F401821

General Info

Members Datasets Scaffolds Average Seq Length
312 161 304 216

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0003057|Ga0466972_0003057_1523_2236
Length 237
Sequence MGLFANRQAEIAGRLVSGAHVTQITDYTSLQTAVTEYLARDQDATLIARIPTFIQLAEAKFNRQLFVRQMEQRATALVDLGSSEPEFISLPSDFQSMRRVRLSSVTGKPCLEFRSGTQMDEYRFATSDVAAQPRYFTVFGTELELAPTPDAAYTLEMVYRQNVPPLASNGSNWLLAMAPDLYLYGALLETAPYIKEDARIQTWALGFTSALTELNNLGLTSTFNAGPMTVRVSGQVI

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
4 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
5 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
6 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
7 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
58 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
149 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
150 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
155 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
156 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
157 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
158 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
159 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
160 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
161 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.9
Nodule 4.49
Rhizoplane 3.21
Rhizosphere 71.47
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10083913 3300001979 Bacteria 830
2 JGI25153J46596_10063632 3300003215 Bacteria 988
3 JGI25160J50197_1000636 3300003354 Bacteria 19563
4 Ga0065165_1001555 3300005262 Bacteria 23837
5 Ga0065707_10026848 3300005295 Bacteria 2474
6 Ga0065707_10186993 3300005295 Bacteria 1383
7 Ga0068869_100077230 3300005334 Bacteria 2477
8 Ga0070680_100001487 3300005336 Bacteria 17034
9 Ga0070680_100012265 3300005336 Bacteria 6656
10 Ga0070689_100589812 3300005340 Bacteria 962
11 Ga0070668_100816689 3300005347 Bacteria 829
12 Ga0070710_10269148 3300005437 Unclassified 1101
13 Ga0070711_100132007 3300005439 Bacteria 1861
14 Ga0070700_100064816 3300005441 Viruses 2314
15 Ga0070662_100315698 3300005457 Bacteria 1273
16 Ga0070681_10000951 3300005458 Bacteria 24399
17 Ga0070681_10003591 3300005458 Bacteria 14540
18 Ga0070699_100005696 3300005518 Bacteria 10912
19 Ga0070679_100007749 3300005530 Bacteria 10056
20 Ga0070679_100009469 3300005530 Bacteria 9213
21 Ga0068853_100000200 3300005539 Bacteria 41971
22 Ga0068853_100190423 3300005539 Bacteria 1863
23 Ga0068853_100261532 3300005539 Bacteria 1591
24 Ga0068853_100838002 3300005539 Bacteria 882
25 Ga0068855_100040925 3300005563 Bacteria 5496
26 Ga0068855_100053138 3300005563 Bacteria 4767
27 Ga0068855_100202005 3300005563 Viruses 2237
28 Ga0068855_100293638 3300005563 Bacteria 1801
29 Ga0068855_100351635 3300005563 Viruses 1623
30 Ga0068855_100369227 3300005563 Bacteria 1578
31 Ga0068855_100716144 3300005563 Viruses 1070
32 Ga0068855_100819018 3300005563 Viruses 988
33 Ga0068855_101052940 3300005563 Viruses 852
34 Ga0068857_100086985 3300005577 Bacteria 2795
35 Ga0068857_100243369 3300005577 Bacteria 1647
36 Ga0068857_100319124 3300005577 Bacteria 1434
37 Ga0068857_100333852 3300005577 Bacteria 1401
38 Ga0068857_100354849 3300005577 Viruses 1358
39 Ga0068857_100554768 3300005577 Viruses 1083
40 Ga0068857_101068858 3300005577 Viruses 778
41 Ga0068854_100149885 3300005578 Bacteria 1798
42 Ga0068856_100000197 3300005614 Bacteria 63857
43 Ga0068856_100000518 3300005614 Bacteria 42504
44 Ga0068856_100000952 3300005614 Bacteria 31012
45 Ga0068856_100019250 3300005614 Bacteria 6626
46 Ga0068852_100015170 3300005616 Bacteria 5963
47 Ga0068852_100198468 3300005616 Bacteria 1898
48 Ga0068859_100209666 3300005617 Bacteria 2034
49 Ga0068851_10000223 3300005834 Bacteria 27325
50 Ga0068851_10008279 3300005834 Bacteria 4802
51 Ga0068851_10413057 3300005834 Viruses 796
52 Ga0068863_100009811 3300005841 Bacteria 9329
53 Ga0068858_100010624 3300005842 Bacteria 8714
54 Ga0068858_100146920 3300005842 Bacteria 2214
55 Ga0068860_100008265 3300005843 Bacteria 10357
56 Ga0068860_101070616 3300005843 Bacteria 825
57 Ga0068862_100000074 3300005844 Bacteria 118036
58 Ga0068862_100000464 3300005844 Bacteria 43716
59 Ga0068862_100051671 3300005844 Bacteria 3516
60 Ga0068862_100207197 3300005844 Viruses 1770
61 Ga0068862_100934164 3300005844 Viruses 854
62 Ga0081455_10107777 3300005937 Bacteria 2220
63 Ga0081539_10107800 3300005985 Bacteria 1408
64 Ga0075370_10059481 3300006353 Bacteria 2175
65 Ga0068871_100551507 3300006358 Bacteria 1044
