338 Bacteria 7073
14 Ga0068868_100010430 3300005338 Bacteria 6725
15 Ga0070689_100023316 3300005340 Bacteria 4632
16 Ga0070689_101018908 3300005340 Bacteria 737
17 Ga0070691_10317948 3300005341 Unclassified 855
18 Ga0070661_100015065 3300005344 Bacteria 5455
19 Ga0070669_100919326 3300005353 Bacteria 748
20 Ga0070671_100752612 3300005355 Unclassified 847
21 Ga0070673_100440230 3300005364 Bacteria 1171
22 Ga0070709_10015970 3300005434 Bacteria 4277
23 Ga0070709_10303035 3300005434 Bacteria 1167
24 Ga0070713_100005203 3300005436 Bacteria 8860
25 Ga0070713_100042904 3300005436 Bacteria 3695
26 Ga0070710_10107186 3300005437 Unclassified 1673
27 Ga0070711_100004751 3300005439 Bacteria 8046
28 Ga0070711_100709073 3300005439 Bacteria 848
29 Ga0070694_100210220 3300005444 Bacteria 1455
30 Ga0070678_101007389 3300005456 Unclassified 766
31 Ga0070681_10000156 3300005458 Bacteria 52135
32 Ga0070681_10012133 3300005458 Bacteria 8548
33 Ga0068867_100007372 3300005459 Bacteria 7781
34 Ga0068867_100253041 3300005459 Bacteria 1433
35 Ga0070706_101164450 3300005467 Unclassified 709
36 Ga0070707_100305169 3300005468 Unclassified 1547
37 Ga0070707_100612752 3300005468 Bacteria 1051
38 Ga0070698_100265327 3300005471 Bacteria 1649
39 Ga0070698_100724606 3300005471 Bacteria 937
40 Ga0070679_100786057 3300005530 Unclassified 895
41 Ga0070684_100014809 3300005535 Bacteria 6328
42 Ga0070684_100147906 3300005535 Bacteria 2127
43 Ga0068853_100009550 3300005539 Bacteria 7816
44 Ga0068853_100237845 3300005539 Bacteria 1668
45 Ga0068853_100665085 3300005539 Unclassified 992
46 Ga0070686_100154776 3300005544 Bacteria 1609
47 Ga0070686_100269295 3300005544 Unclassified 1252
48 Ga0070686_100582458 3300005544 Unclassified 879
49 Ga0070693_100045896 3300005547 Bacteria 2479
50 Ga0070665_100223647 3300005548 Bacteria 1883
51 Ga0068855_100001475 3300005563 Bacteria 29415
52 Ga0068855_100025904 3300005563 Bacteria 7015
53 Ga0068855_100633845 3300005563 Bacteria 1150
54 Ga0068855_101930673 3300005563 Unclassified 597
55 Ga0070664_100003569 3300005564 Bacteria 12559
56 Ga0070664_100070010 3300005564 Bacteria 3003
57 Ga0068857_100000641 3300005577 Bacteria 25788
58 Ga0068857_100014388 3300005577 Bacteria 6898
59 Ga0068857_100421834 3300005577 Bacteria 1244
60 Ga0068854_100024720 3300005578 Bacteria 4116
61 Ga0068854_100117767 3300005578 Bacteria 2012
62 Ga0068854_100168273 3300005578 Bacteria 1703
63 Ga0068856_100004507 3300005614 Bacteria 13849
64 Ga0068856_100024951 3300005614 Bacteria 5826
65 Ga0070702_100177838 3300005615 Bacteria 1390
66 Ga0068852_100010110 3300005616 Bacteria 7025
67 Ga0068852_100357073 3300005616 Bacteria 1428
68 Ga0068859_100011305 3300005617 Bacteria 8982
69 Ga0068859_100019975 3300005617 Bacteria 6726
70 Ga0068859_100023699 3300005617 Bacteria 6160
71 Ga0068859_100177735 3300005617 Bacteria 2211
72 Ga0068859_100529247 3300005617 Bacteria 1273
73 Ga0068859_101234693 3300005617 Unclassified 823
74 Ga0068864_100009353 3300005618 Bacteria 8085
75 Ga0068866_10010247 3300005718 Bacteria 4012
76 Ga0068861_100072610 3300005719 Bacteria 2670
77 Ga0068861_100857263 3300005719 Bacteria 857
78 Ga0068861_101084865 3300005719 Bacteria 769
79 Ga0068851_10402587 3300005834 Unclassified 805
80 Ga0068851_10616817 3300005834 Unclassified 661
81 Ga0068863_100097770 3300005841 Bacteria 2788
82 Ga0068858_100017558 3300005842 Bacteria 6710
83 Ga0068858_100049278 3300005842 Bacteria 3901
84 Ga0068860_100013764 3300005843 Bacteria 7931
85 Ga0068860_100235895 3300005843 Bacteria 1778
86 Ga0068860_100672959 3300005843 Bacteria 1044
87 Ga0068860_100858729 3300005843 Bacteria 922
88 Ga0068862_100003064 3300005844 Bacteria 14566
89 Ga0070717_10000164 3300006028 Bacteria 50120
90 Ga0070717_10000617 3300006028 Bacteria 22842
91 Ga0070717_10046925 3300006028 Bacteria 3536
92 Ga0070715_10032852 3300006163 Bacteria 2117
93 Ga0070716_100009160 3300006173 Bacteria 4927
94 Ga0070712_100045507 3300006175 Bacteria 3030
95 Ga0097621_100000127 3300006237 Bacteria 44332
96 Ga0097621_100037834 3300006237 Bacteria 3869
97 Ga0068871_100002994 3300006358 Bacteria 11589
98 Ga0068871_100059259 3300006358 Bacteria 3119
99 Ga0068871_100603803 3300006358 Unclassified 998
100 Ga0068871_100703494 3300006358 Unclassified 926
101 Ga0075431_100345706 3300006847 Unclassified 1496
102 Ga0075433_10022856 3300006852 Bacteria 5254
