F400912

General Info

Members Datasets Scaffolds Average Seq Length
310 184 620 275

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000366|Ga0501034_0000366_20359_21372
Length 312
Sequence MTDEPLPMTNEEPAVPAEATVAPGHDDPVVTLDLTDAPAGAPAVDPGSAADQGAMFEVRDLSVLYSGFRAVRDVSLDVARNQITAFIGPSGCGKTTVLRCFNRMNDLVEGAVVEGAIRFHGVDLYDPKVNPVEVRRRIGMVFQKPNPFPKSIYDNVAYGPRLAGIRKKAELDEIVERALRGAAIWDEVKDRLHKSGLGLSGGQQQRLCIARAIAVNPEVILMDEPCSALDPIATGRIEDLMEEIKQEYTIIIVTHNMQQAARVSDRCAFFTTEVSETSDTRTGVLVEYDATQKMFSNPSDIRTENYVTGRFG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
113 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
179 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
180 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
181 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
182 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
183 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
184 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 1.61
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 0.97
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000366 3300049571 Bacteria 77097
2 rootH1_10104324 3300003323 Bacteria 2490
3 Ga0055538_1001112 3300003751 Bacteria 5805
4 Ga0055535_1004526 3300003761 Bacteria 3346
5 Ga0055541_1000552 3300003841 Bacteria 10178
6 Ga0065704_10000266 3300005289 Bacteria 46396
7 Ga0065707_10000525 3300005295 Bacteria 38492
8 Ga0070680_100063396 3300005336 Bacteria 3027
9 Ga0070680_100270525 3300005336 Bacteria 1439
10 Ga0070682_100055478 3300005337 Bacteria 2489
11 Ga0070659_100117070 3300005366 Bacteria 2155
12 Ga0070710_10195861 3300005437 Bacteria 1273
13 Ga0070711_100010189 3300005439 Bacteria 5809
14 Ga0070705_100013746 3300005440 Bacteria 4146
15 Ga0070708_100004052 3300005445 Bacteria 11514
16 Ga0070708_100228233 3300005445 Bacteria 1747
17 Ga0070681_10215235 3300005458 Bacteria 1838
18 Ga0070706_100040901 3300005467 Bacteria 4280
19 Ga0070706_100311395 3300005467 Bacteria 1469
20 Ga0070707_100045023 3300005468 Bacteria 4224
21 Ga0070699_100105045 3300005518 Bacteria 2477
22 Ga0068853_100000622 3300005539 Bacteria 24335
23 Ga0070695_100484236 3300005545 Bacteria 954
24 Ga0070696_100007994 3300005546 Bacteria 7062
25 Ga0070665_100000930 3300005548 Bacteria 37459
26 Ga0070704_100002476 3300005549 Bacteria 10380
27 Ga0068855_100138253 3300005563 Bacteria 2778
28 Ga0070664_100175065 3300005564 Bacteria 1905
29 Ga0068857_100013355 3300005577 Bacteria 7151
30 Ga0068861_100430172 3300005719 Bacteria 1178
31 Ga0068870_10051430 3300005840 Bacteria 2181
32 Ga0068860_100066117 3300005843 Bacteria 3434
33 Ga0081455_10004554 3300005937 Bacteria 15473
34 Ga0081455_10021329 3300005937 Bacteria 6079
35 Ga0081455_10041639 3300005937 Bacteria 4037
36 Ga0081538_10000459 3300005981 Bacteria 45654
37 Ga0081538_10005848 3300005981 Bacteria 10959
38 Ga0075364_10052666 3300006051 Bacteria 2660
39 Ga0075364_10077954 3300006051 Bacteria 2188
40 Ga0075367_10033952 3300006178 Bacteria 2944
41 Ga0075430_100000532 3300006846 Bacteria 28687