66 Ga0097620_100209673 3300006931 Bacteria 2034
67 Ga0105250_10064088 3300009092 Viruses 1480
68 Ga0105250_10118863 3300009092 Bacteria 1085
69 Ga0105240_10003986 3300009093 Bacteria 22774
70 Ga0105240_10006359 3300009093 Bacteria 17389
71 Ga0105240_10235584 3300009093 Bacteria 2125
72 Ga0105245_10088107 3300009098 Bacteria 2850
73 Ga0105247_10015520 3300009101 Bacteria 4561
74 Ga0105247_10022187 3300009101 Bacteria 3822
75 Ga0105247_10025798 3300009101 Bacteria 3547
76 Ga0105241_10010352 3300009174 Bacteria 6845
77 Ga0105241_10072976 3300009174 Bacteria 2669
78 Ga0105241_10107620 3300009174 Bacteria 2227
79 Ga0105248_10972291 3300009177 Viruses 959
80 Ga0105237_10004156 3300009545 Bacteria 16868
81 Ga0105237_10004249 3300009545 Bacteria 16670
82 Ga0105237_10068288 3300009545 Bacteria 3549
83 Ga0105237_10287656 3300009545 Bacteria 1646
84 Ga0105237_10384246 3300009545 Bacteria 1409
85 Ga0105238_10001769 3300009551 Bacteria 21672
86 Ga0105238_10503892 3300009551 Viruses 1212
87 Ga0105238_10868073 3300009551 Viruses 920
88 Ga0105249_10000167 3300009553 Bacteria 77350
89 Ga0105239_10006053 3300010375 Bacteria 14082
90 Ga0105239_10160594 3300010375 Bacteria 2510
91 Ga0105239_10427348 3300010375 Bacteria 1501
92 Ga0157369_10260346 3300013105 Bacteria 1809
93 Ga0163163_10715046 3300014325 Bacteria 1065
94 Ga0157380_10561190 3300014326 Viruses 1122
95 Ga0157377_10000150 3300014745 Bacteria 43266
96 Ga0214544_1000055 3300021320 Bacteria 133217
97 Ga0214544_1021236 3300021320 Viruses 4312
98 Ga0214544_1022624 3300021320 Bacteria 3736
99 Ga0214542_1003813 3300021321 Bacteria 30302
100 Ga0214542_1019085 3300021321 Bacteria 5536
101 Ga0214542_1024097 3300021321 Bacteria 3475
102 Ga0214545_1003421 3300021324 Bacteria 30302
103 Ga0214545_1006673 3300021324 Bacteria 19932
104 Ga0214543_1000044 3300021327 Bacteria 158132
105 Ga0214543_1024540 3300021327 Viruses 3700
106 Ga0209677_100796 3300025253 Bacteria 15876
107 Ga0209759_1019950 3300025256 Bacteria 1573
108 Ga0209233_1013037 3300025261 Bacteria 2388
109 Ga0209758_1001110 3300025297 Bacteria 34723
110 Ga0209758_1003093 3300025297 Bacteria 15762
111 Ga0209758_1009869 3300025297 Bacteria 5830
112 Ga0209758_1025234 3300025297 Viruses 2615
113 Ga0207426_1000627 3300025302 Bacteria 44831
114 Ga0207656_10000090 3300025321 Bacteria 33465
115 Ga0207692_10284894 3300025898 Unclassified 1001
116 Ga0207710_10011094 3300025900 Bacteria 3793
117 Ga0207710_10014234 3300025900 Bacteria 3351
118 Ga0207647_10131597 3300025904 Bacteria 1470
119 Ga0207654_10000902 3300025911 Bacteria 16436
120 Ga0207654_10047447 3300025911 Viruses 2454
121 Ga0207654_10152956 3300025911 Bacteria 1483
122 Ga0207707_10002317 3300025912 Bacteria 17170
123 Ga0207707_10047217 3300025912 Bacteria 3750
124 Ga0207695_10000240 3300025913 Bacteria 143196
125 Ga0207695_10001710 3300025913 Bacteria 35146
126 Ga0207695_10026073 3300025913 Bacteria 6529
127 Ga0207695_10104343 3300025913 Viruses 2824
128 Ga0207671_10001587 3300025914 Bacteria 25827
129 Ga0207671_10011383 3300025914 Bacteria 7248
130 Ga0207671_10032589 3300025914 Bacteria 3877
131 Ga0207671_10111295 3300025914 Bacteria 2083
132 Ga0207671_10283051 3300025914 Bacteria 1308
133 Ga0207671_10396364 3300025914 Bacteria 1098
134 Ga0207663_10293528 3300025916 Bacteria 1212
135 Ga0207660_10010021 3300025917 Bacteria 6138
136 Ga0207652_10001755 3300025921 Bacteria 18929
137 Ga0207652_10003614 3300025921 Bacteria 12737
138 Ga0207694_10000206 3300025924 Bacteria 58137
139 Ga0207694_10292526 3300025924 Bacteria 1340
140 Ga0207694_10408746 3300025924 Bacteria 1129
141 Ga0207694_10562515 3300025924 Viruses 958
142 Ga0207687_10132413 3300025927 Bacteria 1881
143 Ga0207689_10107455 3300025942 Bacteria 2293
144 Ga0207689_10116171 3300025942 Bacteria 2200
145 Ga0207667_10032205 3300025949 Bacteria 5651
146 Ga0207667_10145500 3300025949 Viruses 2440
147 Ga0207667_10172987 3300025949 Viruses 2219
148 Ga0207667_10204447 3300025949 Bacteria 2025
149 Ga0207667_10288062 3300025949 Bacteria 1678
150 Ga0207667_10318026 3300025949 Bacteria 1590
151 Ga0207667_10339193 3300025949 Viruses 1534
152 Ga0207712_10000049 3300025961 Bacteria 160026
153 Ga0207712_10354227 3300025961 Viruses 1221
154 Ga0207640_10084402 3300025981 Bacteria 2181
155 Ga0207677_10477627 3300026023 Viruses 1073
156 Ga0207703_10014235 3300026035 Bacteria 6205
157 Ga0207703_10658548 3300026035 Bacteria 994
158 Ga0207639_10013282 3300026041 Bacteria 5759
159 Ga0207708_10004848 3300026075 Bacteria 9913
160 Ga0207708_10449300 3300026075 Viruses 1073