103 Ga0075433_10054740 3300006852 Bacteria 3481
104 Ga0075433_10057245 3300006852 Unclassified 3407
105 Ga0075434_100000617 3300006871 Bacteria 27495
106 Ga0075434_100140327 3300006871 Bacteria 2436
107 Ga0075434_100371603 3300006871 Unclassified 1451
108 Ga0068865_100312947 3300006881 Bacteria 1260
109 Ga0075436_100042496 3300006914 Bacteria 3135
110 Ga0097620_100011305 3300006931 Bacteria 8982
111 Ga0097620_100019973 3300006931 Bacteria 6726
112 Ga0097620_100023702 3300006931 Bacteria 6160
113 Ga0097620_100177752 3300006931 Bacteria 2211
114 Ga0097620_100529256 3300006931 Bacteria 1273
115 Ga0097620_101234291 3300006931 Unclassified 823
116 Ga0075435_100002729 3300007076 Bacteria 11787
117 Ga0075435_100107505 3300007076 Bacteria 2317
118 Ga0075435_101530496 3300007076 Unclassified 585
119 Ga0105240_10001253 3300009093 Bacteria 44068
120 Ga0105240_10311784 3300009093 Bacteria 1796
121 Ga0111539_10191843 3300009094 Unclassified 2384
122 Ga0114129_10007684 3300009147 Bacteria 15343
123 Ga0114129_10142363 3300009147 Unclassified 3286
124 Ga0114129_10233119 3300009147 Bacteria 2478
125 Ga0105243_11133450 3300009148 Unclassified 792
126 Ga0105241_10005471 3300009174 Bacteria 9393
127 Ga0105242_10177018 3300009176 Unclassified 1879
128 Ga0105242_10406294 3300009176 Bacteria 1272
129 Ga0105248_10042119 3300009177 Bacteria 5121
130 Ga0105248_10169261 3300009177 Bacteria 2462
131 Ga0105248_10217769 3300009177 Bacteria 2150
132 Ga0105248_11145127 3300009177 Unclassified 879
133 Ga0105237_10044386 3300009545 Bacteria 4475
134 Ga0105237_10166132 3300009545 Bacteria 2206
135 Ga0105238_10000143 3300009551 Bacteria 78219
136 Ga0105238_10024246 3300009551 Bacteria 6184
137 Ga0105249_10031296 3300009553 Bacteria 4812
138 Ga0105239_10012272 3300010375 Bacteria 9544
139 Ga0105239_10097815 3300010375 Bacteria 3244
140 Ga0157373_10181461 3300013100 Bacteria 1482
141 Ga0157373_10191039 3300013100 Bacteria 1443
142 Ga0157373_10196063 3300013100 Bacteria 1423
143 Ga0157373_10237573 3300013100 Unclassified 1288
144 Ga0157371_10044070 3300013102 Bacteria 3178
145 Ga0157371_10059957 3300013102 Bacteria 2698
146 Ga0157370_10094773 3300013104 Bacteria 2800
147 Ga0157370_10340135 3300013104 Bacteria 1383
148 Ga0157369_10000102 3300013105 Bacteria 118470
149 Ga0157369_10244766 3300013105 Bacteria 1872
150 Ga0157369_10298868 3300013105 Bacteria 1675
151 Ga0157369_10570413 3300013105 Unclassified 1169
152 Ga0157374_10000403 3300013296 Bacteria 39283
153 Ga0157374_10007138 3300013296 Bacteria 9516
154 Ga0157378_10001159 3300013297 Bacteria 23973
155 Ga0157378_10005764 3300013297 Bacteria 10848
156 Ga0157378_10081201 3300013297 Bacteria 2930
157 Ga0157378_10495090 3300013297 Unclassified 1220
158 Ga0163162_10150017 3300013306 Bacteria 2448
159 Ga0163162_10340557 3300013306 Bacteria 1632
160 Ga0157372_10000340 3300013307 Bacteria 51471
161 Ga0157372_10008040 3300013307 Bacteria 11216
162 Ga0157372_10429745 3300013307 Bacteria 1539
163 Ga0157372_10754964 3300013307 Unclassified 1131
164 Ga0157375_10527601 3300013308 Bacteria 1343
165 Ga0163163_10097897 3300014325 Bacteria 2954
166 Ga0163163_10681161 3300014325 Unclassified 1092
167 Ga0157380_10391336 3300014326 Bacteria 1315
168 Ga0182008_10194292 3300014497 Bacteria 1030
169 Ga0157377_10401784 3300014745 Bacteria 933
170 Ga0157379_10071539 3300014968 Bacteria 3102
171 Ga0157376_10017088 3300014969 Bacteria 5526
172 Ga0157376_10802343 3300014969 Unclassified 954
173 Ga0206349_1699182 3300020075 Unclassified 705
174 Ga0206350_11412981 3300020080 Unclassified 867
175 Ga0154015_1232121 3300020610 Unclassified 874
176 Ga0213874_10063110 3300021377 Unclassified 1165
177 Ga0224712_10097256 3300022467 Unclassified 1242
178 Ga0207656_10406629 3300025321 Unclassified 685
179 Ga0207692_10119615 3300025898 Unclassified 1473
180 Ga0207642_10164523 3300025899 Bacteria 1194
181 Ga0207647_10039034 3300025904 Bacteria 2999
182 Ga0207685_10021495 3300025905 Bacteria 2163
183 Ga0207699_10012443 3300025906 Bacteria 4329
184 Ga0207699_10069719 3300025906 Bacteria 2145
185 Ga0207645_10482052 3300025907 Unclassified 839
186 Ga0207684_10411456 3300025910 Unclassified 1162
187 Ga0207654_10016210 3300025911 Bacteria 3876
188 Ga0207707_10000127 3300025912 Bacteria 78669
189 Ga0207707_10044617 3300025912 Bacteria 3865
190 Ga0207695_10093236 3300025913 Bacteria 3021
191 Ga0207671_10281719 3300025914 Bacteria 1311