42 Ga0075430_100003977 3300006846 Bacteria 12464
43 Ga0075430_100059639 3300006846 Bacteria 3208
44 Ga0075430_100061902 3300006846 Bacteria 3144
45 Ga0075430_100256982 3300006846 Bacteria 1447
46 Ga0075431_100002775 3300006847 Bacteria 16962
47 Ga0075431_100003261 3300006847 Bacteria 15710
48 Ga0075434_100416373 3300006871 Bacteria 1365
49 Ga0075429_100000058 3300006880 Bacteria 53378
50 Ga0075429_100000980 3300006880 Bacteria 22677
51 Ga0068865_100029138 3300006881 Bacteria 3660
52 Ga0075436_100104143 3300006914 Bacteria 1978
53 Ga0075436_100141027 3300006914 Bacteria 1694
54 Ga0075435_100028271 3300007076 Bacteria 4396
55 Ga0075435_100249200 3300007076 Bacteria 1512
56 Ga0105240_10027900 3300009093 Bacteria 7386
57 Ga0111539_10001393 3300009094 Bacteria 32172
58 Ga0111539_10044356 3300009094 Bacteria 5327
59 Ga0111539_10141195 3300009094 Bacteria 2819
60 Ga0111539_10179234 3300009094 Bacteria 2475
61 Ga0105245_10390050 3300009098 Bacteria 1389
62 Ga0114129_10001738 3300009147 Bacteria 29647
63 Ga0114129_10055754 3300009147 Bacteria 5539
64 Ga0114129_10061206 3300009147 Bacteria 5261
65 Ga0105237_10000062 3300009545 Bacteria 144236
66 Ga0157369_10001432 3300013105 Bacteria 29263
67 Ga0157369_10121315 3300013105 Bacteria 2774
68 Ga0157372_10152262 3300013307 Bacteria 2670
69 Ga0157380_10000033 3300014326 Bacteria 86616
70 Ga0213876_10079730 3300021384 Bacteria 1730
71 Ga0224712_10145183 3300022467 Bacteria 1047
72 Ga0209784_100134 3300025224 Bacteria 71273
73 Ga0209566_100613 3300025225 Bacteria 22152
74 Ga0209147_100113 3300025229 Bacteria 144844
75 Ga0209258_102096 3300025242 Bacteria 5625
76 Ga0209675_1016801 3300025291 Bacteria 2115
77 Ga0209025_1024080 3300025294 Bacteria 3157
78 Ga0209025_1027120 3300025294 Bacteria 2851
79 Ga0207692_10203573 3300025898 Bacteria 1165
80 Ga0207643_10019275 3300025908 Bacteria 3738
81 Ga0207705_10018466 3300025909 Bacteria 4987
82 Ga0207684_10047919 3300025910 Bacteria 3624
83 Ga0207684_10259640 3300025910 Bacteria 1499
84 Ga0207695_10021630 3300025913 Bacteria 7332
85 Ga0207671_10000140 3300025914 Bacteria 111643
86 Ga0207663_10140727 3300025916 Bacteria 1680
87 Ga0207663_10228764 3300025916 Bacteria 1357
88 Ga0207663_10271622 3300025916 Bacteria 1256
89 Ga0207660_10006927 3300025917 Bacteria 7340
90 Ga0207660_10265433 3300025917 Bacteria 1359
91 Ga0207652_10002200 3300025921 Bacteria 16631
92 Ga0207652_10006770 3300025921 Bacteria 9240
93 Ga0207646_10052676 3300025922 Bacteria 3642
94 Ga0207694_10051732 3300025924 Bacteria 3183
95 Ga0207691_10190558 3300025940 Bacteria 1788
96 Ga0207639_10001770 3300026041 Bacteria 14534
97 Ga0207702_10073009 3300026078 Bacteria 2958
98 Ga0207702_10259652 3300026078 Bacteria 1635
99 Ga0207675_100342558 3300026118 Bacteria 1463
100 Ga0207698_10218108 3300026142 Bacteria 1722
101 Ga0209974_10007913 3300027876 Bacteria 3645
102 Ga0268266_10002232 3300028379 Bacteria 21160
103 Ga0265318_10005805 3300028577 Bacteria 5756
104 Ga0265323_10001421 3300028653 Bacteria 11776
105 Ga0265323_10009149 3300028653 Bacteria 4062