161 Ga0207702_10000026 3300026078 Bacteria 186067
162 Ga0207702_10000044 3300026078 Bacteria 149419
163 Ga0207702_10000528 3300026078 Bacteria 42681
164 Ga0207702_10003205 3300026078 Bacteria 15107
165 Ga0207702_10056032 3300026078 Viruses 3345
166 Ga0207702_10188278 3300026078 Bacteria 1905
167 Ga0207702_10302833 3300026078 Bacteria 1517
168 Ga0207641_10017900 3300026088 Bacteria 5804
169 Ga0207641_10611631 3300026088 Viruses 1068
170 Ga0207674_10020916 3300026116 Bacteria 7061
171 Ga0207674_10029714 3300026116 Bacteria 5752
172 Ga0207674_10123718 3300026116 Bacteria 2552
173 Ga0207674_10130282 3300026116 Bacteria 2479
174 Ga0207674_10722391 3300026116 Bacteria 961
175 Ga0207683_10103282 3300026121 Bacteria 2546
176 Ga0207698_10062375 3300026142 Bacteria 2910
177 Ga0207698_10367558 3300026142 Bacteria 1364
178 Ga0207698_10480516 3300026142 Bacteria 1205
179 Ga0268265_10000113 3300028380 Bacteria 101546
180 Ga0268265_10001330 3300028380 Bacteria 21128
181 Ga0268265_10001554 3300028380 Bacteria 19029
182 Ga0268265_10167016 3300028380 Bacteria 1876
183 Ga0268264_10000828 3300028381 Bacteria 33168
184 Ga0307517_10000756 3300028786 Bacteria 55661
185 Ga0265339_10004747 3300031249 Bacteria 9210
186 Ga0307513_10045171 3300031456 Bacteria 4817
187 Ga0307509_10001174 3300031507 Bacteria 44758
188 Ga0307509_10001198 3300031507 Bacteria 44147
189 Ga0307509_10027322 3300031507 Bacteria 6350
190 Ga0307508_10060397 3300031616 Bacteria 3352
191 Ga0307508_10190000 3300031616 Bacteria 1655
192 Ga0307516_10013828 3300031730 Bacteria 8571
193 Ga0307516_10193554 3300031730 Bacteria 1757
194 Ga0373940_0000008 3300035088 Bacteria 43548
195 Ga0373933_0000350 3300035724 Bacteria 29468
196 Ga0395899_0003406 3300037312 Bacteria 12615
197 Ga0395899_0004299 3300037312 Bacteria 11126
198 Ga0395900_0000433 3300037418 Bacteria 60052
199 Ga0395900_0000708 3300037418 Bacteria 44416
200 Ga0395900_0000831 3300037418 Bacteria 40763
201 Ga0395900_0002279 3300037418 Bacteria 21317
202 Ga0395900_0004951 3300037418 Bacteria 14018
203 Ga0395900_0006767 3300037418 Bacteria 11896
204 Ga0395900_0007740 3300037418 Bacteria 11084
205 Ga0395900_0013512 3300037418 Bacteria 8343
206 Ga0395900_0043058 3300037418 Viruses 4652
207 Ga0395900_0047705 3300037418 Bacteria 4411
208 Ga0395900_0215172 3300037418 Bacteria 1939
209 Ga0395900_0233730 3300037418 Bacteria 1847
210 Ga0395900_0507509 3300037418 Viruses 1155
211 Ga0395900_0583530 3300037418 Viruses 1060
212 Ga0395898_0000962 3300037466 Bacteria 45858
213 Ga0395898_0001021 3300037466 Bacteria 43637
214 Ga0395898_0012149 3300037466 Bacteria 8910
215 Ga0395898_0013809 3300037466 Bacteria 8302
216 Ga0395898_0014758 3300037466 Bacteria 8019
217 Ga0395898_0029704 3300037466 Bacteria 5471
218 Ga0395898_0046564 3300037466 Bacteria 4260
219 Ga0395898_0116990 3300037466 Bacteria 2554
220 Ga0395898_0126197 3300037466 Bacteria 2451
221 Ga0395898_0156696 3300037466 Bacteria 2178
222 Ga0395898_0191187 3300037466 Bacteria 1955
223 Ga0395905_0251645 3300037471 Bacteria 1650
224 Ga0395905_0305089 3300037471 Viruses 1480
225 Ga0395905_0963987 3300037471 Viruses 756
226 Ga0436364_0407691 3300037853 Bacteria 1122
227 Ga0395901_0001389 3300038443 Bacteria 25307
228 Ga0395901_0027941 3300038443 Bacteria 5801
229 Ga0395901_0512363 3300038443 Viruses 1220
230 Ga0395901_0689784 3300038443 Bacteria 1020
231 Ga0436365_0275508 3300039437 Bacteria 1472
232 Ga0436361_0554273 3300039447 Bacteria 4963
233 Ga0451804_0205003 3300041463 Viruses 834
234 Ga0451804_0545649 3300041463 Viruses 826
235 Ga0451807_1460274 3300041486 Viruses 2872
236 Ga0451807_2183079 3300041486 Bacteria 985
237 Ga0451849_0876096 3300041505 Viruses 2168
238 Ga0466972_0003057 3300044658 Bacteria 8299
239 Ga0466966_0142916 3300044684 Viruses 1462
240 Ga0466961_0009611 3300044693 Bacteria 6155
241 Ga0466964_0068254 3300044706 Bacteria 1497
242 Ga0466968_0018988 3300044735 Bacteria 2762
243 Ga0466960_0046060 3300044901 Bacteria 2086
244 Ga0466959_0282493 3300045049 Bacteria 1139
245 Ga0466958_0369890 3300045836 Bacteria 924
246 Ga0495580_0036202 3300046472 Viruses 3545
247 Ga0495606_0159301 3300046507 Viruses 1318
248 Ga0495643_0003258 3300046522 Bacteria 12008
249 Ga0495648_0015043 3300046524 Bacteria 5635
250 Ga0495597_0009573 3300046542 Bacteria 4779
251 Ga0495622_0130674 3300046557 Bacteria 1144
252 Ga0495622_0204721 3300046557 Viruses 878
253 Ga0495661_0014576 3300046665 Bacteria 5265
254 Ga0495600_0072179 3300046809 Bacteria 2255