192 Ga0207671_10375060 3300025914 Bacteria 1130
193 Ga0207671_10527853 3300025914 Unclassified 941
194 Ga0207693_10006117 3300025915 Bacteria 9977
195 Ga0207660_10410024 3300025917 Bacteria 1092
196 Ga0207660_10503272 3300025917 Unclassified 983
197 Ga0207662_10654905 3300025918 Unclassified 734
198 Ga0207649_10008380 3300025920 Bacteria 5634
199 Ga0207646_10173714 3300025922 Bacteria 1946
200 Ga0207646_10223353 3300025922 Unclassified 1702
201 Ga0207646_10636017 3300025922 Unclassified 956
202 Ga0207694_10000539 3300025924 Bacteria 34355
203 Ga0207650_10027553 3300025925 Bacteria 4068
204 Ga0207700_10006374 3300025928 Bacteria 7118
205 Ga0207700_10215014 3300025928 Bacteria 1627
206 Ga0207706_10318473 3300025933 Bacteria 1354
207 Ga0207686_10598605 3300025934 Unclassified 867
208 Ga0207670_10064792 3300025936 Bacteria 2506
209 Ga0207704_10356759 3300025938 Bacteria 1140
210 Ga0207665_10000274 3300025939 Bacteria 35743
211 Ga0207711_10123795 3300025941 Bacteria 2311
212 Ga0207711_10763653 3300025941 Bacteria 901
213 Ga0207689_10008046 3300025942 Bacteria 9201
214 Ga0207661_10082304 3300025944 Bacteria 2661
215 Ga0207661_10253732 3300025944 Bacteria 1564
216 Ga0207679_10076460 3300025945 Bacteria 2544
217 Ga0207679_10236355 3300025945 Bacteria 1546
218 Ga0207667_10001751 3300025949 Bacteria 27306
219 Ga0207667_10033376 3300025949 Bacteria 5533
220 Ga0207667_10872297 3300025949 Unclassified 893
221 Ga0207651_10805117 3300025960 Unclassified 833
222 Ga0207712_10354550 3300025961 Bacteria 1221
223 Ga0207640_10041137 3300025981 Bacteria 2938
224 Ga0207640_10087348 3300025981 Bacteria 2149
225 Ga0207640_10206875 3300025981 Bacteria 1492
226 Ga0207640_10718489 3300025981 Bacteria 858
227 Ga0207677_10005920 3300026023 Bacteria 6654
228 Ga0207677_10011784 3300026023 Bacteria 4999
229 Ga0207703_10009414 3300026035 Bacteria 7674
230 Ga0207703_10088419 3300026035 Bacteria 2600
231 Ga0207703_10133003 3300026035 Bacteria 2150
232 Ga0207639_10006660 3300026041 Bacteria 7857
233 Ga0207639_10207909 3300026041 Bacteria 1683
234 Ga0207639_10966032 3300026041 Unclassified 797
235 Ga0207702_10000427 3300026078 Bacteria 48314
236 Ga0207702_10007982 3300026078 Bacteria 8969
237 Ga0207641_11059816 3300026088 Unclassified 809
238 Ga0207648_10013322 3300026089 Bacteria 7656
239 Ga0207648_10043460 3300026089 Unclassified 3944
240 Ga0207648_11162644 3300026089 Unclassified 724
241 Ga0207676_10531314 3300026095 Bacteria 1121
242 Ga0207674_10002558 3300026116 Bacteria 22905
243 Ga0207674_10004032 3300026116 Bacteria 17824
244 Ga0207675_100620348 3300026118 Unclassified 1086
245 Ga0210002_1016115 3300027617 Unclassified 1181
246 Ga0209971_1008559 3300027682 Bacteria 2428
247 Ga0209966_1001397 3300027695 Bacteria 4223
248 Ga0209974_10040018 3300027876 Unclassified 1559
249 Ga0268265_10081718 3300028380 Bacteria 2552
250 Ga0268264_10438536 3300028381 Bacteria 1263
251 Ga0268264_10533303 3300028381 Bacteria 1149
252 Ga0268264_10684731 3300028381 Bacteria 1017
253 Ga0316579_10001836 3300031691 Bacteria 7848
254 Ga0316577_10015873 3300031733 Bacteria 4145
255 Ga0307416_101182369 3300032002 Unclassified 870
256 Ga0316585_10059435 3300032137 Bacteria 1233
257 Ga0316580_10013528 3300032139 Bacteria 2488
258 Ga0316574_0010445 3300035398 Bacteria 5249
259 Ga0373937_0117997 3300036401 Bacteria 2472
260 Ga0316582_0152689 3300036647 Bacteria 1561
261 Ga0316584_0120081 3300036712 Bacteria 1964
262 Ga0316584_0633968 3300036712 Bacteria 738
263 Ga0316581_0004639 3300037588 Bacteria 3521
264 Ga0395901_0619774 3300038443 Bacteria 1089
265 Ga0436365_0317333 3300039437 Unclassified 1012
266 Ga0436361_1084868 3300039447 Bacteria 2827
267 Ga0436363_1325680 3300039450 Unclassified 2310
268 Ga0436362_0420249 3300039453 Unclassified 864
269 Ga0439441_087034 3300042001 Unclassified 687
270 Ga0453683_0709941 3300044673 Unclassified 659
271 Ga0453684_0843032 3300044712 Bacteria 985
272 Ga0451576_0121215 3300045051 Bacteria 2723
273 Ga0495580_0041489 3300046472 Bacteria 3282
274 Ga0495656_0410726 3300046615 Unclassified 709
275 Ga0495634_0222272 3300046642 Bacteria 1165
276 Ga0495674_0350177 3300047319 Unclassified 1199
277 Ga0496100_0466100 3300048903 Bacteria 970
278 Ga0496102_0750997 3300048905 Unclassified 898
279 Ga0496104_0561886 3300048907 Bacteria 1052
280 Ga0496105_0426296 3300048908 Bacteria 1050
281 Ga0496108_0470466 3300048911 Bacteria 1098