106 Ga0265323_10017206 3300028653 Bacteria 2811
107 Ga0265323_10022430 3300028653 Bacteria 2412
108 Ga0265338_10000527 3300028800 Bacteria 67253
109 Ga0265338_10002630 3300028800 Bacteria 26482
110 Ga0265338_10028402 3300028800 Bacteria 5579
111 Ga0265320_10019010 3300031240 Bacteria 3767
112 Ga0265340_10009087 3300031247 Bacteria 5343
113 Ga0265331_10011762 3300031250 Bacteria 4778
114 Ga0265327_10021218 3300031251 Bacteria 3925
115 Ga0265327_10026386 3300031251 Bacteria 3365
116 Ga0265316_10018358 3300031344 Bacteria 6013
117 Ga0265316_10089880 3300031344 Bacteria 2343
118 Ga0265316_10196203 3300031344 Bacteria 1498
119 Ga0307408_100067934 3300031548 Bacteria 2623
120 Ga0265313_10037853 3300031595 Bacteria 2407
121 Ga0316579_10001840 3300031691 Bacteria 7845
122 Ga0316579_10008972 3300031691 Bacteria 4193
123 Ga0265342_10088427 3300031712 Bacteria 1779
124 Ga0316576_10006453 3300031727 Bacteria 7304
125 Ga0316578_10000641 3300031728 Bacteria 12380
126 Ga0316578_10134342 3300031728 Bacteria 1489
127 Ga0316578_10248797 3300031728 Bacteria 1067
128 Ga0316577_10019697 3300031733 Bacteria 3737
129 Ga0316577_10043808 3300031733 Bacteria 2503
130 Ga0316577_10143599 3300031733 Bacteria 1344
131 Ga0307406_10207414 3300031901 Bacteria 1447
132 Ga0307409_100006225 3300031995 Bacteria 6987
133 Ga0307416_100096622 3300032002 Bacteria 2555
134 Ga0307414_10370425 3300032004 Bacteria 1235
135 Ga0307414_10461617 3300032004 Bacteria 1116
136 Ga0307415_100051076 3300032126 Bacteria 2804
137 Ga0307415_100687232 3300032126 Bacteria 922
138 Ga0316585_10002417 3300032137 Bacteria 5029
139 Ga0316574_0001420 3300035398 Bacteria 11366
140 Ga0316574_0033746 3300035398 Bacteria 3116
141 Ga0316574_0093366 3300035398 Bacteria 1921
142 Ga0373937_0017561 3300036401 Bacteria 6377
143 Ga0316582_0008645 3300036647 Bacteria 5481
144 Ga0316582_0011835 3300036647 Bacteria 4841
145 Ga0316582_0038319 3300036647 Bacteria 2978
146 Ga0316582_0074151 3300036647 Bacteria 2209
147 Ga0316582_0149978 3300036647 Bacteria 1576
148 Ga0316582_0222715 3300036647 Bacteria 1290
149 Ga0316582_0283921 3300036647 Bacteria 1136
150 Ga0316584_0000209 3300036712 Bacteria 28838
151 Ga0316584_0001093 3300036712 Bacteria 15878
152 Ga0316584_0074255 3300036712 Bacteria 2549
153 Ga0316584_0151854 3300036712 Bacteria 1724
154 Ga0316584_0171315 3300036712 Bacteria 1610
155 Ga0316584_0479621 3300036712 Bacteria 876
156 Ga0395898_0774853 3300037466 Bacteria 900
157 Ga0395905_0109305 3300037471 Bacteria 2596
158 Ga0316581_0000197 3300037588 Bacteria 10005
159 Ga0316581_0006509 3300037588 Bacteria 3097
160 Ga0316581_0019016 3300037588 Bacteria 2000
161 Ga0316581_0025157 3300037588 Bacteria 1770
162 Ga0316581_0074356 3300037588 Bacteria 1044
163 Ga0436364_0394595 3300037853 Bacteria 945
164 Ga0436364_0833067 3300037853 Bacteria 1347
165 Ga0436364_1381128 3300037853 Bacteria 1775
166 Ga0395901_0031330 3300038443 Bacteria 5484
167 Ga0400490_31664 3300038726 Bacteria 8833
168 Ga0400490_54128 3300038726 Bacteria 1321
169 Ga0400483_062573 3300039062 Bacteria 1297
