F402368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 190 | 313 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0426296|Ga0496105_0426296_177_701 |
| Length | 174 |
| Sequence | MLHVSCQRLHRQHLEVPIMRKRIVGSPELETAFSDDWLDLETLADVEVTSEDATHPIEAALLPGHGSGWSAATPGKQTIRLLFTRPQRLKRICLVYEEPVTVRTQEYVLRWSADGGQSYREITRQQWNFSPHGAISEAEDHRVDLNAVTALELSIIPDISGGDAVASLARLRVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 92 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 142 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 145 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 149 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 150 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 157 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 158 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 96.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10182817 | 3300005295 | Bacteria | 1407 |
| 2 | Ga0070676_10463344 | 3300005328 | Unclassified | 893 |
| 3 | Ga0070683_100064338 | 3300005329 | Bacteria | 3414 |
| 4 | Ga0070683_100106224 | 3300005329 | Bacteria | 2647 |
| 5 | Ga0070690_100358690 | 3300005330 | Bacteria | 1060 |
| 6 | Ga0070670_100056285 | 3300005331 | Bacteria | 3375 |
| 7 | Ga0068869_100009065 | 3300005334 | Bacteria | 6448 |
| 8 | Ga0068869_100563201 | 3300005334 | Bacteria | 959 |
| 9 | Ga0070680_100027156 | 3300005336 | Bacteria | 4584 |
| 10 | Ga0070680_100467763 | 3300005336 | Bacteria | 1077 |
| 11 | Ga0070682_100858495 | 3300005337 | Unclassified | 742 |
| 12 | Ga0070682_101741060 | 3300005337 | Unclassified | 542 |
| 13 | Ga0068868_100009275 | 3300005338 | Bacteria | 7073 |
| 14 | Ga0068868_100010430 | 3300005338 | Bacteria | 6725 |
| 15 | Ga0070689_100023316 | 3300005340 | Bacteria | 4632 |
| 16 | Ga0070689_101018908 | 3300005340 | Bacteria | 737 |
| 17 | Ga0070691_10317948 | 3300005341 | Unclassified | 855 |
| 18 | Ga0070661_100015065 | 3300005344 | Bacteria | 5455 |
| 19 | Ga0070669_100919326 | 3300005353 | Bacteria | 748 |
| 20 | Ga0070671_100752612 | 3300005355 | Unclassified | 847 |
| 21 | Ga0070673_100440230 | 3300005364 | Bacteria | 1171 |
| 22 | Ga0070709_10015970 | 3300005434 | Bacteria | 4277 |
| 23 | Ga0070709_10303035 | 3300005434 | Bacteria | 1167 |
| 24 | Ga0070713_100005203 | 3300005436 | Bacteria | 8860 |
| 25 | Ga0070713_100042904 | 3300005436 | Bacteria | 3695 |
| 26 | Ga0070710_10107186 | 3300005437 | Unclassified | 1673 |
| 27 | Ga0070711_100004751 | 3300005439 | Bacteria | 8046 |
| 28 | Ga0070711_100709073 | 3300005439 | Bacteria | 848 |
| 29 | Ga0070694_100210220 | 3300005444 | Bacteria | 1455 |
| 30 | Ga0070678_101007389 | 3300005456 | Unclassified | 766 |
| 31 | Ga0070681_10000156 | 3300005458 | Bacteria | 52135 |
| 32 | Ga0070681_10012133 | 3300005458 | Bacteria | 8548 |
| 33 | Ga0068867_100007372 | 3300005459 | Bacteria | 7781 |
| 34 | Ga0068867_100253041 | 3300005459 | Bacteria | 1433 |
| 35 | Ga0070706_101164450 | 3300005467 | Unclassified | 709 |
| 36 | Ga0070707_100305169 | 3300005468 | Unclassified | 1547 |
| 37 | Ga0070707_100612752 | 3300005468 | Bacteria | 1051 |
| 38 | Ga0070698_100265327 | 3300005471 | Bacteria | 1649 |
| 39 | Ga0070698_100724606 | 3300005471 | Bacteria | 937 |
| 40 | Ga0070679_100786057 | 3300005530 | Unclassified | 895 |
| 41 | Ga0070684_100014809 | 3300005535 | Bacteria | 6328 |
| 42 | Ga0070684_100147906 | 3300005535 | Bacteria | 2127 |
| 43 | Ga0068853_100009550 | 3300005539 | Bacteria | 7816 |
| 44 | Ga0068853_100237845 | 3300005539 | Bacteria | 1668 |
| 45 | Ga0068853_100665085 | 3300005539 | Unclassified | 992 |
| 46 | Ga0070686_100154776 | 3300005544 | Bacteria | 1609 |
| 47 | Ga0070686_100269295 | 3300005544 | Unclassified | 1252 |
| 48 | Ga0070686_100582458 | 3300005544 | Unclassified | 879 |
| 49 | Ga0070693_100045896 | 3300005547 | Bacteria | 2479 |
| 50 | Ga0070665_100223647 | 3300005548 | Bacteria | 1883 |
| 51 | Ga0068855_100001475 | 3300005563 | Bacteria | 29415 |
| 52 | Ga0068855_100025904 | 3300005563 | Bacteria | 7015 |
| 53 | Ga0068855_100633845 | 3300005563 | Bacteria | 1150 |
| 54 | Ga0068855_101930673 | 3300005563 | Unclassified | 597 |
| 55 | Ga0070664_100003569 | 3300005564 | Bacteria | 12559 |
| 56 | Ga0070664_100070010 | 3300005564 | Bacteria | 3003 |
| 57 | Ga0068857_100000641 | 3300005577 | Bacteria | 25788 |
| 58 | Ga0068857_100014388 | 3300005577 | Bacteria | 6898 |
| 59 | Ga0068857_100421834 | 3300005577 | Bacteria | 1244 |
| 60 | Ga0068854_100024720 | 3300005578 | Bacteria | 4116 |
| 61 | Ga0068854_100117767 | 3300005578 | Bacteria | 2012 |
| 62 | Ga0068854_100168273 | 3300005578 | Bacteria | 1703 |
| 63 | Ga0068856_100004507 | 3300005614 | Bacteria | 13849 |
| 64 | Ga0068856_100024951 | 3300005614 | Bacteria | 5826 |
| 65 | Ga0070702_100177838 | 3300005615 | Bacteria | 1390 |
| 66 | Ga0068852_100010110 | 3300005616 | Bacteria | 7025 |
| 67 | Ga0068852_100357073 | 3300005616 | Bacteria | 1428 |
| 68 | Ga0068859_100011305 | 3300005617 | Bacteria | 8982 |
| 69 | Ga0068859_100019975 | 3300005617 | Bacteria | 6726 |
| 70 | Ga0068859_100023699 | 3300005617 | Bacteria | 6160 |
| 71 | Ga0068859_100177735 | 3300005617 | Bacteria | 2211 |
| 72 | Ga0068859_100529247 | 3300005617 | Bacteria | 1273 |
| 73 | Ga0068859_101234693 | 3300005617 | Unclassified | 823 |
| 74 | Ga0068864_100009353 | 3300005618 | Bacteria | 8085 |
| 75 | Ga0068866_10010247 | 3300005718 | Bacteria | 4012 |
| 76 | Ga0068861_100072610 | 3300005719 | Bacteria | 2670 |
| 77 | Ga0068861_100857263 | 3300005719 | Bacteria | 857 |