282 Ga0496110_0235419 3300048913 Bacteria 1666
283 Ga0496112_0005439 3300048915 Bacteria 11017
284 Ga0496112_0018520 3300048915 Bacteria 6557
285 Ga0501036_0261672 3300049572 Unclassified 1449
286 Ga0501036_0500049 3300049572 Unclassified 1011
287 Ga0501038_0609377 3300049574 Unclassified 825
288 Ga0501039_0521010 3300049575 Unclassified 933
289 Ga0501041_0099552 3300049577 Unclassified 1798
290 Ga0501046_0817134 3300049580 Unclassified 653
291 Ga0501071_0239418 3300049587 Unclassified 1368
292 Ga0501071_1354976 3300049587 Unclassified 549
293 Ga0501074_0910362 3300049590 Unclassified 619
294 Ga0501076_1152896 3300049592 Unclassified 638
295 Ga0501077_0119694 3300049593 Unclassified 1668
296 Ga0501035_0513127 3300049822 Unclassified 985
297 Ga0501044_0316961 3300049823 Bacteria 1485
298 Ga0501045_0203597 3300049824 Unclassified 1474
299 nmdc:mga05p37_236293_c1 3300050507 Unclassified 2199
300 nmdc:mga05p37_2909_c1 3300050507 Bacteria 19871
301 nmdc:mga05p37_324479_c1 3300050507 Bacteria 1821
302 nmdc:mga06r32_630692_c1 3300050510 Unclassified 1041
303 nmdc:mga0n895_1121210_c1 3300050512 Unclassified 763
304 nmdc:mga0n895_19050_c1 3300050512 Bacteria 6370
305 nmdc:mga0n895_54056_c1 3300050512 Bacteria 3948
306 nmdc:mga0rr50_886711_c1 3300050513 Unclassified 761
307 nmdc:mga0rr50_988187_c1 3300050513 Unclassified 717
308 nmdc:mga08x19_94454_c1 3300050514 Bacteria 1977
309 nmdc:mga0a205_44918_c1 3300050515 Bacteria 4260
310 nmdc:mga0a205_57512_c1 3300050515 Unclassified 3755
311 nmdc:mga0a205_66131_c2 3300050515 Bacteria 2687
312 Ga0495601_0597655 3300053077 Unclassified 708
313 Ga0500641_0004946 3300053096 Bacteria 4725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1325680 Ga0436363_1325680_975_1376 133
2 3300046472 Ga0495580_0041489 Ga0495580_0041489_2057_2464 135
3 3300005328 Ga0070676_10463344 Ga0070676_104633442 143
4 3300005329 Ga0070683_100064338 Ga0070683_1000643386 143
5 3300005331 Ga0070670_100056285 Ga0070670_1000562855 143
6 3300005336 Ga0070680_100467763 Ga0070680_1004677631 143
7 3300005338 Ga0068868_100010430 Ga0068868_1000104306 143
8 3300005340 Ga0070689_100023316 Ga0070689_1000233164 143
9 3300005344 Ga0070661_100015065 Ga0070661_1000150656 143
10 3300005355 Ga0070671_100752612 Ga0070671_1007526121 143
11 3300005458 Ga0070681_10012133 Ga0070681_100121336 143
12 3300005459 Ga0068867_100007372 Ga0068867_1000073725 143
13 3300005530 Ga0070679_100786057 Ga0070679_1007860572 143
14 3300005535 Ga0070684_100014809 Ga0070684_1000148097 143
15 3300005539 Ga0068853_100237845 Ga0068853_1002378453 143
16 3300005544 Ga0070686_100582458 Ga0070686_1005824582 143
17 3300005547 Ga0070693_100045896 Ga0070693_1000458962 143
18 3300005563 Ga0068855_100025904 Ga0068855_1000259046 143
19 3300005564 Ga0070664_100003569 Ga0070664_10000356910 143
20 3300005577 Ga0068857_100014388 Ga0068857_1000143882 143
21 3300005614 Ga0068856_100024951 Ga0068856_1000249516 143
22 3300005617 Ga0068859_100011305 Ga0068859_1000113055 143
23 3300005618 Ga0068864_100009353 Ga0068864_10000935311 143
24 3300005718 Ga0068866_10010247 Ga0068866_100102473 143
25 3300005719 Ga0068861_100072610 Ga0068861_1000726102 143
26 3300005834 Ga0068851_10402587 Ga0068851_104025872 143
27 3300005842 Ga0068858_100049278 Ga0068858_1000492786 143
28 3300005843 Ga0068860_100672959 Ga0068860_1006729592 143
29 3300006237 Ga0097621_100037834 Ga0097621_1000378342 143
30 3300006358 Ga0068871_100059259 Ga0068871_1000592591 143
31 3300006881 Ga0068865_100312947 Ga0068865_1003129471 143
32 3300006931 Ga0097620_100011305 Ga0097620_10001130510 143
33 3300009176 Ga0105242_10406294 Ga0105242_104062943 143
34 3300009177 Ga0105248_10169261 Ga0105248_101692612 143
35 3300010375 Ga0105239_10012272 Ga0105239_100122724 143
36 3300013100 Ga0157373_10191039 Ga0157373_101910392 143
37 3300013102 Ga0157371_10059957 Ga0157371_100599573 143
38 3300013296 Ga0157374_10007138 Ga0157374_1000713812 143
39 3300013297 Ga0157378_10005764 Ga0157378_1000576411 143
40 3300013307 Ga0157372_10008040 Ga0157372_100080407 143
41 3300014325 Ga0163163_10097897 Ga0163163_100978974 143
42 3300014969 Ga0157376_10802343 Ga0157376_108023432 143
43 3300025899 Ga0207642_10164523 Ga0207642_101645232 143
44 3300025907 Ga0207645_10482052 Ga0207645_104820522 143
45 3300025912 Ga0207707_10044617 Ga0207707_100446178 143
46 3300025914 Ga0207671_10527853 Ga0207671_105278532 143