170 Ga0400483_290492 3300039062 Bacteria 2097
171 Ga0400489_02914 3300039093 Bacteria 2500
172 Ga0400489_52982 3300039093 Bacteria 2779
173 Ga0436365_0851869 3300039437 Bacteria 7546
174 Ga0436365_1474958 3300039437 Bacteria 11990
175 Ga0436360_0318524 3300039438 Bacteria 1422
176 Ga0436360_0778671 3300039438 Bacteria 3298
177 Ga0436363_0382153 3300039450 Bacteria 875
178 Ga0436362_0682197 3300039453 Bacteria 849
179 Ga0451798_0144294 3300041458 Bacteria 1191
180 Ga0439444_0016384 3300042437 Bacteria 1261
181 Ga0451577_0000124 3300042876 Bacteria 169120
182 Ga0451577_0000141 3300042876 Bacteria 161372
183 Ga0451577_0006302 3300042876 Bacteria 11878
184 Ga0451577_0020075 3300042876 Bacteria 6137
185 Ga0451577_0021523 3300042876 Bacteria 5900
186 Ga0451577_0025245 3300042876 Bacteria 5394
187 Ga0451577_0027740 3300042876 Bacteria 5125
188 Ga0451577_0028271 3300042876 Bacteria 5072
189 Ga0451577_0035749 3300042876 Bacteria 4474
190 Ga0466972_0010217 3300044658 Bacteria 4714
191 Ga0453683_0000167 3300044673 Bacteria 91120
192 Ga0453683_0015783 3300044673 Bacteria 4884
193 Ga0453683_0019242 3300044673 Bacteria 4374
194 Ga0453683_0105146 3300044673 Bacteria 1773
195 Ga0453683_0144766 3300044673 Bacteria 1500
196 Ga0466965_0001479 3300044683 Bacteria 9496
197 Ga0466964_0012353 3300044706 Bacteria 3231
198 Ga0453684_0000239 3300044712 Bacteria 235992
199 Ga0453684_0000463 3300044712 Bacteria 161665
200 Ga0453684_0003742 3300044712 Bacteria 33649
201 Ga0453684_0004724 3300044712 Bacteria 28171
202 Ga0453684_0022381 3300044712 Bacteria 9380
203 Ga0453684_0025013 3300044712 Bacteria 8689
204 Ga0453684_0034746 3300044712 Bacteria 6986
205 Ga0453684_0041969 3300044712 Bacteria 6174
206 Ga0453684_0085599 3300044712 Bacteria 3915
207 Ga0453684_0140921 3300044712 Bacteria 2879
208 Ga0453684_0156245 3300044712 Bacteria 2704
209 Ga0453684_0189162 3300044712 Bacteria 2409
210 Ga0453684_0211951 3300044712 Bacteria 2251
211 Ga0453684_0255858 3300044712 Bacteria 2008
212 Ga0453684_0478042 3300044712 Bacteria 1382
213 Ga0466968_0000547 3300044735 Bacteria 12751
214 Ga0466960_0009718 3300044901 Bacteria 3976
215 Ga0451576_0000242 3300045051 Bacteria 133680
216 Ga0451576_0017222 3300045051 Bacteria 7948
217 Ga0451576_0033034 3300045051 Bacteria 5501
218 Ga0451576_0338932 3300045051 Bacteria 1574
219 Ga0451576_0524611 3300045051 Bacteria 1244
220 Ga0451576_0858862 3300045051 Bacteria 952
221 Ga0466967_0000130 3300045976 Bacteria 28758
222 Ga0495596_0083542 3300046500 Bacteria 1240
223 Ga0495608_0004787 3300046511 Bacteria 9679
224 Ga0495630_0119949 3300046517 Bacteria 1995
225 Ga0495667_0000069 3300046559 Bacteria 79580
226 Ga0495649_0054077 3300046694 Bacteria 2172
227 Ga0495636_0136969 3300047318 Bacteria 1091
228 Ga0495684_0162632 3300047471 Bacteria 1664
229 Ga0496105_0216819 3300048908 Bacteria 1559
230 Ga0496115_0065885 3300048918 Bacteria 2926
231 Ga0501031_0042188 3300049568 Bacteria 2978
232 Ga0501031_0154450 3300049568 Bacteria 1500
233 Ga0501032_0080631 3300049569 Bacteria 2165