| 78 | Ga0068861_101084865 | 3300005719 | Bacteria | 769 |
| 79 | Ga0068851_10402587 | 3300005834 | Unclassified | 805 |
| 80 | Ga0068851_10616817 | 3300005834 | Unclassified | 661 |
| 81 | Ga0068863_100097770 | 3300005841 | Bacteria | 2788 |
| 82 | Ga0068858_100017558 | 3300005842 | Bacteria | 6710 |
| 83 | Ga0068858_100049278 | 3300005842 | Bacteria | 3901 |
| 84 | Ga0068860_100013764 | 3300005843 | Bacteria | 7931 |
| 85 | Ga0068860_100235895 | 3300005843 | Bacteria | 1778 |
| 86 | Ga0068860_100672959 | 3300005843 | Bacteria | 1044 |
| 87 | Ga0068860_100858729 | 3300005843 | Bacteria | 922 |
| 88 | Ga0068862_100003064 | 3300005844 | Bacteria | 14566 |
| 89 | Ga0070717_10000164 | 3300006028 | Bacteria | 50120 |
| 90 | Ga0070717_10000617 | 3300006028 | Bacteria | 22842 |
| 91 | Ga0070717_10046925 | 3300006028 | Bacteria | 3536 |
| 92 | Ga0070715_10032852 | 3300006163 | Bacteria | 2117 |
| 93 | Ga0070716_100009160 | 3300006173 | Bacteria | 4927 |
| 94 | Ga0070712_100045507 | 3300006175 | Bacteria | 3030 |
| 95 | Ga0097621_100000127 | 3300006237 | Bacteria | 44332 |
| 96 | Ga0097621_100037834 | 3300006237 | Bacteria | 3869 |
| 97 | Ga0068871_100002994 | 3300006358 | Bacteria | 11589 |
| 98 | Ga0068871_100059259 | 3300006358 | Bacteria | 3119 |
| 99 | Ga0068871_100603803 | 3300006358 | Unclassified | 998 |
| 100 | Ga0068871_100703494 | 3300006358 | Unclassified | 926 |
| 101 | Ga0075431_100345706 | 3300006847 | Unclassified | 1496 |
| 102 | Ga0075433_10022856 | 3300006852 | Bacteria | 5254 |
| 103 | Ga0075433_10054740 | 3300006852 | Bacteria | 3481 |
| 104 | Ga0075433_10057245 | 3300006852 | Unclassified | 3407 |
| 105 | Ga0075434_100000617 | 3300006871 | Bacteria | 27495 |
| 106 | Ga0075434_100140327 | 3300006871 | Bacteria | 2436 |
| 107 | Ga0075434_100371603 | 3300006871 | Unclassified | 1451 |
| 108 | Ga0068865_100312947 | 3300006881 | Bacteria | 1260 |
| 109 | Ga0075436_100042496 | 3300006914 | Bacteria | 3135 |
| 110 | Ga0097620_100011305 | 3300006931 | Bacteria | 8982 |
| 111 | Ga0097620_100019973 | 3300006931 | Bacteria | 6726 |
| 112 | Ga0097620_100023702 | 3300006931 | Bacteria | 6160 |
| 113 | Ga0097620_100177752 | 3300006931 | Bacteria | 2211 |
| 114 | Ga0097620_100529256 | 3300006931 | Bacteria | 1273 |
| 115 | Ga0097620_101234291 | 3300006931 | Unclassified | 823 |
| 116 | Ga0075435_100002729 | 3300007076 | Bacteria | 11787 |
| 117 | Ga0075435_100107505 | 3300007076 | Bacteria | 2317 |
| 118 | Ga0075435_101530496 | 3300007076 | Unclassified | 585 |
| 119 | Ga0105240_10001253 | 3300009093 | Bacteria | 44068 |
| 120 | Ga0105240_10311784 | 3300009093 | Bacteria | 1796 |
| 121 | Ga0111539_10191843 | 3300009094 | Unclassified | 2384 |
| 122 | Ga0114129_10007684 | 3300009147 | Bacteria | 15343 |
| 123 | Ga0114129_10142363 | 3300009147 | Unclassified | 3286 |
| 124 | Ga0114129_10233119 | 3300009147 | Bacteria | 2478 |
| 125 | Ga0105243_11133450 | 3300009148 | Unclassified | 792 |
| 126 | Ga0105241_10005471 | 3300009174 | Bacteria | 9393 |
| 127 | Ga0105242_10177018 | 3300009176 | Unclassified | 1879 |
| 128 | Ga0105242_10406294 | 3300009176 | Bacteria | 1272 |
| 129 | Ga0105248_10042119 | 3300009177 | Bacteria | 5121 |
| 130 | Ga0105248_10169261 | 3300009177 | Bacteria | 2462 |
| 131 | Ga0105248_10217769 | 3300009177 | Bacteria | 2150 |
| 132 | Ga0105248_11145127 | 3300009177 | Unclassified | 879 |
| 133 | Ga0105237_10044386 | 3300009545 | Bacteria | 4475 |
| 134 | Ga0105237_10166132 | 3300009545 | Bacteria | 2206 |
| 135 | Ga0105238_10000143 | 3300009551 | Bacteria | 78219 |
| 136 | Ga0105238_10024246 | 3300009551 | Bacteria | 6184 |
| 137 | Ga0105249_10031296 | 3300009553 | Bacteria | 4812 |
| 138 | Ga0105239_10012272 | 3300010375 | Bacteria | 9544 |
| 139 | Ga0105239_10097815 | 3300010375 | Bacteria | 3244 |
| 140 | Ga0157373_10181461 | 3300013100 | Bacteria | 1482 |
| 141 | Ga0157373_10191039 | 3300013100 | Bacteria | 1443 |
| 142 | Ga0157373_10196063 | 3300013100 | Bacteria | 1423 |
| 143 | Ga0157373_10237573 | 3300013100 | Unclassified | 1288 |
| 144 | Ga0157371_10044070 | 3300013102 | Bacteria | 3178 |
| 145 | Ga0157371_10059957 | 3300013102 | Bacteria | 2698 |
| 146 | Ga0157370_10094773 | 3300013104 | Bacteria | 2800 |
| 147 | Ga0157370_10340135 | 3300013104 | Bacteria | 1383 |
| 148 | Ga0157369_10000102 | 3300013105 | Bacteria | 118470 |
| 149 | Ga0157369_10244766 | 3300013105 | Bacteria | 1872 |
| 150 | Ga0157369_10298868 | 3300013105 | Bacteria | 1675 |
| 151 | Ga0157369_10570413 | 3300013105 | Unclassified | 1169 |
| 152 | Ga0157374_10000403 | 3300013296 | Bacteria | 39283 |
| 153 | Ga0157374_10007138 | 3300013296 | Bacteria | 9516 |
| 154 | Ga0157378_10001159 | 3300013297 | Bacteria | 23973 |
| 155 | Ga0157378_10005764 | 3300013297 | Bacteria | 10848 |
| 156 | Ga0157378_10081201 | 3300013297 | Bacteria | 2930 |
| 157 | Ga0157378_10495090 | 3300013297 | Unclassified | 1220 |
| 158 | Ga0163162_10150017 | 3300013306 | Bacteria | 2448 |
| 159 | Ga0163162_10340557 | 3300013306 | Bacteria | 1632 |
| 160 | Ga0157372_10000340 | 3300013307 | Bacteria | 51471 |
| 161 | Ga0157372_10008040 | 3300013307 | Bacteria | 11216 |
| 162 | Ga0157372_10429745 | 3300013307 | Bacteria | 1539 |
| 163 | Ga0157372_10754964 | 3300013307 | Unclassified | 1131 |
| 164 | Ga0157375_10527601 | 3300013308 | Bacteria | 1343 |
| 165 | Ga0163163_10097897 | 3300014325 | Bacteria | 2954 |
| 166 | Ga0163163_10681161 | 3300014325 | Unclassified | 1092 |
| 167 | Ga0157380_10391336 | 3300014326 | Bacteria | 1315 |