47 3300025917 Ga0207660_10410024 Ga0207660_104100242 143
48 3300025918 Ga0207662_10654905 Ga0207662_106549052 143
49 3300025920 Ga0207649_10008380 Ga0207649_100083806 143
50 3300025925 Ga0207650_10027553 Ga0207650_100275536 143
51 3300025934 Ga0207686_10598605 Ga0207686_105986052 143
52 3300025936 Ga0207670_10064792 Ga0207670_100647922 143
53 3300025938 Ga0207704_10356759 Ga0207704_103567591 143
54 3300025941 Ga0207711_10123795 Ga0207711_101237953 143
55 3300025944 Ga0207661_10082304 Ga0207661_100823042 143
56 3300025945 Ga0207679_10236355 Ga0207679_102363553 143
57 3300025949 Ga0207667_10033376 Ga0207667_100333769 143
58 3300025981 Ga0207640_10087348 Ga0207640_100873482 143
59 3300026023 Ga0207677_10005920 Ga0207677_100059207 143
60 3300026035 Ga0207703_10088419 Ga0207703_100884192 143
61 3300026041 Ga0207639_10207909 Ga0207639_102079092 143
62 3300026078 Ga0207702_10007982 Ga0207702_100079828 143
63 3300026089 Ga0207648_10013322 Ga0207648_1001332212 143
64 3300026116 Ga0207674_10002558 Ga0207674_1000255810 143
65 3300028381 Ga0268264_10533303 Ga0268264_105333031 143
66 3300044673 Ga0453683_0709941 Ga0453683_0709941_171_605 144
67 3300005334 Ga0068869_100009065 Ga0068869_1000090655 151
68 3300005337 Ga0070682_100858495 Ga0070682_1008584951 151
69 3300005539 Ga0068853_100665085 Ga0068853_1006650851 151
70 3300005548 Ga0070665_100223647 Ga0070665_1002236472 151
71 3300005563 Ga0068855_100633845 Ga0068855_1006338451 151
72 3300005563 Ga0068855_101930673 Ga0068855_1019306731 151
73 3300005578 Ga0068854_100117767 Ga0068854_1001177673 151
74 3300005616 Ga0068852_100357073 Ga0068852_1003570732 151
75 3300005617 Ga0068859_100019975 Ga0068859_1000199756 151
76 3300005842 Ga0068858_100017558 Ga0068858_1000175589 151
77 3300005843 Ga0068860_100013764 Ga0068860_1000137646 151
78 3300006931 Ga0097620_100019973 Ga0097620_1000199736 151
79 3300009093 Ga0105240_10311784 Ga0105240_103117843 151
80 3300009177 Ga0105248_10217769 Ga0105248_102177694 151
81 3300009545 Ga0105237_10044386 Ga0105237_100443865 151
82 3300009551 Ga0105238_10024246 Ga0105238_100242466 151
83 3300010375 Ga0105239_10097815 Ga0105239_100978155 151
84 3300013100 Ga0157373_10181461 Ga0157373_101814612 151
85 3300013104 Ga0157370_10094773 Ga0157370_100947734 151
86 3300013105 Ga0157369_10244766 Ga0157369_102447663 151
87 3300013105 Ga0157369_10298868 Ga0157369_102988683 151
88 3300013297 Ga0157378_10081201 Ga0157378_100812013 151
89 3300013306 Ga0163162_10340557 Ga0163162_103405572 151
90 3300013307 Ga0157372_10429745 Ga0157372_104297452 151
91 3300013307 Ga0157372_10754964 Ga0157372_107549643 151
92 3300014497 Ga0182008_10194292 Ga0182008_101942923 151
93 3300025904 Ga0207647_10039034 Ga0207647_100390344 151
94 3300025913 Ga0207695_10093236 Ga0207695_100932363 151
95 3300025914 Ga0207671_10375060 Ga0207671_103750602 151
96 3300025933 Ga0207706_10318473 Ga0207706_103184732 151
97 3300025941 Ga0207711_10763653 Ga0207711_107636532 151
98 3300025942 Ga0207689_10008046 Ga0207689_1000804610 151
99 3300025949 Ga0207667_10872297 Ga0207667_108722971 151
100 3300025981 Ga0207640_10206875 Ga0207640_102068752 151
101 3300026035 Ga0207703_10009414 Ga0207703_100094142 151
102 3300026041 Ga0207639_10966032 Ga0207639_109660321 151
103 3300048915 Ga0496112_0018520 Ga0496112_0018520_5917_6390 151
104 3300005329 Ga0070683_100106224 Ga0070683_1001062242 152
105 3300005336 Ga0070680_100027156 Ga0070680_1000271561 152
106 3300005337 Ga0070682_101741060 Ga0070682_1017410601 152
107 3300005338 Ga0068868_100009275 Ga0068868_1000092756 152
108 3300005341 Ga0070691_10317948 Ga0070691_103179481 152
109 3300005364 Ga0070673_100440230 Ga0070673_1004402302 152
110 3300005434 Ga0070709_10015970 Ga0070709_100159702 152
111 3300005436 Ga0070713_100005203 Ga0070713_1000052033 152
112 3300005436 Ga0070713_100042904 Ga0070713_1000429042 152
113 3300005437 Ga0070710_10107186 Ga0070710_101071862 152
114 3300005439 Ga0070711_100004751 Ga0070711_1000047512 152
115 3300005458 Ga0070681_10000156 Ga0070681_1000015623 152
116 3300005535 Ga0070684_100147906 Ga0070684_1001479062 152
117 3300005539 Ga0068853_100009550 Ga0068853_1000095502 152
118 3300005563 Ga0068855_100001475 Ga0068855_10000147512 152
119 3300005564 Ga0070664_100070010 Ga0070664_1000700103 152
120 3300005577 Ga0068857_100000641 Ga0068857_10000064117 152
121 3300005578 Ga0068854_100024720 Ga0068854_1000247202 152