234 Ga0501033_0044469 3300049570 Bacteria 3305
235 Ga0501034_0018796 3300049571 Bacteria 7082
236 Ga0501034_0025246 3300049571 Bacteria 6048
237 Ga0501034_0033168 3300049571 Bacteria 5240
238 Ga0501034_0071225 3300049571 Bacteria 3486
239 Ga0501036_0002838 3300049572 Bacteria 13733
240 Ga0501037_0009977 3300049573 Bacteria 6965
241 Ga0501038_0034073 3300049574 Bacteria 4479
242 Ga0501039_0192448 3300049575 Bacteria 1604
243 Ga0501039_0206224 3300049575 Bacteria 1545
244 Ga0501040_0031497 3300049576 Bacteria 3585
245 Ga0501042_0037330 3300049578 Bacteria 3449
246 Ga0501043_0045776 3300049579 Bacteria 3440
247 Ga0501046_0017819 3300049580 Bacteria 5923
248 Ga0501046_0083855 3300049580 Bacteria 2459
249 Ga0501047_0269368 3300049581 Bacteria 1549
250 Ga0501048_0069213 3300049582 Bacteria 2493
251 Ga0501048_0228705 3300049582 Bacteria 1320
252 Ga0501067_0003411 3300049583 Bacteria 8742
253 Ga0501068_0170327 3300049584 Bacteria 1374
254 Ga0501069_0039024 3300049585 Bacteria 2622
255 Ga0501070_0057253 3300049586 Bacteria 3231
256 Ga0501070_0082751 3300049586 Bacteria 2656
257 Ga0501070_0388243 3300049586 Bacteria 1130
258 Ga0501071_0008624 3300049587 Bacteria 6738
259 Ga0501072_0008660 3300049588 Bacteria 7723
260 Ga0501072_0030852 3300049588 Bacteria 4193
261 Ga0501073_0007002 3300049589 Bacteria 8401
262 Ga0501074_0016528 3300049590 Bacteria 5356
263 Ga0501076_0003608 3300049592 Bacteria 10874
264 Ga0501076_0095761 3300049592 Bacteria 2391
265 Ga0501079_0024714 3300049741 Bacteria 4609
266 Ga0501079_0193973 3300049741 Bacteria 1586
267 Ga0501080_0265539 3300049742 Bacteria 1563
268 Ga0501080_0439760 3300049742 Bacteria 1170
269 Ga0501083_0001372 3300049744 Bacteria 16528
270 Ga0501035_0033205 3300049822 Bacteria 4693
271 Ga0501035_0060917 3300049822 Bacteria 3359
272 Ga0501044_0011754 3300049823 Bacteria 9485
273 Ga0501044_0399772 3300049823 Bacteria 1286
274 Ga0501045_0079988 3300049824 Bacteria 2410
275 nmdc:mga03n38_18249_c1 3300050490 Bacteria 2766
276 nmdc:mga03n38_82182_c1 3300050490 Bacteria 1516
277 nmdc:mga0yw44_177924_c1 3300050492 Bacteria 1399
278 nmdc:mga07m45_171380_c1 3300050496 Bacteria 1261
279 nmdc:mga05p37_272_c1 3300050507 Bacteria 49943
280 nmdc:mga05p37_427030_c1 3300050507 Bacteria 1541
281 nmdc:mga05p37_52811_c2 3300050507 Bacteria 3267
282 nmdc:mga05p37_6818_c2 3300050507 Bacteria 6371
283 nmdc:mga09592_1380_c1 3300050508 Bacteria 19427
284 nmdc:mga09592_3249_c1 3300050508 Bacteria 13149
285 nmdc:mga09592_361744_c1 3300050508 Bacteria 1255
286 nmdc:mga0qj67_19102_c1 3300050509 Bacteria 5233
287 nmdc:mga0qj67_581_c1 3300050509 Bacteria 24951
288 nmdc:mga0qj67_8084_c1 3300050509 Bacteria 7785
289 nmdc:mga06r32_2454_c1 3300050510 Bacteria 16586
290 nmdc:mga06r32_57995_c1 3300050510 Bacteria 3721
291 nmdc:mga06r32_7978_c1 3300050510 Bacteria 9516
292 nmdc:mga08y16_192884_c1 3300050511 Bacteria 2113
293 nmdc:mga08y16_770651_c1 3300050511 Bacteria 957
294 nmdc:mga0n895_597909_c1 3300050512 Bacteria 1106
295 nmdc:mga0rr50_228613_c1 3300050513 Bacteria 1538