| 168 | Ga0182008_10194292 | 3300014497 | Bacteria | 1030 |
| 169 | Ga0157377_10401784 | 3300014745 | Bacteria | 933 |
| 170 | Ga0157379_10071539 | 3300014968 | Bacteria | 3102 |
| 171 | Ga0157376_10017088 | 3300014969 | Bacteria | 5526 |
| 172 | Ga0157376_10802343 | 3300014969 | Unclassified | 954 |
| 173 | Ga0206349_1699182 | 3300020075 | Unclassified | 705 |
| 174 | Ga0206350_11412981 | 3300020080 | Unclassified | 867 |
| 175 | Ga0154015_1232121 | 3300020610 | Unclassified | 874 |
| 176 | Ga0213874_10063110 | 3300021377 | Unclassified | 1165 |
| 177 | Ga0224712_10097256 | 3300022467 | Unclassified | 1242 |
| 178 | Ga0207656_10406629 | 3300025321 | Unclassified | 685 |
| 179 | Ga0207692_10119615 | 3300025898 | Unclassified | 1473 |
| 180 | Ga0207642_10164523 | 3300025899 | Bacteria | 1194 |
| 181 | Ga0207647_10039034 | 3300025904 | Bacteria | 2999 |
| 182 | Ga0207685_10021495 | 3300025905 | Bacteria | 2163 |
| 183 | Ga0207699_10012443 | 3300025906 | Bacteria | 4329 |
| 184 | Ga0207699_10069719 | 3300025906 | Bacteria | 2145 |
| 185 | Ga0207645_10482052 | 3300025907 | Unclassified | 839 |
| 186 | Ga0207684_10411456 | 3300025910 | Unclassified | 1162 |
| 187 | Ga0207654_10016210 | 3300025911 | Bacteria | 3876 |
| 188 | Ga0207707_10000127 | 3300025912 | Bacteria | 78669 |
| 189 | Ga0207707_10044617 | 3300025912 | Bacteria | 3865 |
| 190 | Ga0207695_10093236 | 3300025913 | Bacteria | 3021 |
| 191 | Ga0207671_10281719 | 3300025914 | Bacteria | 1311 |
| 192 | Ga0207671_10375060 | 3300025914 | Bacteria | 1130 |
| 193 | Ga0207671_10527853 | 3300025914 | Unclassified | 941 |
| 194 | Ga0207693_10006117 | 3300025915 | Bacteria | 9977 |
| 195 | Ga0207660_10410024 | 3300025917 | Bacteria | 1092 |
| 196 | Ga0207660_10503272 | 3300025917 | Unclassified | 983 |
| 197 | Ga0207662_10654905 | 3300025918 | Unclassified | 734 |
| 198 | Ga0207649_10008380 | 3300025920 | Bacteria | 5634 |
| 199 | Ga0207646_10173714 | 3300025922 | Bacteria | 1946 |
| 200 | Ga0207646_10223353 | 3300025922 | Unclassified | 1702 |
| 201 | Ga0207646_10636017 | 3300025922 | Unclassified | 956 |
| 202 | Ga0207694_10000539 | 3300025924 | Bacteria | 34355 |
| 203 | Ga0207650_10027553 | 3300025925 | Bacteria | 4068 |
| 204 | Ga0207700_10006374 | 3300025928 | Bacteria | 7118 |
| 205 | Ga0207700_10215014 | 3300025928 | Bacteria | 1627 |
| 206 | Ga0207706_10318473 | 3300025933 | Bacteria | 1354 |
| 207 | Ga0207686_10598605 | 3300025934 | Unclassified | 867 |
| 208 | Ga0207670_10064792 | 3300025936 | Bacteria | 2506 |
| 209 | Ga0207704_10356759 | 3300025938 | Bacteria | 1140 |
| 210 | Ga0207665_10000274 | 3300025939 | Bacteria | 35743 |
| 211 | Ga0207711_10123795 | 3300025941 | Bacteria | 2311 |
| 212 | Ga0207711_10763653 | 3300025941 | Bacteria | 901 |
| 213 | Ga0207689_10008046 | 3300025942 | Bacteria | 9201 |
| 214 | Ga0207661_10082304 | 3300025944 | Bacteria | 2661 |
| 215 | Ga0207661_10253732 | 3300025944 | Bacteria | 1564 |
| 216 | Ga0207679_10076460 | 3300025945 | Bacteria | 2544 |
| 217 | Ga0207679_10236355 | 3300025945 | Bacteria | 1546 |
| 218 | Ga0207667_10001751 | 3300025949 | Bacteria | 27306 |
| 219 | Ga0207667_10033376 | 3300025949 | Bacteria | 5533 |
| 220 | Ga0207667_10872297 | 3300025949 | Unclassified | 893 |
| 221 | Ga0207651_10805117 | 3300025960 | Unclassified | 833 |
| 222 | Ga0207712_10354550 | 3300025961 | Bacteria | 1221 |
| 223 | Ga0207640_10041137 | 3300025981 | Bacteria | 2938 |
| 224 | Ga0207640_10087348 | 3300025981 | Bacteria | 2149 |
| 225 | Ga0207640_10206875 | 3300025981 | Bacteria | 1492 |
| 226 | Ga0207640_10718489 | 3300025981 | Bacteria | 858 |
| 227 | Ga0207677_10005920 | 3300026023 | Bacteria | 6654 |
| 228 | Ga0207677_10011784 | 3300026023 | Bacteria | 4999 |
| 229 | Ga0207703_10009414 | 3300026035 | Bacteria | 7674 |
| 230 | Ga0207703_10088419 | 3300026035 | Bacteria | 2600 |
| 231 | Ga0207703_10133003 | 3300026035 | Bacteria | 2150 |
| 232 | Ga0207639_10006660 | 3300026041 | Bacteria | 7857 |
| 233 | Ga0207639_10207909 | 3300026041 | Bacteria | 1683 |
| 234 | Ga0207639_10966032 | 3300026041 | Unclassified | 797 |
| 235 | Ga0207702_10000427 | 3300026078 | Bacteria | 48314 |
| 236 | Ga0207702_10007982 | 3300026078 | Bacteria | 8969 |
| 237 | Ga0207641_11059816 | 3300026088 | Unclassified | 809 |
| 238 | Ga0207648_10013322 | 3300026089 | Bacteria | 7656 |
| 239 | Ga0207648_10043460 | 3300026089 | Unclassified | 3944 |
| 240 | Ga0207648_11162644 | 3300026089 | Unclassified | 724 |
| 241 | Ga0207676_10531314 | 3300026095 | Bacteria | 1121 |
| 242 | Ga0207674_10002558 | 3300026116 | Bacteria | 22905 |
| 243 | Ga0207674_10004032 | 3300026116 | Bacteria | 17824 |
| 244 | Ga0207675_100620348 | 3300026118 | Unclassified | 1086 |
| 245 | Ga0210002_1016115 | 3300027617 | Unclassified | 1181 |
| 246 | Ga0209971_1008559 | 3300027682 | Bacteria | 2428 |
| 247 | Ga0209966_1001397 | 3300027695 | Bacteria | 4223 |
| 248 | Ga0209974_10040018 | 3300027876 | Unclassified | 1559 |
| 249 | Ga0268265_10081718 | 3300028380 | Bacteria | 2552 |
| 250 | Ga0268264_10438536 | 3300028381 | Bacteria | 1263 |
| 251 | Ga0268264_10533303 | 3300028381 | Bacteria | 1149 |
| 252 | Ga0268264_10684731 | 3300028381 | Bacteria | 1017 |
| 253 | Ga0316579_10001836 | 3300031691 | Bacteria | 7848 |
| 254 | Ga0316577_10015873 | 3300031733 | Bacteria | 4145 |
| 255 | Ga0307416_101182369 | 3300032002 | Unclassified | 870 |
| 256 | Ga0316585_10059435 | 3300032137 | Bacteria | 1233 |
| 257 | Ga0316580_10013528 | 3300032139 | Bacteria | 2488 |
| 258 | Ga0316574_0010445 | 3300035398 | Bacteria | 5249 |