122 3300005614 Ga0068856_100004507 Ga0068856_1000045072 152
123 3300005616 Ga0068852_100010110 Ga0068852_1000101105 152
124 3300005834 Ga0068851_10616817 Ga0068851_106168171 152
125 3300005841 Ga0068863_100097770 Ga0068863_1000977704 152
126 3300005843 Ga0068860_100235895 Ga0068860_1002358952 152
127 3300006028 Ga0070717_10046925 Ga0070717_100469252 152
128 3300006237 Ga0097621_100000127 Ga0097621_1000001277 152
129 3300006358 Ga0068871_100002994 Ga0068871_10000299411 152
130 3300009093 Ga0105240_10001253 Ga0105240_100012533 152
131 3300009174 Ga0105241_10005471 Ga0105241_100054714 152
132 3300009545 Ga0105237_10166132 Ga0105237_101661321 152
133 3300009551 Ga0105238_10000143 Ga0105238_1000014336 152
134 3300013100 Ga0157373_10196063 Ga0157373_101960631 152
135 3300013102 Ga0157371_10044070 Ga0157371_100440702 152
136 3300013104 Ga0157370_10340135 Ga0157370_103401352 152
137 3300013105 Ga0157369_10000102 Ga0157369_1000010267 152
138 3300013296 Ga0157374_10000403 Ga0157374_1000040313 152
139 3300013297 Ga0157378_10001159 Ga0157378_1000115914 152
140 3300013307 Ga0157372_10000340 Ga0157372_1000034037 152
141 3300014325 Ga0163163_10681161 Ga0163163_106811611 152
142 3300014969 Ga0157376_10017088 Ga0157376_100170884 152
143 3300020080 Ga0206350_11412981 Ga0206350_114129811 152
144 3300020610 Ga0154015_1232121 Ga0154015_12321211 152
145 3300021377 Ga0213874_10063110 Ga0213874_100631102 152
146 3300022467 Ga0224712_10097256 Ga0224712_100972562 152
147 3300025321 Ga0207656_10406629 Ga0207656_104066292 152
148 3300025898 Ga0207692_10119615 Ga0207692_101196152 152
149 3300025906 Ga0207699_10012443 Ga0207699_100124434 152
150 3300025911 Ga0207654_10016210 Ga0207654_100162102 152
151 3300025912 Ga0207707_10000127 Ga0207707_100001273 152
152 3300025914 Ga0207671_10281719 Ga0207671_102817191 152
153 3300025917 Ga0207660_10503272 Ga0207660_105032721 152
154 3300025924 Ga0207694_10000539 Ga0207694_1000053910 152
155 3300025928 Ga0207700_10006374 Ga0207700_100063745 152
156 3300025928 Ga0207700_10215014 Ga0207700_102150142 152
157 3300025944 Ga0207661_10253732 Ga0207661_102537322 152
158 3300025945 Ga0207679_10076460 Ga0207679_100764602 152
159 3300025949 Ga0207667_10001751 Ga0207667_100017512 152
160 3300025960 Ga0207651_10805117 Ga0207651_108051171 152
161 3300025981 Ga0207640_10041137 Ga0207640_100411372 152
162 3300026023 Ga0207677_10011784 Ga0207677_100117842 152
163 3300026035 Ga0207703_10133003 Ga0207703_101330031 152
164 3300026041 Ga0207639_10006660 Ga0207639_100066606 152
165 3300026078 Ga0207702_10000427 Ga0207702_1000042735 152
166 3300026095 Ga0207676_10531314 Ga0207676_105313142 152
167 3300026116 Ga0207674_10004032 Ga0207674_100040325 152
168 3300028381 Ga0268264_10438536 Ga0268264_104385363 152
169 3300048905 Ga0496102_0750997 Ga0496102_0750997_338_796 152
170 3300048907 Ga0496104_0561886 Ga0496104_0561886_484_942 152
171 3300048911 Ga0496108_0470466 Ga0496108_0470466_245_703 152
172 3300048913 Ga0496110_0235419 Ga0496110_0235419_644_1102 152
173 3300048915 Ga0496112_0005439 Ga0496112_0005439_7797_8255 152
174 3300006852 Ga0075433_10022856 Ga0075433_100228566 154
175 3300006871 Ga0075434_100000617 Ga0075434_1000006172 154
176 3300006914 Ga0075436_100042496 Ga0075436_1000424964 154
177 3300007076 Ga0075435_100002729 Ga0075435_1000027295 154
178 3300009147 Ga0114129_10233119 Ga0114129_102331194 154
179 3300050507 nmdc:mga05p37_324479_c1 nmdc:mga05p37_324479_c1_879_1367 154
180 3300050512 nmdc:mga0n895_19050_c1 nmdc:mga0n895_19050_c1_2320_2928 154
181 3300050514 nmdc:mga08x19_94454_c1 nmdc:mga08x19_94454_c1_341_829 154
182 3300050515 nmdc:mga0a205_44918_c1 nmdc:mga0a205_44918_c1_2946_3434 154
183 3300005459 Ga0068867_100253041 Ga0068867_1002530412 155
184 3300006847 Ga0075431_100345706 Ga0075431_1003457062 155
185 3300006852 Ga0075433_10054740 Ga0075433_100547403 155
186 3300006871 Ga0075434_100140327 Ga0075434_1001403273 155
187 3300007076 Ga0075435_100107505 Ga0075435_1001075051 155
188 3300009094 Ga0111539_10191843 Ga0111539_101918432 155
189 3300009147 Ga0114129_10007684 Ga0114129_100076846 155
190 3300009176 Ga0105242_10177018 Ga0105242_101770182 155
191 3300026089 Ga0207648_10043460 Ga0207648_100434602 155
192 3300027617 Ga0210002_1016115 Ga0210002_10161151 155
193 3300027682 Ga0209971_1008559 Ga0209971_10085592 155
194 3300027695 Ga0209966_1001397 Ga0209966_10013975 155