296 Ga0501084_0020464 3300054114 Bacteria 5518
297 Ga0501084_0140771 3300054114 Bacteria 2031
298 Ga0587083_0013886 3300059505 Bacteria 1378
299 Ga0587078_004808 3300059646 Bacteria 1422
300 Ga0587079_006231 3300059647 Bacteria 1729
301 Ga0587071_014295 3300060344 Bacteria 1378
302 Ga0501082_0457257 3300060353 Bacteria 1115
303 Ga0530510_0000662 3300061734 Bacteria 22265
304 2578336286 2576861424 Bacteria 5270569
305 2687234976 2684623219 Bacteria 8442773
306 2837186750 2837183177 Bacteria 4637169
307 2881639250 2881636855 Bacteria 5205297
308 2971515343 2971511577 Bacteria 5404012
309 2980181439 2980176882 Bacteria 5397533
310 8057734161 8057733483 Bacteria 6578323
311 Ga0501034_0000366
312 rootH1_10104324
313 Ga0055538_1001112
314 Ga0055535_1004526
315 Ga0055541_1000552
316 Ga0065704_10000266
317 Ga0065707_10000525
318 Ga0070680_100063396
319 Ga0070680_100270525
320 Ga0070682_100055478
321 Ga0070659_100117070
322 Ga0070710_10195861
323 Ga0070711_100010189
324 Ga0070705_100013746
325 Ga0070708_100004052
326 Ga0070708_100228233
327 Ga0070681_10215235
328 Ga0070706_100040901
329 Ga0070706_100311395
330 Ga0070707_100045023
331 Ga0070699_100105045
332 Ga0068853_100000622
333 Ga0070695_100484236
334 Ga0070696_100007994
335 Ga0070665_100000930
336 Ga0070704_100002476
337 Ga0068855_100138253
338 Ga0070664_100175065
339 Ga0068857_100013355
340 Ga0068861_100430172
341 Ga0068870_10051430
342 Ga0068860_100066117
343 Ga0081455_10004554
344 Ga0081455_10021329
345 Ga0081455_10041639
346 Ga0081538_10000459
347 Ga0081538_10005848
348 Ga0075364_10052666
349 Ga0075364_10077954
350 Ga0075367_10033952
351 Ga0075430_100000532
352 Ga0075430_100003977
353 Ga0075430_100059639
354 Ga0075430_100061902
355 Ga0075430_100256982
356 Ga0075431_100002775
357 Ga0075431_100003261
358 Ga0075434_100416373
359 Ga0075429_100000058
360 Ga0075429_100000980
361 Ga0068865_100029138
362 Ga0075436_100104143
363 Ga0075436_100141027
364 Ga0075435_100028271
365 Ga0075435_100249200
366 Ga0105240_10027900
367 Ga0111539_10001393
368 Ga0111539_10044356
369 Ga0111539_10141195
370 Ga0111539_10179234
371 Ga0105245_10390050
372 Ga0114129_10001738
373 Ga0114129_10055754
374 Ga0114129_10061206
375 Ga0105237_10000062
376 Ga0157369_10001432
377 Ga0157369_10121315
378 Ga0157372_10152262
379 Ga0157380_10000033
380 Ga0213876_10079730
381 Ga0224712_10145183
382 Ga0209784_100134
383 Ga0209566_100613
384 Ga0209147_100113
385 Ga0209258_102096
386 Ga0209675_1016801
387 Ga0209025_1024080
388 Ga0209025_1027120
389 Ga0207692_10203573
390 Ga0207643_10019275
391 Ga0207705_10018466
392 Ga0207684_10047919
393 Ga0207684_10259640
394 Ga0207695_10021630
395 Ga0207671_10000140
396 Ga0207663_10140727
397 Ga0207663_10228764
398 Ga0207663_10271622
399 Ga0207660_10006927
400 Ga0207660_10265433
401 Ga0207652_10002200
402 Ga0207652_10006770
403 Ga0207646_10052676
404 Ga0207694_10051732
405 Ga0207691_10190558
406 Ga0207639_10001770
407 Ga0207702_10073009
408 Ga0207702_10259652
409 Ga0207675_100342558
410 Ga0207698_10218108
411 Ga0209974_10007913
412 Ga0268266_10002232