| 259 | Ga0373937_0117997 | 3300036401 | Bacteria | 2472 |
| 260 | Ga0316582_0152689 | 3300036647 | Bacteria | 1561 |
| 261 | Ga0316584_0120081 | 3300036712 | Bacteria | 1964 |
| 262 | Ga0316584_0633968 | 3300036712 | Bacteria | 738 |
| 263 | Ga0316581_0004639 | 3300037588 | Bacteria | 3521 |
| 264 | Ga0395901_0619774 | 3300038443 | Bacteria | 1089 |
| 265 | Ga0436365_0317333 | 3300039437 | Unclassified | 1012 |
| 266 | Ga0436361_1084868 | 3300039447 | Bacteria | 2827 |
| 267 | Ga0436363_1325680 | 3300039450 | Unclassified | 2310 |
| 268 | Ga0436362_0420249 | 3300039453 | Unclassified | 864 |
| 269 | Ga0439441_087034 | 3300042001 | Unclassified | 687 |
| 270 | Ga0453683_0709941 | 3300044673 | Unclassified | 659 |
| 271 | Ga0453684_0843032 | 3300044712 | Bacteria | 985 |
| 272 | Ga0451576_0121215 | 3300045051 | Bacteria | 2723 |
| 273 | Ga0495580_0041489 | 3300046472 | Bacteria | 3282 |
| 274 | Ga0495656_0410726 | 3300046615 | Unclassified | 709 |
| 275 | Ga0495634_0222272 | 3300046642 | Bacteria | 1165 |
| 276 | Ga0495674_0350177 | 3300047319 | Unclassified | 1199 |
| 277 | Ga0496100_0466100 | 3300048903 | Bacteria | 970 |
| 278 | Ga0496102_0750997 | 3300048905 | Unclassified | 898 |
| 279 | Ga0496104_0561886 | 3300048907 | Bacteria | 1052 |
| 280 | Ga0496105_0426296 | 3300048908 | Bacteria | 1050 |
| 281 | Ga0496108_0470466 | 3300048911 | Bacteria | 1098 |
| 282 | Ga0496110_0235419 | 3300048913 | Bacteria | 1666 |
| 283 | Ga0496112_0005439 | 3300048915 | Bacteria | 11017 |
| 284 | Ga0496112_0018520 | 3300048915 | Bacteria | 6557 |
| 285 | Ga0501036_0261672 | 3300049572 | Unclassified | 1449 |
| 286 | Ga0501036_0500049 | 3300049572 | Unclassified | 1011 |
| 287 | Ga0501038_0609377 | 3300049574 | Unclassified | 825 |
| 288 | Ga0501039_0521010 | 3300049575 | Unclassified | 933 |
| 289 | Ga0501041_0099552 | 3300049577 | Unclassified | 1798 |
| 290 | Ga0501046_0817134 | 3300049580 | Unclassified | 653 |
| 291 | Ga0501071_0239418 | 3300049587 | Unclassified | 1368 |
| 292 | Ga0501071_1354976 | 3300049587 | Unclassified | 549 |
| 293 | Ga0501074_0910362 | 3300049590 | Unclassified | 619 |
| 294 | Ga0501076_1152896 | 3300049592 | Unclassified | 638 |
| 295 | Ga0501077_0119694 | 3300049593 | Unclassified | 1668 |
| 296 | Ga0501035_0513127 | 3300049822 | Unclassified | 985 |
| 297 | Ga0501044_0316961 | 3300049823 | Bacteria | 1485 |
| 298 | Ga0501045_0203597 | 3300049824 | Unclassified | 1474 |
| 299 | nmdc:mga05p37_236293_c1 | 3300050507 | Unclassified | 2199 |
| 300 | nmdc:mga05p37_2909_c1 | 3300050507 | Bacteria | 19871 |
| 301 | nmdc:mga05p37_324479_c1 | 3300050507 | Bacteria | 1821 |
| 302 | nmdc:mga06r32_630692_c1 | 3300050510 | Unclassified | 1041 |
| 303 | nmdc:mga0n895_1121210_c1 | 3300050512 | Unclassified | 763 |
| 304 | nmdc:mga0n895_19050_c1 | 3300050512 | Bacteria | 6370 |
| 305 | nmdc:mga0n895_54056_c1 | 3300050512 | Bacteria | 3948 |
| 306 | nmdc:mga0rr50_886711_c1 | 3300050513 | Unclassified | 761 |
| 307 | nmdc:mga0rr50_988187_c1 | 3300050513 | Unclassified | 717 |
| 308 | nmdc:mga08x19_94454_c1 | 3300050514 | Bacteria | 1977 |
| 309 | nmdc:mga0a205_44918_c1 | 3300050515 | Bacteria | 4260 |
| 310 | nmdc:mga0a205_57512_c1 | 3300050515 | Unclassified | 3755 |
| 311 | nmdc:mga0a205_66131_c2 | 3300050515 | Bacteria | 2687 |
| 312 | Ga0495601_0597655 | 3300053077 | Unclassified | 708 |
| 313 | Ga0500641_0004946 | 3300053096 | Bacteria | 4725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1325680 | Ga0436363_1325680_975_1376 | 133 |
| 2 | 3300046472 | Ga0495580_0041489 | Ga0495580_0041489_2057_2464 | 135 |
| 3 | 3300005328 | Ga0070676_10463344 | Ga0070676_104633442 | 143 |
| 4 | 3300005329 | Ga0070683_100064338 | Ga0070683_1000643386 | 143 |
| 5 | 3300005331 | Ga0070670_100056285 | Ga0070670_1000562855 | 143 |
| 6 | 3300005336 | Ga0070680_100467763 | Ga0070680_1004677631 | 143 |
| 7 | 3300005338 | Ga0068868_100010430 | Ga0068868_1000104306 | 143 |
| 8 | 3300005340 | Ga0070689_100023316 | Ga0070689_1000233164 | 143 |
| 9 | 3300005344 | Ga0070661_100015065 | Ga0070661_1000150656 | 143 |
| 10 | 3300005355 | Ga0070671_100752612 | Ga0070671_1007526121 | 143 |
| 11 | 3300005458 | Ga0070681_10012133 | Ga0070681_100121336 | 143 |
| 12 | 3300005459 | Ga0068867_100007372 | Ga0068867_1000073725 | 143 |
| 13 | 3300005530 | Ga0070679_100786057 | Ga0070679_1007860572 | 143 |
| 14 | 3300005535 | Ga0070684_100014809 | Ga0070684_1000148097 | 143 |
| 15 | 3300005539 | Ga0068853_100237845 | Ga0068853_1002378453 | 143 |
| 16 | 3300005544 | Ga0070686_100582458 | Ga0070686_1005824582 | 143 |
| 17 | 3300005547 | Ga0070693_100045896 | Ga0070693_1000458962 | 143 |
| 18 | 3300005563 | Ga0068855_100025904 | Ga0068855_1000259046 | 143 |
| 19 | 3300005564 | Ga0070664_100003569 | Ga0070664_10000356910 | 143 |
| 20 | 3300005577 | Ga0068857_100014388 | Ga0068857_1000143882 | 143 |
| 21 | 3300005614 | Ga0068856_100024951 | Ga0068856_1000249516 | 143 |
| 22 | 3300005617 | Ga0068859_100011305 | Ga0068859_1000113055 | 143 |
| 23 | 3300005618 | Ga0068864_100009353 | Ga0068864_10000935311 | 143 |
| 24 | 3300005718 | Ga0068866_10010247 | Ga0068866_100102473 | 143 |
| 25 | 3300005719 | Ga0068861_100072610 | Ga0068861_1000726102 | 143 |
| 26 | 3300005834 | Ga0068851_10402587 | Ga0068851_104025872 | 143 |
| 27 | 3300005842 | Ga0068858_100049278 | Ga0068858_1000492786 | 143 |
| 28 | 3300005843 | Ga0068860_100672959 | Ga0068860_1006729592 | 143 |
| 29 | 3300006237 | Ga0097621_100037834 | Ga0097621_1000378342 | 143 |