195 3300027876 Ga0209974_10040018 Ga0209974_100400182 155
196 3300039437 Ga0436365_0317333 Ga0436365_0317333_261_731 155
197 3300039453 Ga0436362_0420249 Ga0436362_0420249_262_732 155
198 3300050507 nmdc:mga05p37_2909_c1 nmdc:mga05p37_2909_c1_1005_1475 155
199 3300050510 nmdc:mga06r32_630692_c1 nmdc:mga06r32_630692_c1_420_887 155
200 3300050512 nmdc:mga0n895_54056_c1 nmdc:mga0n895_54056_c1_1299_1769 155
201 3300050513 nmdc:mga0rr50_886711_c1 nmdc:mga0rr50_886711_c1_111_581 155
202 3300050515 nmdc:mga0a205_66131_c2 nmdc:mga0a205_66131_c2_904_1374 155
203 3300005434 Ga0070709_10303035 Ga0070709_103030352 156
204 3300005439 Ga0070711_100709073 Ga0070711_1007090731 156
205 3300006163 Ga0070715_10032852 Ga0070715_100328524 156
206 3300006173 Ga0070716_100009160 Ga0070716_1000091602 156
207 3300006175 Ga0070712_100045507 Ga0070712_1000455071 156
208 3300006358 Ga0068871_100703494 Ga0068871_1007034942 156
209 3300006852 Ga0075433_10057245 Ga0075433_100572456 156
210 3300006871 Ga0075434_100371603 Ga0075434_1003716032 156
211 3300009147 Ga0114129_10142363 Ga0114129_101423631 156
212 3300025905 Ga0207685_10021495 Ga0207685_100214951 156
213 3300025906 Ga0207699_10069719 Ga0207699_100697192 156
214 3300025915 Ga0207693_10006117 Ga0207693_100061171 156
215 3300025939 Ga0207665_10000274 Ga0207665_100002745 156
216 3300048903 Ga0496100_0466100 Ga0496100_0466100_343_813 156
217 3300048908 Ga0496105_0426296 Ga0496105_0426296_177_701 156
218 3300050507 nmdc:mga05p37_236293_c1 nmdc:mga05p37_236293_c1_817_1287 156
219 3300050512 nmdc:mga0n895_1121210_c1 nmdc:mga0n895_1121210_c1_218_688 156
220 3300050513 nmdc:mga0rr50_988187_c1 nmdc:mga0rr50_988187_c1_209_679 156
221 3300050515 nmdc:mga0a205_57512_c1 nmdc:mga0a205_57512_c1_487_957 156
222 3300005456 Ga0070678_101007389 Ga0070678_1010073892 157
223 3300005467 Ga0070706_101164450 Ga0070706_1011644501 157
224 3300005468 Ga0070707_100305169 Ga0070707_1003051692 157
225 3300005468 Ga0070707_100612752 Ga0070707_1006127521 157
226 3300005471 Ga0070698_100265327 Ga0070698_1002653272 157
227 3300005471 Ga0070698_100724606 Ga0070698_1007246061 157
228 3300005617 Ga0068859_101234693 Ga0068859_1012346931 157
229 3300006028 Ga0070717_10000164 Ga0070717_100001643 157
230 3300006028 Ga0070717_10000617 Ga0070717_100006175 157
231 3300006358 Ga0068871_100603803 Ga0068871_1006038031 157
232 3300006931 Ga0097620_101234291 Ga0097620_1012342911 157
233 3300007076 Ga0075435_101530496 Ga0075435_1015304961 157
234 3300009148 Ga0105243_11133450 Ga0105243_111334501 157
235 3300013100 Ga0157373_10237573 Ga0157373_102375733 157
236 3300013105 Ga0157369_10570413 Ga0157369_105704132 157
237 3300013297 Ga0157378_10495090 Ga0157378_104950901 157
238 3300014326 Ga0157380_10391336 Ga0157380_103913362 157
239 3300014745 Ga0157377_10401784 Ga0157377_104017842 157
240 3300020075 Ga0206349_1699182 Ga0206349_16991821 157
241 3300025910 Ga0207684_10411456 Ga0207684_104114561 157
242 3300025922 Ga0207646_10173714 Ga0207646_101737143 157
243 3300025922 Ga0207646_10223353 Ga0207646_102233532 157
244 3300025922 Ga0207646_10636017 Ga0207646_106360171 157
245 3300031691 Ga0316579_10001836 Ga0316579_100018366 157
246 3300031733 Ga0316577_10015873 Ga0316577_100158732 157
247 3300032002 Ga0307416_101182369 Ga0307416_1011823692 157
248 3300032137 Ga0316585_10059435 Ga0316585_100594352 157
249 3300032139 Ga0316580_10013528 Ga0316580_100135281 157
250 3300035398 Ga0316574_0010445 Ga0316574_0010445_4521_4997 157
251 3300036401 Ga0373937_0117997 Ga0373937_0117997_107_580 157
252 3300036647 Ga0316582_0152689 Ga0316582_0152689_16_492 157
253 3300036712 Ga0316584_0120081 Ga0316584_0120081_17_493 157
254 3300037588 Ga0316581_0004639 Ga0316581_0004639_320_796 157
255 3300038443 Ga0395901_0619774 Ga0395901_0619774_351_824 157
256 3300039447 Ga0436361_1084868 Ga0436361_1084868_1446_1919 157
257 3300042001 Ga0439441_087034 Ga0439441_087034_50_523 157
258 3300044712 Ga0453684_0843032 Ga0453684_0843032_413_886 157
259 3300046615 Ga0495656_0410726 Ga0495656_0410726_98_571 157
260 3300046642 Ga0495634_0222272 Ga0495634_0222272_639_1112 157
261 3300047319 Ga0495674_0350177 Ga0495674_0350177_335_808 157
262 3300049572 Ga0501036_0261672 Ga0501036_0261672_481_954 157
263 3300049572 Ga0501036_0500049 Ga0501036_0500049_523_996 157
264 3300049574 Ga0501038_0609377 Ga0501038_0609377_341_814 157