255 Ga0495604_0002216 3300047317 Bacteria 15549
256 Ga0495674_0244426 3300047319 Bacteria 1478
257 Ga0495674_0281986 3300047319 Viruses 1361
258 Ga0495672_0014640 3300047320 Bacteria 5360
259 Ga0495684_0080224 3300047471 Bacteria 2477
260 Ga0495684_0101985 3300047471 Viruses 2169
261 Ga0496104_0057143 3300048907 Bacteria 3692
262 Ga0496104_0950858 3300048907 Bacteria 764
263 Ga0496105_0002405 3300048908 Bacteria 13551
264 Ga0496112_0000304 3300048915 Bacteria 31768
265 Ga0496113_0000208 3300048916 Bacteria 27346
266 Ga0496114_0012034 3300048917 Bacteria 6921
267 Ga0496118_0184734 3300048921 Viruses 1255
268 Ga0496119_0136494 3300048922 Bacteria 1330
269 Ga0496121_0004424 3300048924 Bacteria 18914
270 Ga0496121_0014207 3300048924 Bacteria 8472
271 Ga0496121_0172027 3300048924 Bacteria 1572
272 Ga0496121_0207189 3300048924 Bacteria 1392
273 Ga0496124_0032978 3300048927 Bacteria 4564
274 Ga0496125_0012293 3300048928 Bacteria 8507
275 Ga0496126_0002258 3300048929 Bacteria 26576
276 Ga0496126_0022405 3300048929 Bacteria 6149
277 Ga0496126_0073319 3300048929 Bacteria 3044
278 Ga0496126_0084012 3300048929 Bacteria 2809
279 Ga0496126_0265311 3300048929 Viruses 1427
280 Ga0496126_0311920 3300048929 Unclassified 1295
281 Ga0496126_0365157 3300048929 Bacteria 1178
282 nmdc:mga0k408_256278_c1 3300050493 Bacteria 1044
283 nmdc:mga0sz30_60523_c1 3300050516 Bacteria 1617
284 Ga0500610_0190548 3300053079 Bacteria 996
285 Ga0500635_0174276 3300053080 Viruses 829
286 Ga0500566_0098626 3300053094 Bacteria 1605
287 Ga0500641_0001608 3300053096 Bacteria 8047
288 Ga0500641_0134100 3300053096 Bacteria 1069
289 Ga0500558_000176 3300053106 Bacteria 11084
290 Ga0500569_000523 3300053109 Bacteria 6402
291 Ga0500575_094391 3300053112 Viruses 1082
292 Ga0500595_012784 3300053119 Bacteria 3235
293 Ga0500608_034014 3300053122 Bacteria 2427
294 Ga0500568_0050438 3300053139 Bacteria 1640
295 Ga0500603_020604 3300053150 Bacteria 1613
296 Ga0500604_0104885 3300053151 Bacteria 935
297 Ga0500619_012779 3300053154 Bacteria 2206
298 Ga0500627_0001525 3300053158 Bacteria 6518
299 Ga0500639_045845 3300053163 Viruses 2287
300 Ga0500637_0012381 3300053178 Bacteria 4442
301 Ga0500637_0017406 3300053178 Viruses 3848
302 Ga0500637_0019751 3300053178 Bacteria 3638
303 Ga0500625_005534 3300053729 Bacteria 5291
304 Ga0500552_000059 3300053733 Bacteria 9147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053080 Ga0500635_0174276 Ga0500635_0174276_22_603 192
2 3300037466 Ga0395898_0116990 Ga0395898_0116990_976_1563 195
3 3300053158 Ga0500627_0001525 Ga0500627_0001525_78_734 195
4 3300005563 Ga0068855_100293638 Ga0068855_1002936383 196
5 3300005577 Ga0068857_101068858 Ga0068857_1010688581 196
6 3300026116 Ga0207674_10020916 Ga0207674_100209167 196
7 3300005563 Ga0068855_100369227 Ga0068855_1003692273 198
8 3300005577 Ga0068857_100554768 Ga0068857_1005547682 198
9 3300025949 Ga0207667_10288062 Ga0207667_102880624 198
10 3300026116 Ga0207674_10123718 Ga0207674_101237185 198
11 3300025949 Ga0207667_10145500 Ga0207667_101455005 199
12 3300009093 Ga0105240_10006359 Ga0105240_100063595 200
13 3300025913 Ga0207695_10001710 Ga0207695_1000171033 200
14 3300026078 Ga0207702_10056032 Ga0207702_100560324 200
15 3300005295 Ga0065707_10186993 Ga0065707_101869931 203
16 3300005841 Ga0068863_100009811 Ga0068863_1000098113 203
17 3300005843 Ga0068860_100008265 Ga0068860_1000082653 203
18 3300005844 Ga0068862_100000074 Ga0068862_10000007416 203
19 3300009101 Ga0105247_10022187 Ga0105247_100221873 203
20 3300009553 Ga0105249_10000167 Ga0105249_1000016730 203
21 3300014326 Ga0157380_10561190 Ga0157380_105611901 203
22 3300025900 Ga0207710_10011094 Ga0207710_100110943 203
23 3300025961 Ga0207712_10000049 Ga0207712_1000004997 203
24 3300026088 Ga0207641_10017900 Ga0207641_100179006 203
25 3300028380 Ga0268265_10000113 Ga0268265_1000011333 203
26 3300028381 Ga0268264_10000828 Ga0268264_100008283 203
27 3300031456 Ga0307513_10045171 Ga0307513_100451713 203
28 3300005457 Ga0070662_100315698 Ga0070662_1003156982 207
29 3300005843 Ga0068860_101070616 Ga0068860_1010706162 208
30 3300048924 Ga0496121_0172027 Ga0496121_0172027_20_673 208
31 3300048927 Ga0496124_0032978 Ga0496124_0032978_1109_1762 208
32 3300053139 Ga0500568_0050438 Ga0500568_0050438_239_892 210
33 3300005295 Ga0065707_10026848 Ga0065707_100268483 213
34 3300005336 Ga0070680_100001487 Ga0070680_10000148711 213
35 3300005458 Ga0070681_10000951 Ga0070681_1000095110 213
36 3300005518 Ga0070699_100005696 Ga0070699_10000569612 213