| 30 | 3300006358 | Ga0068871_100059259 | Ga0068871_1000592591 | 143 |
| 31 | 3300006881 | Ga0068865_100312947 | Ga0068865_1003129471 | 143 |
| 32 | 3300006931 | Ga0097620_100011305 | Ga0097620_10001130510 | 143 |
| 33 | 3300009176 | Ga0105242_10406294 | Ga0105242_104062943 | 143 |
| 34 | 3300009177 | Ga0105248_10169261 | Ga0105248_101692612 | 143 |
| 35 | 3300010375 | Ga0105239_10012272 | Ga0105239_100122724 | 143 |
| 36 | 3300013100 | Ga0157373_10191039 | Ga0157373_101910392 | 143 |
| 37 | 3300013102 | Ga0157371_10059957 | Ga0157371_100599573 | 143 |
| 38 | 3300013296 | Ga0157374_10007138 | Ga0157374_1000713812 | 143 |
| 39 | 3300013297 | Ga0157378_10005764 | Ga0157378_1000576411 | 143 |
| 40 | 3300013307 | Ga0157372_10008040 | Ga0157372_100080407 | 143 |
| 41 | 3300014325 | Ga0163163_10097897 | Ga0163163_100978974 | 143 |
| 42 | 3300014969 | Ga0157376_10802343 | Ga0157376_108023432 | 143 |
| 43 | 3300025899 | Ga0207642_10164523 | Ga0207642_101645232 | 143 |
| 44 | 3300025907 | Ga0207645_10482052 | Ga0207645_104820522 | 143 |
| 45 | 3300025912 | Ga0207707_10044617 | Ga0207707_100446178 | 143 |
| 46 | 3300025914 | Ga0207671_10527853 | Ga0207671_105278532 | 143 |
| 47 | 3300025917 | Ga0207660_10410024 | Ga0207660_104100242 | 143 |
| 48 | 3300025918 | Ga0207662_10654905 | Ga0207662_106549052 | 143 |
| 49 | 3300025920 | Ga0207649_10008380 | Ga0207649_100083806 | 143 |
| 50 | 3300025925 | Ga0207650_10027553 | Ga0207650_100275536 | 143 |
| 51 | 3300025934 | Ga0207686_10598605 | Ga0207686_105986052 | 143 |
| 52 | 3300025936 | Ga0207670_10064792 | Ga0207670_100647922 | 143 |
| 53 | 3300025938 | Ga0207704_10356759 | Ga0207704_103567591 | 143 |
| 54 | 3300025941 | Ga0207711_10123795 | Ga0207711_101237953 | 143 |
| 55 | 3300025944 | Ga0207661_10082304 | Ga0207661_100823042 | 143 |
| 56 | 3300025945 | Ga0207679_10236355 | Ga0207679_102363553 | 143 |
| 57 | 3300025949 | Ga0207667_10033376 | Ga0207667_100333769 | 143 |
| 58 | 3300025981 | Ga0207640_10087348 | Ga0207640_100873482 | 143 |
| 59 | 3300026023 | Ga0207677_10005920 | Ga0207677_100059207 | 143 |
| 60 | 3300026035 | Ga0207703_10088419 | Ga0207703_100884192 | 143 |
| 61 | 3300026041 | Ga0207639_10207909 | Ga0207639_102079092 | 143 |
| 62 | 3300026078 | Ga0207702_10007982 | Ga0207702_100079828 | 143 |
| 63 | 3300026089 | Ga0207648_10013322 | Ga0207648_1001332212 | 143 |
| 64 | 3300026116 | Ga0207674_10002558 | Ga0207674_1000255810 | 143 |
| 65 | 3300028381 | Ga0268264_10533303 | Ga0268264_105333031 | 143 |
| 66 | 3300044673 | Ga0453683_0709941 | Ga0453683_0709941_171_605 | 144 |
| 67 | 3300005334 | Ga0068869_100009065 | Ga0068869_1000090655 | 151 |
| 68 | 3300005337 | Ga0070682_100858495 | Ga0070682_1008584951 | 151 |
| 69 | 3300005539 | Ga0068853_100665085 | Ga0068853_1006650851 | 151 |
| 70 | 3300005548 | Ga0070665_100223647 | Ga0070665_1002236472 | 151 |
| 71 | 3300005563 | Ga0068855_100633845 | Ga0068855_1006338451 | 151 |
| 72 | 3300005563 | Ga0068855_101930673 | Ga0068855_1019306731 | 151 |
| 73 | 3300005578 | Ga0068854_100117767 | Ga0068854_1001177673 | 151 |
| 74 | 3300005616 | Ga0068852_100357073 | Ga0068852_1003570732 | 151 |
| 75 | 3300005617 | Ga0068859_100019975 | Ga0068859_1000199756 | 151 |
| 76 | 3300005842 | Ga0068858_100017558 | Ga0068858_1000175589 | 151 |
| 77 | 3300005843 | Ga0068860_100013764 | Ga0068860_1000137646 | 151 |
| 78 | 3300006931 | Ga0097620_100019973 | Ga0097620_1000199736 | 151 |
| 79 | 3300009093 | Ga0105240_10311784 | Ga0105240_103117843 | 151 |
| 80 | 3300009177 | Ga0105248_10217769 | Ga0105248_102177694 | 151 |
| 81 | 3300009545 | Ga0105237_10044386 | Ga0105237_100443865 | 151 |
| 82 | 3300009551 | Ga0105238_10024246 | Ga0105238_100242466 | 151 |
| 83 | 3300010375 | Ga0105239_10097815 | Ga0105239_100978155 | 151 |
| 84 | 3300013100 | Ga0157373_10181461 | Ga0157373_101814612 | 151 |
| 85 | 3300013104 | Ga0157370_10094773 | Ga0157370_100947734 | 151 |
| 86 | 3300013105 | Ga0157369_10244766 | Ga0157369_102447663 | 151 |
| 87 | 3300013105 | Ga0157369_10298868 | Ga0157369_102988683 | 151 |
| 88 | 3300013297 | Ga0157378_10081201 | Ga0157378_100812013 | 151 |
| 89 | 3300013306 | Ga0163162_10340557 | Ga0163162_103405572 | 151 |
| 90 | 3300013307 | Ga0157372_10429745 | Ga0157372_104297452 | 151 |
| 91 | 3300013307 | Ga0157372_10754964 | Ga0157372_107549643 | 151 |
| 92 | 3300014497 | Ga0182008_10194292 | Ga0182008_101942923 | 151 |
| 93 | 3300025904 | Ga0207647_10039034 | Ga0207647_100390344 | 151 |
| 94 | 3300025913 | Ga0207695_10093236 | Ga0207695_100932363 | 151 |
| 95 | 3300025914 | Ga0207671_10375060 | Ga0207671_103750602 | 151 |
| 96 | 3300025933 | Ga0207706_10318473 | Ga0207706_103184732 | 151 |
| 97 | 3300025941 | Ga0207711_10763653 | Ga0207711_107636532 | 151 |
| 98 | 3300025942 | Ga0207689_10008046 | Ga0207689_1000804610 | 151 |
| 99 | 3300025949 | Ga0207667_10872297 | Ga0207667_108722971 | 151 |
| 100 | 3300025981 | Ga0207640_10206875 | Ga0207640_102068752 | 151 |
| 101 | 3300026035 | Ga0207703_10009414 | Ga0207703_100094142 | 151 |
| 102 | 3300026041 | Ga0207639_10966032 | Ga0207639_109660321 | 151 |
| 103 | 3300048915 | Ga0496112_0018520 | Ga0496112_0018520_5917_6390 | 151 |
| 104 | 3300005329 | Ga0070683_100106224 | Ga0070683_1001062242 | 152 |
| 105 | 3300005336 | Ga0070680_100027156 | Ga0070680_1000271561 | 152 |
| 106 | 3300005337 | Ga0070682_101741060 | Ga0070682_1017410601 | 152 |
| 107 | 3300005338 | Ga0068868_100009275 | Ga0068868_1000092756 | 152 |
| 108 | 3300005341 | Ga0070691_10317948 | Ga0070691_103179481 | 152 |