265 3300049575 Ga0501039_0521010 Ga0501039_0521010_379_852 157
266 3300049577 Ga0501041_0099552 Ga0501041_0099552_1251_1724 157
267 3300049580 Ga0501046_0817134 Ga0501046_0817134_30_503 157
268 3300049587 Ga0501071_0239418 Ga0501071_0239418_734_1207 157
269 3300049587 Ga0501071_1354976 Ga0501071_1354976_35_508 157
270 3300049590 Ga0501074_0910362 Ga0501074_0910362_90_563 157
271 3300049592 Ga0501076_1152896 Ga0501076_1152896_52_525 157
272 3300049593 Ga0501077_0119694 Ga0501077_0119694_414_887 157
273 3300049822 Ga0501035_0513127 Ga0501035_0513127_104_577 157
274 3300049823 Ga0501044_0316961 Ga0501044_0316961_562_1035 157
275 3300049824 Ga0501045_0203597 Ga0501045_0203597_895_1368 157
276 3300053077 Ga0495601_0597655 Ga0495601_0597655_106_579 157
277 3300053096 Ga0500641_0004946 Ga0500641_0004946_431_904 157
278 3300036712 Ga0316584_0633968 Ga0316584_0633968_69_545 158
279 3300005444 Ga0070694_100210220 Ga0070694_1002102202 162
280 3300005617 Ga0068859_100529247 Ga0068859_1005292472 162
281 3300005719 Ga0068861_100857263 Ga0068861_1008572632 162
282 3300006931 Ga0097620_100529256 Ga0097620_1005292562 162
283 3300009177 Ga0105248_10042119 Ga0105248_100421193 162
284 3300026089 Ga0207648_11162644 Ga0207648_111626443 162
285 3300005295 Ga0065707_10182817 Ga0065707_101828173 163
286 3300005330 Ga0070690_100358690 Ga0070690_1003586902 163
287 3300005334 Ga0068869_100563201 Ga0068869_1005632012 163
288 3300005340 Ga0070689_101018908 Ga0070689_1010189081 163
289 3300005353 Ga0070669_100919326 Ga0070669_1009193262 163
290 3300005544 Ga0070686_100154776 Ga0070686_1001547763 163
291 3300005544 Ga0070686_100269295 Ga0070686_1002692953 163
292 3300005577 Ga0068857_100421834 Ga0068857_1004218343 163
293 3300005578 Ga0068854_100168273 Ga0068854_1001682733 163
294 3300005615 Ga0070702_100177838 Ga0070702_1001778381 163
295 3300005617 Ga0068859_100023699 Ga0068859_10002369913 163
296 3300005617 Ga0068859_100177735 Ga0068859_1001777353 163
297 3300005719 Ga0068861_101084865 Ga0068861_1010848652 163
298 3300005843 Ga0068860_100858729 Ga0068860_1008587292 163
299 3300005844 Ga0068862_100003064 Ga0068862_10000306417 163
300 3300006931 Ga0097620_100023702 Ga0097620_10002370213 163
301 3300006931 Ga0097620_100177752 Ga0097620_1001777523 163
302 3300009177 Ga0105248_11145127 Ga0105248_111451272 163
303 3300009553 Ga0105249_10031296 Ga0105249_100312968 163
304 3300013306 Ga0163162_10150017 Ga0163162_101500173 163
305 3300013308 Ga0157375_10527601 Ga0157375_105276012 163
306 3300014968 Ga0157379_10071539 Ga0157379_100715396 163
307 3300025961 Ga0207712_10354550 Ga0207712_103545502 163
308 3300025981 Ga0207640_10718489 Ga0207640_107184892 163
309 3300026088 Ga0207641_11059816 Ga0207641_110598162 163
310 3300026118 Ga0207675_100620348 Ga0207675_1006203481 163
311 3300028380 Ga0268265_10081718 Ga0268265_100817183 163
312 3300028381 Ga0268264_10684731 Ga0268264_106847312 163
313 3300045051 Ga0451576_0121215 Ga0451576_0121215_179_670 163

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yc4-assembly1.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.812 25 163
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.7987 25 163
2yc4-assembly1.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.7955 25 163
2yc4-assembly1.cif.gz_A intraflagellar transport complex 25-27 from chlamydomonas 0.7913 33 163
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.7771 25 163
ID Description Score Start End Superfamily
2yc4A00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7913 33 163 2.60.120.260
1tvgA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7686 35 163 2.60.120.260
af_A0A1D6EW30_590_725_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7647 38 163 2.60.120.260
4a3zA00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7567 27 163 2.60.120.260
2v72A00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7532 26 162 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A2S8K3A8-F1-model_v4 deleted 0.991 57 163
AF-A0A2U3LEF6-F1-model_v4 Carbohydrate-binding protein 0.9871 34 163
AF-A0A2W0BG54-F1-model_v4 Carbohydrate-binding protein 0.9822 23 163 GO:0000012
GO:0003684
AF-A0A2U3LEF6-F1-model_v4 Carbohydrate-binding protein 0.9796 34 163
AF-A0A2V7HYK2-F1-model_v4 Carbohydrate-binding protein 0.9762 26 163

Feature Viewer

pLDDT pTM Quality
87.28 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map