37 3300005530 Ga0070679_100009469 Ga0070679_1000094697 213
38 3300005577 Ga0068857_100354849 Ga0068857_1003548492 213
39 3300021320 Ga0214544_1021236 Ga0214544_10212364 213
40 3300021320 Ga0214544_1022624 Ga0214544_10226242 213
41 3300021321 Ga0214542_1019085 Ga0214542_10190857 213
42 3300021321 Ga0214542_1024097 Ga0214542_10240973 213
43 3300021324 Ga0214545_1006673 Ga0214545_100667319 213
44 3300021327 Ga0214543_1024540 Ga0214543_10245401 213
45 3300025912 Ga0207707_10047217 Ga0207707_100472175 213
46 3300025917 Ga0207660_10010021 Ga0207660_100100212 213
47 3300025921 Ga0207652_10003614 Ga0207652_100036147 213
48 3300037312 Ga0395899_0003406 Ga0395899_0003406_7969_8613 213
49 3300037312 Ga0395899_0004299 Ga0395899_0004299_257_901 213
50 3300037418 Ga0395900_0000433 Ga0395900_0000433_44669_45313 213
51 3300037418 Ga0395900_0002279 Ga0395900_0002279_8870_9511 213
52 3300037418 Ga0395900_0006767 Ga0395900_0006767_3000_3644 213
53 3300037418 Ga0395900_0013512 Ga0395900_0013512_5767_6411 213
54 3300037418 Ga0395900_0047705 Ga0395900_0047705_1266_1910 213
55 3300037418 Ga0395900_0507509 Ga0395900_0507509_67_711 213
56 3300037418 Ga0395900_0583530 Ga0395900_0583530_129_770 213
57 3300037466 Ga0395898_0000962 Ga0395898_0000962_11807_12448 213
58 3300037466 Ga0395898_0014758 Ga0395898_0014758_6595_7239 213
59 3300037466 Ga0395898_0029704 Ga0395898_0029704_2525_3169 213
60 3300037466 Ga0395898_0126197 Ga0395898_0126197_1421_2065 213
61 3300037466 Ga0395898_0156696 Ga0395898_0156696_391_1035 213
62 3300037466 Ga0395898_0191187 Ga0395898_0191187_696_1340 213
63 3300037471 Ga0395905_0305089 Ga0395905_0305089_643_1284 213
64 3300038443 Ga0395901_0001389 Ga0395901_0001389_22822_23466 213
65 3300038443 Ga0395901_0027941 Ga0395901_0027941_2796_3440 213
66 3300038443 Ga0395901_0689784 Ga0395901_0689784_193_837 213
67 iso_pu_bacteria 2511231028 2511396366 213
68 iso_pu_bacteria 2513237141 2513888341 213
69 iso_pu_bacteria 2824704595 2824705656 213
70 iso_pu_bacteria 2876761206 2876766908 213
71 iso_pu_bacteria 2908756301 2908760488 213
72 iso_pu_bacteria 2908756301 2908762163 213
73 iso_pu_bacteria 3005506211 3005512110 213
74 iso_pu_bacteria 3005710791 3005713054 213
75 3300005563 Ga0068855_100351635 Ga0068855_1003516352 214
76 3300005842 Ga0068858_100010624 Ga0068858_10001062412 214
77 3300005844 Ga0068862_100000464 Ga0068862_10000046464 214
78 3300025949 Ga0207667_10339193 Ga0207667_103391932 214
79 3300026035 Ga0207703_10014235 Ga0207703_100142357 214
80 3300028380 Ga0268265_10001554 Ga0268265_1000155427 214
81 3300048929 Ga0496126_0311920 Ga0496126_0311920_391_1038 214
82 3300005614 Ga0068856_100000518 Ga0068856_10000051883 215
83 3300005617 Ga0068859_100209666 Ga0068859_1002096662 215
84 3300005844 Ga0068862_100207197 Ga0068862_1002071972 215
85 3300005844 Ga0068862_100934164 Ga0068862_1009341641 215
86 3300006931 Ga0097620_100209673 Ga0097620_1002096732 215
87 3300025942 Ga0207689_10116171 Ga0207689_101161712 215
88 3300025961 Ga0207712_10354227 Ga0207712_103542272 215
89 3300026023 Ga0207677_10477627 Ga0207677_104776272 215
90 3300026075 Ga0207708_10449300 Ga0207708_104493002 215
91 3300026078 Ga0207702_10000528 Ga0207702_1000052817 215
92 3300026088 Ga0207641_10611631 Ga0207641_106116312 215
93 3300028380 Ga0268265_10001330 Ga0268265_100013304 215
94 3300028380 Ga0268265_10167016 Ga0268265_101670162 215
95 3300031507 Ga0307509_10001198 Ga0307509_1000119816 215
96 3300037418 Ga0395900_0000708 Ga0395900_0000708_40013_40663 215
97 3300037466 Ga0395898_0001021 Ga0395898_0001021_19725_20375 215
98 3300046472 Ga0495580_0036202 Ga0495580_0036202_1515_2165 215
99 3300046507 Ga0495606_0159301 Ga0495606_0159301_332_979 215
100 3300046522 Ga0495643_0003258 Ga0495643_0003258_1133_1780 215
101 3300046557 Ga0495622_0130674 Ga0495622_0130674_160_810 215
102 3300046809 Ga0495600_0072179 Ga0495600_0072179_448_1095 215
103 3300047317 Ga0495604_0002216 Ga0495604_0002216_13071_13718 215
104 3300047319 Ga0495674_0281986 Ga0495674_0281986_562_1212 215
105 3300047471 Ga0495684_0101985 Ga0495684_0101985_1160_1807 215
106 3300048907 Ga0496104_0057143 Ga0496104_0057143_2828_3475 215
107 3300048908 Ga0496105_0002405 Ga0496105_0002405_4407_5054 215
108 3300048915 Ga0496112_0000304 Ga0496112_0000304_15231_15878 215
109 3300048916 Ga0496113_0000208 Ga0496113_0000208_10031_10678 215
110 3300048917 Ga0496114_0012034 Ga0496114_0012034_5173_5820 215
111 3300048929 Ga0496126_0365157 Ga0496126_0365157_462_1109 215
112 3300053112 Ga0500575_094391 Ga0500575_094391_326_976 215