| 109 | 3300005364 | Ga0070673_100440230 | Ga0070673_1004402302 | 152 |
| 110 | 3300005434 | Ga0070709_10015970 | Ga0070709_100159702 | 152 |
| 111 | 3300005436 | Ga0070713_100005203 | Ga0070713_1000052033 | 152 |
| 112 | 3300005436 | Ga0070713_100042904 | Ga0070713_1000429042 | 152 |
| 113 | 3300005437 | Ga0070710_10107186 | Ga0070710_101071862 | 152 |
| 114 | 3300005439 | Ga0070711_100004751 | Ga0070711_1000047512 | 152 |
| 115 | 3300005458 | Ga0070681_10000156 | Ga0070681_1000015623 | 152 |
| 116 | 3300005535 | Ga0070684_100147906 | Ga0070684_1001479062 | 152 |
| 117 | 3300005539 | Ga0068853_100009550 | Ga0068853_1000095502 | 152 |
| 118 | 3300005563 | Ga0068855_100001475 | Ga0068855_10000147512 | 152 |
| 119 | 3300005564 | Ga0070664_100070010 | Ga0070664_1000700103 | 152 |
| 120 | 3300005577 | Ga0068857_100000641 | Ga0068857_10000064117 | 152 |
| 121 | 3300005578 | Ga0068854_100024720 | Ga0068854_1000247202 | 152 |
| 122 | 3300005614 | Ga0068856_100004507 | Ga0068856_1000045072 | 152 |
| 123 | 3300005616 | Ga0068852_100010110 | Ga0068852_1000101105 | 152 |
| 124 | 3300005834 | Ga0068851_10616817 | Ga0068851_106168171 | 152 |
| 125 | 3300005841 | Ga0068863_100097770 | Ga0068863_1000977704 | 152 |
| 126 | 3300005843 | Ga0068860_100235895 | Ga0068860_1002358952 | 152 |
| 127 | 3300006028 | Ga0070717_10046925 | Ga0070717_100469252 | 152 |
| 128 | 3300006237 | Ga0097621_100000127 | Ga0097621_1000001277 | 152 |
| 129 | 3300006358 | Ga0068871_100002994 | Ga0068871_10000299411 | 152 |
| 130 | 3300009093 | Ga0105240_10001253 | Ga0105240_100012533 | 152 |
| 131 | 3300009174 | Ga0105241_10005471 | Ga0105241_100054714 | 152 |
| 132 | 3300009545 | Ga0105237_10166132 | Ga0105237_101661321 | 152 |
| 133 | 3300009551 | Ga0105238_10000143 | Ga0105238_1000014336 | 152 |
| 134 | 3300013100 | Ga0157373_10196063 | Ga0157373_101960631 | 152 |
| 135 | 3300013102 | Ga0157371_10044070 | Ga0157371_100440702 | 152 |
| 136 | 3300013104 | Ga0157370_10340135 | Ga0157370_103401352 | 152 |
| 137 | 3300013105 | Ga0157369_10000102 | Ga0157369_1000010267 | 152 |
| 138 | 3300013296 | Ga0157374_10000403 | Ga0157374_1000040313 | 152 |
| 139 | 3300013297 | Ga0157378_10001159 | Ga0157378_1000115914 | 152 |
| 140 | 3300013307 | Ga0157372_10000340 | Ga0157372_1000034037 | 152 |
| 141 | 3300014325 | Ga0163163_10681161 | Ga0163163_106811611 | 152 |
| 142 | 3300014969 | Ga0157376_10017088 | Ga0157376_100170884 | 152 |
| 143 | 3300020080 | Ga0206350_11412981 | Ga0206350_114129811 | 152 |
| 144 | 3300020610 | Ga0154015_1232121 | Ga0154015_12321211 | 152 |
| 145 | 3300021377 | Ga0213874_10063110 | Ga0213874_100631102 | 152 |
| 146 | 3300022467 | Ga0224712_10097256 | Ga0224712_100972562 | 152 |
| 147 | 3300025321 | Ga0207656_10406629 | Ga0207656_104066292 | 152 |
| 148 | 3300025898 | Ga0207692_10119615 | Ga0207692_101196152 | 152 |
| 149 | 3300025906 | Ga0207699_10012443 | Ga0207699_100124434 | 152 |
| 150 | 3300025911 | Ga0207654_10016210 | Ga0207654_100162102 | 152 |
| 151 | 3300025912 | Ga0207707_10000127 | Ga0207707_100001273 | 152 |
| 152 | 3300025914 | Ga0207671_10281719 | Ga0207671_102817191 | 152 |
| 153 | 3300025917 | Ga0207660_10503272 | Ga0207660_105032721 | 152 |
| 154 | 3300025924 | Ga0207694_10000539 | Ga0207694_1000053910 | 152 |
| 155 | 3300025928 | Ga0207700_10006374 | Ga0207700_100063745 | 152 |
| 156 | 3300025928 | Ga0207700_10215014 | Ga0207700_102150142 | 152 |
| 157 | 3300025944 | Ga0207661_10253732 | Ga0207661_102537322 | 152 |
| 158 | 3300025945 | Ga0207679_10076460 | Ga0207679_100764602 | 152 |
| 159 | 3300025949 | Ga0207667_10001751 | Ga0207667_100017512 | 152 |
| 160 | 3300025960 | Ga0207651_10805117 | Ga0207651_108051171 | 152 |
| 161 | 3300025981 | Ga0207640_10041137 | Ga0207640_100411372 | 152 |
| 162 | 3300026023 | Ga0207677_10011784 | Ga0207677_100117842 | 152 |
| 163 | 3300026035 | Ga0207703_10133003 | Ga0207703_101330031 | 152 |
| 164 | 3300026041 | Ga0207639_10006660 | Ga0207639_100066606 | 152 |
| 165 | 3300026078 | Ga0207702_10000427 | Ga0207702_1000042735 | 152 |
| 166 | 3300026095 | Ga0207676_10531314 | Ga0207676_105313142 | 152 |
| 167 | 3300026116 | Ga0207674_10004032 | Ga0207674_100040325 | 152 |
| 168 | 3300028381 | Ga0268264_10438536 | Ga0268264_104385363 | 152 |
| 169 | 3300048905 | Ga0496102_0750997 | Ga0496102_0750997_338_796 | 152 |
| 170 | 3300048907 | Ga0496104_0561886 | Ga0496104_0561886_484_942 | 152 |
| 171 | 3300048911 | Ga0496108_0470466 | Ga0496108_0470466_245_703 | 152 |
| 172 | 3300048913 | Ga0496110_0235419 | Ga0496110_0235419_644_1102 | 152 |
| 173 | 3300048915 | Ga0496112_0005439 | Ga0496112_0005439_7797_8255 | 152 |
| 174 | 3300006852 | Ga0075433_10022856 | Ga0075433_100228566 | 154 |
| 175 | 3300006871 | Ga0075434_100000617 | Ga0075434_1000006172 | 154 |
| 176 | 3300006914 | Ga0075436_100042496 | Ga0075436_1000424964 | 154 |
| 177 | 3300007076 | Ga0075435_100002729 | Ga0075435_1000027295 | 154 |
| 178 | 3300009147 | Ga0114129_10233119 | Ga0114129_102331194 | 154 |
| 179 | 3300050507 | nmdc:mga05p37_324479_c1 | nmdc:mga05p37_324479_c1_879_1367 | 154 |
| 180 | 3300050512 | nmdc:mga0n895_19050_c1 | nmdc:mga0n895_19050_c1_2320_2928 | 154 |
| 181 | 3300050514 | nmdc:mga08x19_94454_c1 | nmdc:mga08x19_94454_c1_341_829 | 154 |
| 182 | 3300050515 | nmdc:mga0a205_44918_c1 | nmdc:mga0a205_44918_c1_2946_3434 | 154 |
| 183 | 3300005459 | Ga0068867_100253041 | Ga0068867_1002530412 | 155 |
| 184 | 3300006847 | Ga0075431_100345706 | Ga0075431_1003457062 | 155 |