413 Ga0265318_10005805
414 Ga0265323_10001421
415 Ga0265323_10009149
416 Ga0265323_10017206
417 Ga0265323_10022430
418 Ga0265338_10000527
419 Ga0265338_10002630
420 Ga0265338_10028402
421 Ga0265320_10019010
422 Ga0265340_10009087
423 Ga0265331_10011762
424 Ga0265327_10021218
425 Ga0265327_10026386
426 Ga0265316_10018358
427 Ga0265316_10089880
428 Ga0265316_10196203
429 Ga0307408_100067934
430 Ga0265313_10037853
431 Ga0316579_10001840
432 Ga0316579_10008972
433 Ga0265342_10088427
434 Ga0316576_10006453
435 Ga0316578_10000641
436 Ga0316578_10134342
437 Ga0316578_10248797
438 Ga0316577_10019697
439 Ga0316577_10043808
440 Ga0316577_10143599
441 Ga0307406_10207414
442 Ga0307409_100006225
443 Ga0307416_100096622
444 Ga0307414_10370425
445 Ga0307414_10461617
446 Ga0307415_100051076
447 Ga0307415_100687232
448 Ga0316585_10002417
449 Ga0316574_0001420
450 Ga0316574_0033746
451 Ga0316574_0093366
452 Ga0373937_0017561
453 Ga0316582_0008645
454 Ga0316582_0011835
455 Ga0316582_0038319
456 Ga0316582_0074151
457 Ga0316582_0149978
458 Ga0316582_0222715
459 Ga0316582_0283921
460 Ga0316584_0000209
461 Ga0316584_0001093
462 Ga0316584_0074255
463 Ga0316584_0151854
464 Ga0316584_0171315
465 Ga0316584_0479621
466 Ga0395898_0774853
467 Ga0395905_0109305
468 Ga0316581_0000197
469 Ga0316581_0006509
470 Ga0316581_0019016
471 Ga0316581_0025157
472 Ga0316581_0074356
473 Ga0436364_0394595
474 Ga0436364_0833067
475 Ga0436364_1381128
476 Ga0395901_0031330
477 Ga0400490_31664
478 Ga0400490_54128
479 Ga0400483_062573
480 Ga0400483_290492
481 Ga0400489_02914
482 Ga0400489_52982
483 Ga0436365_0851869
484 Ga0436365_1474958
485 Ga0436360_0318524
486 Ga0436360_0778671
487 Ga0436363_0382153
488 Ga0436362_0682197
489 Ga0451798_0144294
490 Ga0439444_0016384
491 Ga0451577_0000124
492 Ga0451577_0000141
493 Ga0451577_0006302
494 Ga0451577_0020075
495 Ga0451577_0021523
496 Ga0451577_0025245
497 Ga0451577_0027740
498 Ga0451577_0028271
499 Ga0451577_0035749
500 Ga0466972_0010217
501 Ga0453683_0000167
502 Ga0453683_0015783
503 Ga0453683_0019242
504 Ga0453683_0105146
505 Ga0453683_0144766
506 Ga0466965_0001479
507 Ga0466964_0012353
508 Ga0453684_0000239
509 Ga0453684_0000463
510 Ga0453684_0003742
511 Ga0453684_0004724
512 Ga0453684_0022381
513 Ga0453684_0025013
514 Ga0453684_0034746
515 Ga0453684_0041969
516 Ga0453684_0085599
517 Ga0453684_0140921
518 Ga0453684_0156245
519 Ga0453684_0189162
520 Ga0453684_0211951
521 Ga0453684_0255858
522 Ga0453684_0478042
523 Ga0466968_0000547
524 Ga0466960_0009718
525 Ga0451576_0000242
526 Ga0451576_0017222
527 Ga0451576_0033034
528 Ga0451576_0338932
529 Ga0451576_0524611
530 Ga0451576_0858862
531 Ga0466967_0000130
532 Ga0495596_0083542
533 Ga0495608_0004787
534 Ga0495630_0119949
535 Ga0495667_0000069
536 Ga0495649_0054077
537 Ga0495636_0136969
538 Ga0495684_0162632
539 Ga0496105_0216819
540 Ga0496115_0065885
541 Ga0501031_0042188
542 Ga0501031_0154450
543 Ga0501032_0080631
544 Ga0501033_0044469
545 Ga0501034_0018796
546 Ga0501034_0025246
547 Ga0501034_0033168
548 Ga0501034_0071225
549 Ga0501036_0002838
550 Ga0501037_0009977
551 Ga0501038_0034073
552 Ga0501039_0192448
553 Ga0501039_0206224
554 Ga0501040_0031497
555 Ga0501042_0037330
556 Ga0501043_0045776
557 Ga0501046_0017819
558 Ga0501046_0083855
559 Ga0501047_0269368
560 Ga0501048_0069213
561 Ga0501048_0228705
562 Ga0501067_0003411
563 Ga0501068_0170327
564 Ga0501069_0039024
565 Ga0501070_0057253
566 Ga0501070_0082751
567 Ga0501070_0388243
568 Ga0501071_0008624
569 Ga0501072_0008660
570 Ga0501072_0030852
571 Ga0501073_0007002
572 Ga0501074_0016528
573 Ga0501076_0003608
574 Ga0501076_0095761
575 Ga0501079_0024714
576 Ga0501079_0193973
577 Ga0501080_0265539
578 Ga0501080_0439760
579 Ga0501083_0001372
580 Ga0501035_0033205
581 Ga0501035_0060917
582 Ga0501044_0011754
583 Ga0501044_0399772
584 Ga0501045_0079988
585 nmdc:mga03n38_18249_c1
586 nmdc:mga03n38_82182_c1
587 nmdc:mga0yw44_177924_c1
588 nmdc:mga07m45_171380_c1
589 nmdc:mga05p37_272_c1
590 nmdc:mga05p37_427030_c1
591 nmdc:mga05p37_52811_c2
592 nmdc:mga05p37_6818_c2
593 nmdc:mga09592_1380_c1
594 nmdc:mga09592_3249_c1
595 nmdc:mga09592_361744_c1
596 nmdc:mga0qj67_19102_c1
597 nmdc:mga0qj67_581_c1
598 nmdc:mga0qj67_8084_c1
599 nmdc:mga06r32_2454_c1
600 nmdc:mga06r32_57995_c1
601 nmdc:mga06r32_7978_c1
602 nmdc:mga08y16_192884_c1
603 nmdc:mga08y16_770651_c1
604 nmdc:mga0n895_597909_c1
605 nmdc:mga0rr50_228613_c1
606 Ga0501084_0020464
607 Ga0501084_0140771
608 Ga0587083_0013886
609 Ga0587078_004808
610 Ga0587079_006231
611 Ga0587071_014295
612 Ga0501082_0457257
613 Ga0530510_0000662
614 2578336286
615 2687234976
616 2837186750
617 2881639250
618 2971515343
619 2980181439
620 8057734161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

227

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9231 7 249
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9215 5 236
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9185 5 236
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9153 4 231
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9116 4 251
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9878 9 248 3.40.50.300
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9757 9 248 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9747 9 251 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 7 251 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9261 7 247 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2I6QJ79-F1-model_v4 Phosphate transport ATP-binding protein PstB 0.9883 5 253 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A1F7BME5-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9878 1 253 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A7U9C389-F1-model_v4 Phosphate import ATP-binding protein pstB 2 0.9866 5 253 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435
AF-Q5QVB0-F1-model_v4 Phosphate import ATP-binding protein PstB (EC 7.3.2.1) (ABC phosphate transporter) (Phosphate-transporting ATPase) 0.9864 5 253 GO:0005524
GO:0005886
GO:0015415
GO:0016887
GO:0035435
AF-A0A374DCB4-F1-model_v4 deleted 0.986 3 253

Map