113 3300053178 Ga0500637_0012381 Ga0500637_0012381_1043_1693 215
114 3300053178 Ga0500637_0019751 Ga0500637_0019751_2975_3622 215
115 3300053733 Ga0500552_000059 Ga0500552_000059_7463_8113 215
116 3300003215 JGI25153J46596_10063632 JGI25153J46596_100636322 216
117 3300005340 Ga0070689_100589812 Ga0070689_1005898121 216
118 3300005441 Ga0070700_100064816 Ga0070700_1000648163 216
119 3300005563 Ga0068855_100716144 Ga0068855_1007161442 216
120 3300009092 Ga0105250_10064088 Ga0105250_100640882 216
121 3300025297 Ga0209758_1025234 Ga0209758_10252343 216
122 3300025924 Ga0207694_10562515 Ga0207694_105625151 216
123 3300026075 Ga0207708_10004848 Ga0207708_100048489 216
124 3300037418 Ga0395900_0043058 Ga0395900_0043058_1282_1932 216
125 3300047320 Ga0495672_0014640 Ga0495672_0014640_4165_4818 216
126 3300001979 JGI24740J21852_10083913 JGI24740J21852_100839131 217
127 3300003354 JGI25160J50197_1000636 JGI25160J50197_100063610 217
128 3300005262 Ga0065165_1001555 Ga0065165_100155526 217
129 3300005334 Ga0068869_100077230 Ga0068869_1000772303 217
130 3300005336 Ga0070680_100012265 Ga0070680_1000122652 217
131 3300005347 Ga0070668_100816689 Ga0070668_1008166891 217
132 3300005437 Ga0070710_10269148 Ga0070710_102691482 217
133 3300005439 Ga0070711_100132007 Ga0070711_1001320072 217
134 3300005458 Ga0070681_10003591 Ga0070681_1000359114 217
135 3300005530 Ga0070679_100007749 Ga0070679_1000077497 217
136 3300005539 Ga0068853_100000200 Ga0068853_10000020014 217
137 3300005539 Ga0068853_100190423 Ga0068853_1001904232 217
138 3300005539 Ga0068853_100261532 Ga0068853_1002615324 217
139 3300005539 Ga0068853_100838002 Ga0068853_1008380021 217
140 3300005563 Ga0068855_100040925 Ga0068855_1000409255 217
141 3300005563 Ga0068855_100053138 Ga0068855_1000531388 217
142 3300005563 Ga0068855_100202005 Ga0068855_1002020052 217
143 3300005563 Ga0068855_100819018 Ga0068855_1008190182 217
144 3300005563 Ga0068855_101052940 Ga0068855_1010529402 217
145 3300005577 Ga0068857_100086985 Ga0068857_1000869855 217
146 3300005577 Ga0068857_100243369 Ga0068857_1002433694 217
147 3300005577 Ga0068857_100319124 Ga0068857_1003191243 217
148 3300005577 Ga0068857_100333852 Ga0068857_1003338522 217
149 3300005578 Ga0068854_100149885 Ga0068854_1001498852 217
150 3300005614 Ga0068856_100000197 Ga0068856_10000019766 217
151 3300005614 Ga0068856_100000952 Ga0068856_10000095232 217
152 3300005614 Ga0068856_100019250 Ga0068856_1000192506 217
153 3300005616 Ga0068852_100015170 Ga0068852_1000151705 217
154 3300005616 Ga0068852_100198468 Ga0068852_1001984683 217
155 3300005834 Ga0068851_10000223 Ga0068851_100002234 217
156 3300005834 Ga0068851_10008279 Ga0068851_100082792 217
157 3300005834 Ga0068851_10413057 Ga0068851_104130572 217
158 3300005842 Ga0068858_100146920 Ga0068858_1001469202 217
159 3300005844 Ga0068862_100051671 Ga0068862_1000516714 217
160 3300005937 Ga0081455_10107777 Ga0081455_101077774 217
161 3300005985 Ga0081539_10107800 Ga0081539_101078003 217
162 3300006353 Ga0075370_10059481 Ga0075370_100594813 217
163 3300006358 Ga0068871_100551507 Ga0068871_1005515072 217
164 3300009092 Ga0105250_10118863 Ga0105250_101188632 217
165 3300009093 Ga0105240_10003986 Ga0105240_1000398625 217
166 3300009093 Ga0105240_10235584 Ga0105240_102355843 217
167 3300009098 Ga0105245_10088107 Ga0105245_100881072 217
168 3300009101 Ga0105247_10015520 Ga0105247_100155205 217
169 3300009101 Ga0105247_10025798 Ga0105247_100257983 217
170 3300009174 Ga0105241_10010352 Ga0105241_100103526 217
171 3300009174 Ga0105241_10072976 Ga0105241_100729763 217
172 3300009174 Ga0105241_10107620 Ga0105241_101076206 217
173 3300009177 Ga0105248_10972291 Ga0105248_109722912 217
174 3300009545 Ga0105237_10004156 Ga0105237_1000415616 217
175 3300009545 Ga0105237_10004249 Ga0105237_1000424910 217
176 3300009545 Ga0105237_10068288 Ga0105237_100682885 217
177 3300009545 Ga0105237_10287656 Ga0105237_102876561 217
178 3300009545 Ga0105237_10384246 Ga0105237_103842462 217
179 3300009551 Ga0105238_10001769 Ga0105238_1000176912 217
180 3300009551 Ga0105238_10503892 Ga0105238_105038921 217
181 3300009551 Ga0105238_10868073 Ga0105238_108680731 217
182 3300010375 Ga0105239_10006053 Ga0105239_100060533 217
183 3300010375 Ga0105239_10160594 Ga0105239_101605945 217
184 3300010375 Ga0105239_10427348 Ga0105239_104273483 217
185 3300013105 Ga0157369_10260346 Ga0157369_102603461 217
186 3300014325 Ga0163163_10715046 Ga0163163_107150462 217
187 3300014745 Ga0157377_10000150 Ga0157377_1000015070 217
188 3300021320 Ga0214544_1000055 Ga0214544_1000055117 217
189 3300021321 Ga0214542_1003813 Ga0214542_100381324 217
190 3300021324 Ga0214545_1003421 Ga0214545_100342120 217
191 3300021327 Ga0214543_1000044 Ga0214543_100004420 217
192 3300025253 Ga0209677_100796 Ga0209677_10079623 217
193 3300025256 Ga0209759_1019950 Ga0209759_10199502 217
194 3300025261 Ga0209233_1013037 Ga0209233_10130375 217
195 3300025297 Ga0209758_1001110 Ga0209758_100111045 217
196 3300025297 Ga0209758_1003093 Ga0209758_10030935 217
197 3300025297 Ga0209758_1009869 Ga0209758_10098698 217
198 3300025302 Ga0207426_1000627 Ga0207426_10006275 217
199 3300025321 Ga0207656_10000090 Ga0207656_1000009038 217
200 3300025898 Ga0207692_10284894 Ga0207692_102848942 217
201 3300025900 Ga0207710_10014234 Ga0207710_100142345 217
202 3300025904 Ga0207647_10131597 Ga0207647_101315972 217
203 3300025911 Ga0207654_10000902 Ga0207654_1000090222 217
204 3300025911 Ga0207654_10047447 Ga0207654_100474476 217
205 3300025911 Ga0207654_10152956 Ga0207654_101529563 217
206 3300025912 Ga0207707_10002317 Ga0207707_1000231711 217
207 3300025913 Ga0207695_10000240 Ga0207695_10000240148 217
208 3300025913 Ga0207695_10026073 Ga0207695_100260739 217
209 3300025913 Ga0207695_10104343 Ga0207695_101043433 217
210 3300025914 Ga0207671_10001587 Ga0207671_1000158725 217
211 3300025914 Ga0207671_10011383 Ga0207671_100113836 217
212 3300025914 Ga0207671_10032589 Ga0207671_100325898 217
213 3300025914 Ga0207671_10111295 Ga0207671_101112953 217
214 3300025914 Ga0207671_10283051 Ga0207671_102830512 217
215 3300025914 Ga0207671_10396364 Ga0207671_103963642 217
216 3300025916 Ga0207663_10293528 Ga0207663_102935282 217
217 3300025921 Ga0207652_10001755 Ga0207652_1000175522 217
218 3300025924 Ga0207694_10000206 Ga0207694_1000020655 217
219 3300025924 Ga0207694_10292526 Ga0207694_102925261 217
220 3300025924 Ga0207694_10408746 Ga0207694_104087463 217
221 3300025927 Ga0207687_10132413 Ga0207687_101324133 217
222 3300025942 Ga0207689_10107455 Ga0207689_101074553 217
223 3300025949 Ga0207667_10032205 Ga0207667_100322058 217
224 3300025949 Ga0207667_10172987 Ga0207667_101729872 217
225 3300025949 Ga0207667_10204447 Ga0207667_102044473 217
226 3300025949 Ga0207667_10318026 Ga0207667_103180264 217
227 3300025981 Ga0207640_10084402 Ga0207640_100844023 217
228 3300026035 Ga0207703_10658548 Ga0207703_106585482 217
229 3300026041 Ga0207639_10013282 Ga0207639_100132827 217
230 3300026078 Ga0207702_10000026 Ga0207702_1000002649 217
231 3300026078 Ga0207702_10000044 Ga0207702_10000044103 217
232 3300026078 Ga0207702_10003205 Ga0207702_100032058 217
233 3300026078 Ga0207702_10188278 Ga0207702_101882784 217
234 3300026078 Ga0207702_10302833 Ga0207702_103028332 217
235 3300026116 Ga0207674_10029714 Ga0207674_100297147 217
236 3300026116 Ga0207674_10130282 Ga0207674_101302823 217
237 3300026116 Ga0207674_10722391 Ga0207674_107223912 217
238 3300026121 Ga0207683_10103282 Ga0207683_101032823 217
239 3300026142 Ga0207698_10062375 Ga0207698_100623752 217
240 3300026142 Ga0207698_10367558 Ga0207698_103675582 217
241 3300026142 Ga0207698_10480516 Ga0207698_104805161 217
242 3300028786 Ga0307517_10000756 Ga0307517_1000075650 217
243 3300031249 Ga0265339_10004747 Ga0265339_1000474712 217
244 3300031507 Ga0307509_10001174 Ga0307509_100011743 217
245 3300031507 Ga0307509_10027322 Ga0307509_100273224 217
246 3300031616 Ga0307508_10060397 Ga0307508_100603971 217
247 3300031616 Ga0307508_10190000 Ga0307508_101900002 217
248 3300031730 Ga0307516_10013828 Ga0307516_1001382811 217
249 3300031730 Ga0307516_10193554 Ga0307516_101935543 217
250 3300035088 Ga0373940_0000008 Ga0373940_0000008_18480_19133 217
251 3300035724 Ga0373933_0000350 Ga0373933_0000350_15121_15774 217
252 3300037418 Ga0395900_0000831 Ga0395900_0000831_14039_14692 217
253 3300037418 Ga0395900_0004951 Ga0395900_0004951_12335_12988 217
254 3300037418 Ga0395900_0007740 Ga0395900_0007740_6640_7293 217
255 3300037418 Ga0395900_0215172 Ga0395900_0215172_1166_1834 217
256 3300037418 Ga0395900_0233730 Ga0395900_0233730_1071_1742 217
257 3300037466 Ga0395898_0012149 Ga0395898_0012149_1035_1688 217
258 3300037466 Ga0395898_0013809 Ga0395898_0013809_5211_5864 217
259 3300037466 Ga0395898_0046564 Ga0395898_0046564_1886_2557 217
260 3300037471 Ga0395905_0251645 Ga0395905_0251645_877_1545 217
261 3300037471 Ga0395905_0963987 Ga0395905_0963987_17_673 217
262 3300037853 Ga0436364_0407691 Ga0436364_0407691_96_752 217
263 3300038443 Ga0395901_0512363 Ga0395901_0512363_232_885 217
264 3300039437 Ga0436365_0275508 Ga0436365_0275508_80_733 217
265 3300039447 Ga0436361_0554273 Ga0436361_0554273_1009_1662 217
266 3300041463 Ga0451804_0205003 Ga0451804_0205003_54_707 217
267 3300041463 Ga0451804_0545649 Ga0451804_0545649_13_684 217
268 3300041486 Ga0451807_1460274 Ga0451807_1460274_1205_1858 217
269 3300041486 Ga0451807_2183079 Ga0451807_2183079_236_907 217
270 3300041505 Ga0451849_0876096 Ga0451849_0876096_181_834 217
271 3300044658 Ga0466972_0003057 Ga0466972_0003057_1523_2236 217
272 3300044684 Ga0466966_0142916 Ga0466966_0142916_431_1084 217
273 3300044693 Ga0466961_0009611 Ga0466961_0009611_4507_5163 217
274 3300044706 Ga0466964_0068254 Ga0466964_0068254_49_702 217
275 3300044735 Ga0466968_0018988 Ga0466968_0018988_449_1102 217
276 3300044901 Ga0466960_0046060 Ga0466960_0046060_867_1520 217
277 3300045049 Ga0466959_0282493 Ga0466959_0282493_241_894 217
278 3300045836 Ga0466958_0369890 Ga0466958_0369890_66_719 217
279 3300046524 Ga0495648_0015043 Ga0495648_0015043_256_909 217
280 3300046542 Ga0495597_0009573 Ga0495597_0009573_988_1641 217
281 3300046557 Ga0495622_0204721 Ga0495622_0204721_152_811 217
282 3300046665 Ga0495661_0014576 Ga0495661_0014576_265_933 217
283 3300047319 Ga0495674_0244426 Ga0495674_0244426_150_809 217
284 3300047471 Ga0495684_0080224 Ga0495684_0080224_384_1043 217
285 3300048907 Ga0496104_0950858 Ga0496104_0950858_34_687 217
286 3300048921 Ga0496118_0184734 Ga0496118_0184734_387_1043 217
287 3300048922 Ga0496119_0136494 Ga0496119_0136494_64_717 217
288 3300048924 Ga0496121_0004424 Ga0496121_0004424_9811_10467 217
289 3300048924 Ga0496121_0014207 Ga0496121_0014207_3169_3822 217
290 3300048924 Ga0496121_0207189 Ga0496121_0207189_322_975 217
291 3300048928 Ga0496125_0012293 Ga0496125_0012293_1334_1987 217
292 3300048929 Ga0496126_0002258 Ga0496126_0002258_4654_5307 217
293 3300048929 Ga0496126_0022405 Ga0496126_0022405_2123_2776 217
294 3300048929 Ga0496126_0073319 Ga0496126_0073319_250_903 217
295 3300048929 Ga0496126_0084012 Ga0496126_0084012_442_1095 217
296 3300048929 Ga0496126_0265311 Ga0496126_0265311_422_1075 217
297 3300050493 nmdc:mga0k408_256278_c1 nmdc:mga0k408_256278_c1_129_782 217
298 3300050516 nmdc:mga0sz30_60523_c1 nmdc:mga0sz30_60523_c1_89_742 217
299 3300053079 Ga0500610_0190548 Ga0500610_0190548_73_786 217
300 3300053094 Ga0500566_0098626 Ga0500566_0098626_380_1033 217
301 3300053096 Ga0500641_0001608 Ga0500641_0001608_4364_5017 217
302 3300053096 Ga0500641_0134100 Ga0500641_0134100_187_840 217
303 3300053106 Ga0500558_000176 Ga0500558_000176_6380_7033 217
304 3300053109 Ga0500569_000523 Ga0500569_000523_1622_2275 217
305 3300053119 Ga0500595_012784 Ga0500595_012784_1131_1784 217
306 3300053122 Ga0500608_034014 Ga0500608_034014_1596_2249 217
307 3300053150 Ga0500603_020604 Ga0500603_020604_740_1393 217
308 3300053151 Ga0500604_0104885 Ga0500604_0104885_260_913 217
309 3300053154 Ga0500619_012779 Ga0500619_012779_390_1043 217
310 3300053163 Ga0500639_045845 Ga0500639_045845_84_737 217
311 3300053178 Ga0500637_0017406 Ga0500637_0017406_1302_1955 217
312 3300053729 Ga0500625_005534 Ga0500625_005534_1108_1761 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24175

24

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z4f-assembly1.cif.gz_I tail of phage su10 genome release intermediate 0.7621 4 216
7z47-assembly1.cif.gz_B tail of bacteriophage su10 0.7581 1 216
7z4b-assembly1.cif.gz_DV bacteriophage su10 virion (c1) 0.7556 1 215
7z4f-assembly1.cif.gz_I tail of phage su10 genome release intermediate 0.7494 4 216
7z4b-assembly1.cif.gz_DV bacteriophage su10 virion (c1) 0.7492 1 215
ID Description Score Start End Superfamily
4q20B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6491 154 204 1.10.287.130
5zieB01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.6227 51 140 2.60.40.1730
af_Q7ZUI3_36_199_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6092 154 204 1.25.40.10
af_Q9STS9_427_666_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5967 154 190 1.25.40.10
af_F4KFV7_645_750_1.20.58.1080 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5524 154 214 1.20.58.1080
ID Description Score Start End GO Terms
AF-A0A0R3DQD4-F1-model_v4 deleted 0.9302 1 216
AF-A0A800JSN6-F1-model_v4 deleted 0.9288 4 194
AF-A0A7X6GRC7-F1-model_v4 deleted 0.9271 2 210
AF-A0A0R3DQD4-F1-model_v4 deleted 0.926 1 216
AF-A0A7X6GRC7-F1-model_v4 deleted 0.9227 2 210

Feature Viewer

pLDDT pTM Quality
91.67 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map