| 185 | 3300006852 | Ga0075433_10054740 | Ga0075433_100547403 | 155 |
| 186 | 3300006871 | Ga0075434_100140327 | Ga0075434_1001403273 | 155 |
| 187 | 3300007076 | Ga0075435_100107505 | Ga0075435_1001075051 | 155 |
| 188 | 3300009094 | Ga0111539_10191843 | Ga0111539_101918432 | 155 |
| 189 | 3300009147 | Ga0114129_10007684 | Ga0114129_100076846 | 155 |
| 190 | 3300009176 | Ga0105242_10177018 | Ga0105242_101770182 | 155 |
| 191 | 3300026089 | Ga0207648_10043460 | Ga0207648_100434602 | 155 |
| 192 | 3300027617 | Ga0210002_1016115 | Ga0210002_10161151 | 155 |
| 193 | 3300027682 | Ga0209971_1008559 | Ga0209971_10085592 | 155 |
| 194 | 3300027695 | Ga0209966_1001397 | Ga0209966_10013975 | 155 |
| 195 | 3300027876 | Ga0209974_10040018 | Ga0209974_100400182 | 155 |
| 196 | 3300039437 | Ga0436365_0317333 | Ga0436365_0317333_261_731 | 155 |
| 197 | 3300039453 | Ga0436362_0420249 | Ga0436362_0420249_262_732 | 155 |
| 198 | 3300050507 | nmdc:mga05p37_2909_c1 | nmdc:mga05p37_2909_c1_1005_1475 | 155 |
| 199 | 3300050510 | nmdc:mga06r32_630692_c1 | nmdc:mga06r32_630692_c1_420_887 | 155 |
| 200 | 3300050512 | nmdc:mga0n895_54056_c1 | nmdc:mga0n895_54056_c1_1299_1769 | 155 |
| 201 | 3300050513 | nmdc:mga0rr50_886711_c1 | nmdc:mga0rr50_886711_c1_111_581 | 155 |
| 202 | 3300050515 | nmdc:mga0a205_66131_c2 | nmdc:mga0a205_66131_c2_904_1374 | 155 |
| 203 | 3300005434 | Ga0070709_10303035 | Ga0070709_103030352 | 156 |
| 204 | 3300005439 | Ga0070711_100709073 | Ga0070711_1007090731 | 156 |
| 205 | 3300006163 | Ga0070715_10032852 | Ga0070715_100328524 | 156 |
| 206 | 3300006173 | Ga0070716_100009160 | Ga0070716_1000091602 | 156 |
| 207 | 3300006175 | Ga0070712_100045507 | Ga0070712_1000455071 | 156 |
| 208 | 3300006358 | Ga0068871_100703494 | Ga0068871_1007034942 | 156 |
| 209 | 3300006852 | Ga0075433_10057245 | Ga0075433_100572456 | 156 |
| 210 | 3300006871 | Ga0075434_100371603 | Ga0075434_1003716032 | 156 |
| 211 | 3300009147 | Ga0114129_10142363 | Ga0114129_101423631 | 156 |
| 212 | 3300025905 | Ga0207685_10021495 | Ga0207685_100214951 | 156 |
| 213 | 3300025906 | Ga0207699_10069719 | Ga0207699_100697192 | 156 |
| 214 | 3300025915 | Ga0207693_10006117 | Ga0207693_100061171 | 156 |
| 215 | 3300025939 | Ga0207665_10000274 | Ga0207665_100002745 | 156 |
| 216 | 3300048903 | Ga0496100_0466100 | Ga0496100_0466100_343_813 | 156 |
| 217 | 3300048908 | Ga0496105_0426296 | Ga0496105_0426296_177_701 | 156 |
| 218 | 3300050507 | nmdc:mga05p37_236293_c1 | nmdc:mga05p37_236293_c1_817_1287 | 156 |
| 219 | 3300050512 | nmdc:mga0n895_1121210_c1 | nmdc:mga0n895_1121210_c1_218_688 | 156 |
| 220 | 3300050513 | nmdc:mga0rr50_988187_c1 | nmdc:mga0rr50_988187_c1_209_679 | 156 |
| 221 | 3300050515 | nmdc:mga0a205_57512_c1 | nmdc:mga0a205_57512_c1_487_957 | 156 |
| 222 | 3300005456 | Ga0070678_101007389 | Ga0070678_1010073892 | 157 |
| 223 | 3300005467 | Ga0070706_101164450 | Ga0070706_1011644501 | 157 |
| 224 | 3300005468 | Ga0070707_100305169 | Ga0070707_1003051692 | 157 |
| 225 | 3300005468 | Ga0070707_100612752 | Ga0070707_1006127521 | 157 |
| 226 | 3300005471 | Ga0070698_100265327 | Ga0070698_1002653272 | 157 |
| 227 | 3300005471 | Ga0070698_100724606 | Ga0070698_1007246061 | 157 |
| 228 | 3300005617 | Ga0068859_101234693 | Ga0068859_1012346931 | 157 |
| 229 | 3300006028 | Ga0070717_10000164 | Ga0070717_100001643 | 157 |
| 230 | 3300006028 | Ga0070717_10000617 | Ga0070717_100006175 | 157 |
| 231 | 3300006358 | Ga0068871_100603803 | Ga0068871_1006038031 | 157 |
| 232 | 3300006931 | Ga0097620_101234291 | Ga0097620_1012342911 | 157 |
| 233 | 3300007076 | Ga0075435_101530496 | Ga0075435_1015304961 | 157 |
| 234 | 3300009148 | Ga0105243_11133450 | Ga0105243_111334501 | 157 |
| 235 | 3300013100 | Ga0157373_10237573 | Ga0157373_102375733 | 157 |
| 236 | 3300013105 | Ga0157369_10570413 | Ga0157369_105704132 | 157 |
| 237 | 3300013297 | Ga0157378_10495090 | Ga0157378_104950901 | 157 |
| 238 | 3300014326 | Ga0157380_10391336 | Ga0157380_103913362 | 157 |
| 239 | 3300014745 | Ga0157377_10401784 | Ga0157377_104017842 | 157 |
| 240 | 3300020075 | Ga0206349_1699182 | Ga0206349_16991821 | 157 |
| 241 | 3300025910 | Ga0207684_10411456 | Ga0207684_104114561 | 157 |
| 242 | 3300025922 | Ga0207646_10173714 | Ga0207646_101737143 | 157 |
| 243 | 3300025922 | Ga0207646_10223353 | Ga0207646_102233532 | 157 |
| 244 | 3300025922 | Ga0207646_10636017 | Ga0207646_106360171 | 157 |
| 245 | 3300031691 | Ga0316579_10001836 | Ga0316579_100018366 | 157 |
| 246 | 3300031733 | Ga0316577_10015873 | Ga0316577_100158732 | 157 |
| 247 | 3300032002 | Ga0307416_101182369 | Ga0307416_1011823692 | 157 |
| 248 | 3300032137 | Ga0316585_10059435 | Ga0316585_100594352 | 157 |
| 249 | 3300032139 | Ga0316580_10013528 | Ga0316580_100135281 | 157 |
| 250 | 3300035398 | Ga0316574_0010445 | Ga0316574_0010445_4521_4997 | 157 |
| 251 | 3300036401 | Ga0373937_0117997 | Ga0373937_0117997_107_580 | 157 |
| 252 | 3300036647 | Ga0316582_0152689 | Ga0316582_0152689_16_492 | 157 |
| 253 | 3300036712 | Ga0316584_0120081 | Ga0316584_0120081_17_493 | 157 |
| 254 | 3300037588 | Ga0316581_0004639 | Ga0316581_0004639_320_796 | 157 |
| 255 | 3300038443 | Ga0395901_0619774 | Ga0395901_0619774_351_824 | 157 |
| 256 | 3300039447 | Ga0436361_1084868 | Ga0436361_1084868_1446_1919 | 157 |
| 257 | 3300042001 | Ga0439441_087034 | Ga0439441_087034_50_523 | 157 |
| 258 | 3300044712 | Ga0453684_0843032 | Ga0453684_0843032_413_886 | 157 |
| 259 | 3300046615 | Ga0495656_0410726 | Ga0495656_0410726_98_571 | 157 |
| 260 | 3300046642 | Ga0495634_0222272 | Ga0495634_0222272_639_1112 | 157 |
| 261 | 3300047319 | Ga0495674_0350177 | Ga0495674_0350177_335_808 | 157 |
| 262 | 3300049572 | Ga0501036_0261672 | Ga0501036_0261672_481_954 | 157 |
| 263 | 3300049572 | Ga0501036_0500049 | Ga0501036_0500049_523_996 | 157 |
| 264 | 3300049574 | Ga0501038_0609377 | Ga0501038_0609377_341_814 | 157 |
| 265 | 3300049575 | Ga0501039_0521010 | Ga0501039_0521010_379_852 | 157 |
| 266 | 3300049577 | Ga0501041_0099552 | Ga0501041_0099552_1251_1724 | 157 |
| 267 | 3300049580 | Ga0501046_0817134 | Ga0501046_0817134_30_503 | 157 |
| 268 | 3300049587 | Ga0501071_0239418 | Ga0501071_0239418_734_1207 | 157 |
| 269 | 3300049587 | Ga0501071_1354976 | Ga0501071_1354976_35_508 | 157 |
| 270 | 3300049590 | Ga0501074_0910362 | Ga0501074_0910362_90_563 | 157 |
| 271 | 3300049592 | Ga0501076_1152896 | Ga0501076_1152896_52_525 | 157 |
| 272 | 3300049593 | Ga0501077_0119694 | Ga0501077_0119694_414_887 | 157 |
| 273 | 3300049822 | Ga0501035_0513127 | Ga0501035_0513127_104_577 | 157 |
| 274 | 3300049823 | Ga0501044_0316961 | Ga0501044_0316961_562_1035 | 157 |
| 275 | 3300049824 | Ga0501045_0203597 | Ga0501045_0203597_895_1368 | 157 |
| 276 | 3300053077 | Ga0495601_0597655 | Ga0495601_0597655_106_579 | 157 |
| 277 | 3300053096 | Ga0500641_0004946 | Ga0500641_0004946_431_904 | 157 |
| 278 | 3300036712 | Ga0316584_0633968 | Ga0316584_0633968_69_545 | 158 |
| 279 | 3300005444 | Ga0070694_100210220 | Ga0070694_1002102202 | 162 |
| 280 | 3300005617 | Ga0068859_100529247 | Ga0068859_1005292472 | 162 |
| 281 | 3300005719 | Ga0068861_100857263 | Ga0068861_1008572632 | 162 |
| 282 | 3300006931 | Ga0097620_100529256 | Ga0097620_1005292562 | 162 |
| 283 | 3300009177 | Ga0105248_10042119 | Ga0105248_100421193 | 162 |
| 284 | 3300026089 | Ga0207648_11162644 | Ga0207648_111626443 | 162 |
| 285 | 3300005295 | Ga0065707_10182817 | Ga0065707_101828173 | 163 |
| 286 | 3300005330 | Ga0070690_100358690 | Ga0070690_1003586902 | 163 |
| 287 | 3300005334 | Ga0068869_100563201 | Ga0068869_1005632012 | 163 |
| 288 | 3300005340 | Ga0070689_101018908 | Ga0070689_1010189081 | 163 |
| 289 | 3300005353 | Ga0070669_100919326 | Ga0070669_1009193262 | 163 |
| 290 | 3300005544 | Ga0070686_100154776 | Ga0070686_1001547763 | 163 |
| 291 | 3300005544 | Ga0070686_100269295 | Ga0070686_1002692953 | 163 |
| 292 | 3300005577 | Ga0068857_100421834 | Ga0068857_1004218343 | 163 |
| 293 | 3300005578 | Ga0068854_100168273 | Ga0068854_1001682733 | 163 |
| 294 | 3300005615 | Ga0070702_100177838 | Ga0070702_1001778381 | 163 |
| 295 | 3300005617 | Ga0068859_100023699 | Ga0068859_10002369913 | 163 |
| 296 | 3300005617 | Ga0068859_100177735 | Ga0068859_1001777353 | 163 |
| 297 | 3300005719 | Ga0068861_101084865 | Ga0068861_1010848652 | 163 |
| 298 | 3300005843 | Ga0068860_100858729 | Ga0068860_1008587292 | 163 |
| 299 | 3300005844 | Ga0068862_100003064 | Ga0068862_10000306417 | 163 |
| 300 | 3300006931 | Ga0097620_100023702 | Ga0097620_10002370213 | 163 |
| 301 | 3300006931 | Ga0097620_100177752 | Ga0097620_1001777523 | 163 |
| 302 | 3300009177 | Ga0105248_11145127 | Ga0105248_111451272 | 163 |
| 303 | 3300009553 | Ga0105249_10031296 | Ga0105249_100312968 | 163 |
| 304 | 3300013306 | Ga0163162_10150017 | Ga0163162_101500173 | 163 |
| 305 | 3300013308 | Ga0157375_10527601 | Ga0157375_105276012 | 163 |
| 306 | 3300014968 | Ga0157379_10071539 | Ga0157379_100715396 | 163 |
| 307 | 3300025961 | Ga0207712_10354550 | Ga0207712_103545502 | 163 |
| 308 | 3300025981 | Ga0207640_10718489 | Ga0207640_107184892 | 163 |
| 309 | 3300026088 | Ga0207641_11059816 | Ga0207641_110598162 | 163 |
| 310 | 3300026118 | Ga0207675_100620348 | Ga0207675_1006203481 | 163 |
| 311 | 3300028380 | Ga0268265_10081718 | Ga0268265_100817183 | 163 |
| 312 | 3300028381 | Ga0268264_10684731 | Ga0268264_106847312 | 163 |
| 313 | 3300045051 | Ga0451576_0121215 | Ga0451576_0121215_179_670 | 163 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yc4-assembly1.cif.gz_B | intraflagellar transport complex 25-27 from chlamydomonas | 0.812 | 25 | 163 |
| 2yc2-assembly2.cif.gz_B | intraflagellar transport complex 25-27 from chlamydomonas | 0.7987 | 25 | 163 |
| 2yc4-assembly1.cif.gz_B | intraflagellar transport complex 25-27 from chlamydomonas | 0.7955 | 25 | 163 |
| 2yc4-assembly1.cif.gz_A | intraflagellar transport complex 25-27 from chlamydomonas | 0.7913 | 33 | 163 |
| 2yc2-assembly2.cif.gz_B | intraflagellar transport complex 25-27 from chlamydomonas | 0.7771 | 25 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yc4A00 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7913 | 33 | 163 | 2.60.120.260 |
| 1tvgA00 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7686 | 35 | 163 | 2.60.120.260 |
| af_A0A1D6EW30_590_725_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7647 | 38 | 163 | 2.60.120.260 |
| 4a3zA00 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7567 | 27 | 163 | 2.60.120.260 |
| 2v72A00 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7532 | 26 | 162 | 2.60.120.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8K3A8-F1-model_v4 | deleted | 0.991 | 57 | 163 |
|
| AF-A0A2U3LEF6-F1-model_v4 | Carbohydrate-binding protein | 0.9871 | 34 | 163 |
|
| AF-A0A2W0BG54-F1-model_v4 | Carbohydrate-binding protein | 0.9822 | 23 | 163 |
GO:0000012
GO:0003684 |
| AF-A0A2U3LEF6-F1-model_v4 | Carbohydrate-binding protein | 0.9796 | 34 | 163 |
|
| AF-A0A2V7HYK2-F1-model_v4 | Carbohydrate-binding protein | 0.9762 | 26 | 163 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar