F400691

General Info

Members Datasets Scaffolds Average Seq Length
310 222 620 331

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10164487|Ga0105240_101644871
Length 376
Sequence MSPSSAGARRQVPNLALATADRPGSLRMCRRRFPAHRESEGGIAMTQMNRRILLASRPQGPLSPENFKLEQAPLAALAEGQFRVRNLYLSIDPYMRGRMNDAKSYAEPLAIGDVMVGGTVGEVVESKHRAFAVGDKVTGMFGWQDYGSSDGTGVRKIDDSRVPLSAYLGVAGMPGVTAWYGLNKIIAPRAAETVVVSAASGAVGSVVGQLAKLAGCRAVGIAGGPDKCRYVVEELGFDACVDYKAGNLFNDLKAATPNGVDGCFENVGGEGLDATLARMNPFGRIAVCGMIAGYDGQPVPLKQPSIILTMRLLVQGFIVTEHLDLWPEALGTLTTLVSQKKLRYRESIVDGLEHAPDALIGLLQGKNFGKQIVKIA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
114 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
205 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
206 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
210 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
211 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
212 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
213 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
214 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
215 2851153111 Caulobacter radicis 736 Isolate Unclassified
216 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
217 2867369537 Streptomyces sp. Z26 Isolate Unclassified
218 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
219 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
220 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
221 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
222 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 0.97
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0.97
Rhizoplane 0.32
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10164487 3300009093 Bacteria 2632
2 JGI24741J21665_1001326 3300001915 Bacteria 7231
3 JGI25151J46595_10009271 3300003187 Bacteria 4674
4 JGI25405J52794_10000311 3300003911 Bacteria 6697
5 Ga0065714_10066864 3300005288 Bacteria 6186
6 Ga0070658_10017019 3300005327 Bacteria 5818
7 Ga0070658_10179789 3300005327 Bacteria 1780
8 Ga0070660_100000107 3300005339 Bacteria 51864
9 Ga0070691_10010480 3300005341 Bacteria 4230
10 Ga0070714_100000163 3300005435 Bacteria 53786
11 Ga0070713_100015782 3300005436 Bacteria 5660
12 Ga0070708_100002033 3300005445 Bacteria 15574
13 Ga0070708_100022676 3300005445 Bacteria 5328
14 Ga0070706_100099450 3300005467 Bacteria 2703
15 Ga0070707_100055658 3300005468 Bacteria 3792
16 Ga0070707_100120624 3300005468 Bacteria 2546
17 Ga0070698_100130374 3300005471 Bacteria 2470
18 Ga0070699_100246768 3300005518 Bacteria 1595
19 Ga0070684_100431854 3300005535 Bacteria 1216
20 Ga0068855_100020574 3300005563 Bacteria 7913
21 Ga0068855_100020815 3300005563 Bacteria 7865
22 Ga0081455_10000880 3300005937 Bacteria 38878
23 Ga0081455_10113414 3300005937 Bacteria 2150
24 Ga0081538_10005608 3300005981 Bacteria 11260
25 Ga0081538_10028301 3300005981 Bacteria 3858
26 Ga0070717_10020391 3300006028 Bacteria 5213
27 Ga0070717_10084175 3300006028 Bacteria 2675
28 Ga0075365_10025466 3300006038 Bacteria 3746
29 Ga0075431_100345196 3300006847 Bacteria 1497
30 Ga0099826_10000004 3300006948 Bacteria 802669
31 Ga0111539_10465413 3300009094 Bacteria 1472
32 Ga0114129_10023249 3300009147 Bacteria 8793
33 Ga0114129_10166443 3300009147 Bacteria 3008
34 Ga0114129_10330756 3300009147 Bacteria 2023
35 Ga0105237_10011019 3300009545 Bacteria 9593
36 Ga0105237_10239744 3300009545 Bacteria 1814
37 Ga0105238_10114252 3300009551 Bacteria 2679
38 Ga0105238_10184713 3300009551 Bacteria 2061
39 Ga0105249_10114234 3300009553 Bacteria 2556
40 Ga0105239_10023696 3300010375 Bacteria 6758
41 Ga0157373_10011151 3300013100 Bacteria 6614
42 Ga0157371_10058131 3300013102 Bacteria 2743
43 Ga0157370_10000590 3300013104 Bacteria 45367
44 Ga0157370_10000913 3300013104 Bacteria 37440
45 Ga0157369_10000061 3300013105 Bacteria 151283
46 Ga0157369_10000886 3300013105 Bacteria 38170
47 Ga0157374_10000033 3300013296 Bacteria 185818
48 Ga0163162_10218099 3300013306 Bacteria 2038
49 Ga0157372_10000977 3300013307 Bacteria 31182
50 Ga0163163_10000130 3300014325 Bacteria 77745
51 Ga0163163_10433279 3300014325 Bacteria 1374
52 Ga0163163_10528132 3300014325 Bacteria 1242
53 Ga0157376_10361499 3300014969 Unclassified 1392
54 Ga0182006_1060476 3300015261 Bacteria 1431
55 Ga0163161_10114741 3300017792 Bacteria 2018
56 Ga0206353_11021888 3300020082 Bacteria 2942
57 Ga0213873_10035160 3300021358 Bacteria 1266
58 Ga0213872_10000008 3300021361 Bacteria 226283
59 Ga0213876_10029492 3300021384 Bacteria 2891
60 Ga0213875_10067620 3300021388 Bacteria 1669
61 Ga0224712_10001401 3300022467 Bacteria 5535
62 Ga0209672_100333 3300025228 Bacteria 30540
63 Ga0209759_1003791 3300025256 Bacteria 5888
64 Ga0209256_1027508 3300025299 Bacteria 1620
65 Ga0207426_1036141 3300025302 Bacteria 1572
66 Ga0207642_10025371 3300025899 Bacteria 2397
67 Ga0207647_10001079 3300025904 Bacteria 21029
68 Ga0207705_10004091 3300025909 Bacteria 11064
69 Ga0207684_10017269 3300025910 Bacteria 6190
70 Ga0207695_10007704 3300025913 Bacteria 13636
71 Ga0207657_10000380 3300025919 Bacteria 46947
72 Ga0207646_10045979 3300025922 Bacteria 3917
73 Ga0207646_10095700 3300025922 Bacteria 2660
74 Ga0207694_10241659 3300025924 Bacteria 1476
75 Ga0207700_10386767 3300025928 Bacteria 1224
76 Ga0207664_10001799 3300025929 Bacteria 14133
77 Ga0207704_10216449 3300025938 Bacteria 1414
78 Ga0207665_10033029 3300025939 Bacteria 3428
79 Ga0207667_10001946 3300025949 Bacteria 25888
80 Ga0207667_10018175 3300025949 Bacteria 7892
81 Ga0207640_10175202 3300025981 Bacteria 1602
82 Ga0207703_10083714 3300026035 Unclassified 2666
83 Ga0207675_100342139 3300026118 Bacteria 1464
84 Ga0209282_1000035 3300027666 Bacteria 137066
85 Ga0265337_1003455 3300028556 Bacteria 6846
86 Ga0265319_1004385 3300028563 Bacteria 6995
87 Ga0265323_10001525 3300028653 Bacteria 11255
88 Ga0265322_10002513 3300028654 Bacteria 5650
89 Ga0265336_10000178 3300028666 Bacteria 44620
90 Ga0265324_10000008 3300029957 Bacteria 259947
91 Ga0265324_10027743 3300029957 Bacteria 1999
92 Ga0307511_10000145 3300030521 Bacteria 66808
93 Ga0265332_10016846 3300031238 Bacteria 3223
94 Ga0265320_10000366 3300031240 Bacteria 36506
95 Ga0265320_10004236 3300031240 Bacteria 9431
96 Ga0265325_10000765 3300031241 Bacteria 23274
97 Ga0265340_10000292 3300031247 Bacteria 26277
98 Ga0265339_10083293 3300031249 Bacteria 1687
99 Ga0265327_10042188 3300031251 Unclassified 2452
100 Ga0265316_10021588 3300031344 Bacteria 5448
101 Ga0265316_10023079 3300031344 Bacteria 5231
102 Ga0265316_10060174 3300031344 Bacteria 2952
103 Ga0265316_10085110 3300031344 Bacteria 2420
104 Ga0265316_10163691 3300031344 Bacteria 1662
105 Ga0265316_10180637 3300031344 Bacteria 1571
106 Ga0307509_10168251 3300031507 Bacteria 2076
107 Ga0307508_10052722 3300031616 Bacteria 3611
108 Ga0307508_10271679 3300031616 Bacteria 1289
109 Ga0265314_10000304 3300031711 Bacteria 70430
110 Ga0265314_10030790 3300031711 Bacteria 3969
111 Ga0265314_10053282 3300031711 Bacteria 2807
112 Ga0265314_10097499 3300031711 Bacteria 1899
113 Ga0265342_10048934 3300031712 Bacteria 2532
114 Ga0265342_10153243 3300031712 Bacteria 1278
115 Ga0316576_10001372 3300031727 Bacteria 13007
116 Ga0307406_10258319 3300031901 Bacteria 1316
117 Ga0316593_10075480 3300032168 Bacteria 1170
118 Ga0307507_10189526 3300033179 Bacteria 1449
119 Ga0373934_0022079 3300035086 Bacteria 2453
120 Ga0373949_0001208 3300035090 Bacteria 7654
121 Ga0373923_0115154 3300035111 Bacteria 1197
122 Ga0373954_0004847 3300035118 Bacteria 5803
123 Ga0373954_0043371 3300035118 Bacteria 2098
124 Ga0373943_0064505 3300035170 Unclassified 1839
125 Ga0373955_0010133 3300035172 Bacteria 4441
126 Ga0373924_0034872 3300035410 Bacteria 2039
127 Ga0373935_0040810 3300035692 Bacteria 2913
128 Ga0373927_0005315 3300035695 Bacteria 8899
129 Ga0373927_0141344 3300035695 Unclassified 1575
130 Ga0373937_0013516 3300036401 Bacteria 7192
131 Ga0373937_0081776 3300036401 Bacteria 2988
132 Ga0373937_0258753 3300036401 Bacteria 1641
133 Ga0373937_0456436 3300036401 Bacteria 1214
134 Ga0316582_0097456 3300036647 Bacteria 1943
135 Ga0373925_0415446 3300037068 Unclassified 1099
136 Ga0395899_0009762 3300037312 Bacteria 7365
137 Ga0395899_0069712 3300037312 Bacteria 2574
138 Ga0395900_0000026 3300037418 Bacteria 313470
139 Ga0395900_0000628 3300037418 Bacteria 47493
140 Ga0395900_0082081 3300037418 Bacteria 3312
141 Ga0395900_0107854 3300037418 Bacteria 2861
142 Ga0395900_0120634 3300037418 Bacteria 2690
143 Ga0395898_0000085 3300037466 Bacteria 240992
144 Ga0395898_0000344 3300037466 Bacteria 104925
145 Ga0395898_0047281 3300037466 Bacteria 4224
146 Ga0395898_0048780 3300037466 Bacteria 4150
147 Ga0395898_0062301 3300037466 Bacteria 3622
148 Ga0395898_0599755 3300037466 Bacteria 1044
149 Ga0436364_0874538 3300037853 Bacteria 4034
150 Ga0395901_0000039 3300038443 Bacteria 206143
151 Ga0395901_0000090 3300038443 Bacteria 123748
152 Ga0395901_0000831 3300038443 Bacteria 34027
153 Ga0395901_0050403 3300038443 Bacteria 4325
154 Ga0395901_0140466 3300038443 Bacteria 2539
155 Ga0395901_0279236 3300038443 Bacteria 1736
156 Ga0400489_35688 3300039093 Bacteria 1617
157 Ga0436361_0252128 3300039447 Bacteria 1567
158 Ga0436361_0900991 3300039447 Bacteria 50083
159 Ga0436362_0865730 3300039453 Bacteria 1671
160 Ga0439448_0000029 3300042005 Bacteria 23623
161 Ga0451577_0008684 3300042876 Bacteria 9862
162 Ga0451577_0042712 3300042876 Bacteria 4064
163 Ga0451577_0150548 3300042876 Bacteria 2093
164 Ga0451577_0395781 3300042876 Bacteria 1254
165 Ga0466969_0000240 3300044656 Bacteria 29998
166 Ga0466973_0005575 3300044659 Bacteria 10897
167 Ga0466977_0000020 3300044666 Bacteria 24620
168 Ga0453683_0060033 3300044673 Bacteria 2378
169 Ga0466965_0011510 3300044683 Bacteria 4149
170 Ga0466966_0000046 3300044684 Bacteria 92241
171 Ga0466966_0007183 3300044684 Bacteria 7379
172 Ga0466966_0096642 3300044684 Bacteria 1829
173 Ga0466961_0000098 3300044693 Bacteria 56393
174 Ga0466961_0025333 3300044693 Bacteria 3815
175 Ga0466961_0145077 3300044693 Bacteria 1484
176 Ga0466963_0002263 3300044694 Bacteria 10695
177 Ga0466963_0015756 3300044694 Bacteria 4690
178 Ga0466963_0034958 3300044694 Bacteria 3272
179 Ga0453684_0020818 3300044712 Bacteria 9855
180 Ga0453684_0228413 3300044712 Bacteria 2150
181 Ga0466971_0005866 3300044719 Bacteria 5345
182 Ga0466971_0031561 3300044719 Bacteria 2372
183 Ga0466971_0035730 3300044719 Bacteria 2229
184 Ga0466971_0112300 3300044719 Bacteria 1258
185 Ga0466957_0001125 3300044842 Bacteria 13847
186 Ga0466957_0009964 3300044842 Bacteria 5437
187 Ga0466957_0010316 3300044842 Bacteria 5357
188 Ga0466960_0006117 3300044901 Bacteria 4815
189 Ga0466959_0029398 3300045049 Bacteria 4071
190 Ga0466959_0105734 3300045049 Bacteria 2012
191 Ga0451576_0001259 3300045051 Bacteria 44476
192 Ga0451576_0099122 3300045051 Bacteria 3031
193 Ga0466958_0002689 3300045836 Bacteria 9012
194 Ga0466958_0009235 3300045836 Bacteria 5488
195 Ga0466958_0017619 3300045836 Bacteria 4132
196 Ga0466958_0054195 3300045836 Bacteria 2432
197 Ga0495592_0138968 3300046454 Bacteria 1691
198 Ga0495603_0027535 3300046455 Bacteria 3430
199 Ga0495629_0050010 3300046459 Bacteria 2929
200 Ga0495629_0063396 3300046459 Bacteria 2581
201 Ga0495651_0018324 3300046462 Bacteria 5421
202 Ga0495653_0030803 3300046463 Bacteria 4269
203 Ga0495580_0000423 3300046472 Bacteria 35086
204 Ga0495580_0000858 3300046472 Bacteria 26259
205 Ga0495605_0000788 3300046474 Bacteria 22750
206 Ga0495594_0017001 3300046499 Bacteria 3839
207 Ga0495596_0000470 3300046500 Bacteria 25556
208 Ga0495596_0005206 3300046500 Bacteria 6185
209 Ga0495607_0106029 3300046501 Bacteria 1497
210 Ga0495610_0042478 3300046512 Bacteria 2273
211 Ga0495616_0009604 3300046513 Bacteria 5646
212 Ga0495618_0135500 3300046514 Bacteria 1575
213 Ga0495620_0000079 3300046515 Bacteria 80460
214 Ga0495637_0003365 3300046520 Bacteria 8504
215 Ga0495666_0000943 3300046526 Bacteria 13672
216 Ga0495652_0037708 3300046529 Bacteria 4191
217 Ga0495665_0002643 3300046531 Bacteria 9665
218 Ga0495640_0025211 3300046533 Bacteria 4316
219 Ga0495640_0061810 3300046533 Bacteria 2543
220 Ga0495586_0011015 3300046535 Bacteria 4804
221 Ga0495609_0014307 3300046538 Bacteria 3733
222 Ga0495597_0006212 3300046542 Bacteria 6198
223 Ga0495667_0080076 3300046559 Bacteria 2123
224 Ga0495634_0010122 3300046642 Bacteria 6919
225 Ga0495635_0018550 3300046663 Bacteria 4854
226 Ga0495635_0148677 3300046663 Bacteria 1595
227 Ga0495661_0003938 3300046665 Bacteria 10848
228 Ga0495613_0143930 3300046689 Bacteria 1702
229 Ga0495624_0023246 3300046690 Bacteria 4089
230 Ga0495624_0173973 3300046690 Bacteria 1313
231 Ga0495670_0004239 3300046691 Bacteria 7029
232 Ga0495671_0000408 3300046692 Bacteria 34520
233 Ga0495671_0000532 3300046692 Bacteria 28752
234 Ga0495649_0042001 3300046694 Bacteria 2499
235 Ga0495600_0073210 3300046809 Bacteria 2237
236 Ga0495581_0094331 3300047315 Bacteria 1737
237 Ga0495604_0003862 3300047317 Bacteria 11936
238 Ga0495604_0015686 3300047317 Bacteria 6046
239 Ga0495604_0021561 3300047317 Bacteria 5143
240 Ga0495674_0118190 3300047319 Bacteria 2242
241 Ga0495672_0059233 3300047320 Bacteria 2216
242 Ga0495676_0000208 3300047321 Bacteria 46581
243 Ga0495680_0006926 3300047322 Bacteria 10461
244 Ga0495680_0094151 3300047322 Bacteria 2242
245 Ga0495675_0014789 3300047444 Bacteria 4934
246 Ga0495673_0000205 3300047469 Bacteria 89721
247 Ga0495673_0000233 3300047469 Bacteria 81103
248 Ga0495673_0087540 3300047469 Bacteria 1278
249 Ga0495684_0117505 3300047471 Bacteria 2004
250 Ga0495686_0047593 3300047472 Bacteria 2707
251 Ga0495593_0007457 3300047673 Bacteria 6399
252 Ga0495614_0002972 3300048089 Bacteria 7552
253 Ga0496106_0000014 3300048909 Bacteria 194239
254 Ga0496116_0096191 3300048919 Bacteria 1785
255 Ga0496117_0134391 3300048920 Bacteria 1493
256 Ga0496118_0073338 3300048921 Bacteria 2453
257 Ga0496121_0018589 3300048924 Bacteria 6999
258 Ga0496121_0074330 3300048924 Bacteria 2719
259 Ga0496122_0010587 3300048925 Bacteria 9472
260 Ga0496123_0006912 3300048926 Bacteria 10854
261 Ga0496124_0104680 3300048927 Bacteria 2288
262 Ga0496125_0112284 3300048928 Bacteria 1969
263 Ga0501032_0037593 3300049569 Bacteria 3300
264 Ga0501034_0000069 3300049571 Bacteria 181133
265 Ga0501034_0044518 3300049571 Bacteria 4488
266 Ga0501036_0002490 3300049572 Bacteria 14443
267 Ga0501039_0024463 3300049575 Bacteria 4639
268 Ga0501042_0003022 3300049578 Bacteria 10461
269 Ga0501043_0112567 3300049579 Bacteria 2137
270 Ga0501047_0084754 3300049581 Bacteria 3045
271 Ga0501048_0005060 3300049582 Bacteria 10047
272 Ga0501073_0102973 3300049589 Bacteria 1982
273 Ga0501074_0023301 3300049590 Bacteria 4502
274 Ga0501076_0134696 3300049592 Bacteria 2005
275 Ga0501044_0356841 3300049823 Bacteria 1380
276 nmdc:mga0yw44_49046_c1 3300050492 Bacteria 2547
277 nmdc:mga0k408_145308_c1 3300050493 Bacteria 1412
278 nmdc:mga05p37_36602_c1 3300050507 Bacteria 6019
279 nmdc:mga05p37_666223_c1 3300050507 Bacteria 1162
280 nmdc:mga09592_186809_c1 3300050508 Bacteria 1793
281 nmdc:mga08y16_9689_c1 3300050511 Bacteria 10112
282 Ga0500651_0049041 3300053093 Bacteria 2652
283 Ga0500641_0003851 3300053096 Bacteria 5304
284 Ga0500655_000084 3300053133 Bacteria 24813
285 Ga0500559_0004196 3300053136 Bacteria 6909
286 Ga0500590_000885 3300053148 Bacteria 11340
287 Ga0500616_0000090 3300053153 Bacteria 187734
288 Ga0500622_0001574 3300053156 Bacteria 17956
289 Ga0500567_000358 3300053723 Bacteria 14925
290 Ga0500570_000131 3300053724 Bacteria 22227
291 Ga0500625_000038 3300053729 Bacteria 43903
292 Ga0466962_0000995 3300061719 Bacteria 12943
293 Ga0466962_0007520 3300061719 Bacteria 5226
294 Ga0466962_0062019 3300061719 Bacteria 1784
295 Ga0530510_0142483 3300061734 Bacteria 1767
296 2514043424 2513237165 Bacteria 6771773
297 2588109324 2585428157 Bacteria 3018951
298 2600809641 2600255067 Bacteria 6795583
299 2795784741 2795385470 Bacteria 8317180
300 2817618692 2816332336 Bacteria 5207640
301 2844851948 2844849076 Bacteria 4091819
302 2851155430 2851153111 Bacteria 5542585
303 2858696749 2858688981 Bacteria 8184122
304 2867370900 2867369537 Bacteria 6501581
305 2939631855 2939631187 Bacteria 6118131
306 2939634915 2939631187 Bacteria 6118131
307 2990093711 2990088156 Bacteria 6657676
308 2997602178 2997600082 Bacteria 9896405
309 8048135890 8048127548 Bacteria 11053136
310 8057569840 8057568493 Bacteria 7221719
311 Ga0105240_10164487
312 JGI24741J21665_1001326
313 JGI25151J46595_10009271
314 JGI25405J52794_10000311
315 Ga0065714_10066864
316 Ga0070658_10017019
317 Ga0070658_10179789
318 Ga0070660_100000107
319 Ga0070691_10010480
320 Ga0070714_100000163
321 Ga0070713_100015782
322 Ga0070708_100002033
323 Ga0070708_100022676
324 Ga0070706_100099450
325 Ga0070707_100055658
326 Ga0070707_100120624
327 Ga0070698_100130374
328 Ga0070699_100246768
329 Ga0070684_100431854
330 Ga0068855_100020574
331 Ga0068855_100020815
332 Ga0081455_10000880
333 Ga0081455_10113414
334 Ga0081538_10005608
335 Ga0081538_10028301
336 Ga0070717_10020391
337 Ga0070717_10084175
338 Ga0075365_10025466
339 Ga0075431_100345196
340 Ga0099826_10000004
341 Ga0111539_10465413
342 Ga0114129_10023249
343 Ga0114129_10166443
344 Ga0114129_10330756
345 Ga0105237_10011019
346 Ga0105237_10239744
347 Ga0105238_10114252
348 Ga0105238_10184713
349 Ga0105249_10114234
350 Ga0105239_10023696
351 Ga0157373_10011151
352 Ga0157371_10058131
353 Ga0157370_10000590
354 Ga0157370_10000913
355 Ga0157369_10000061
356 Ga0157369_10000886
357 Ga0157374_10000033
358 Ga0163162_10218099
359 Ga0157372_10000977
360 Ga0163163_10000130
361 Ga0163163_10433279
362 Ga0163163_10528132
363 Ga0157376_10361499
364 Ga0182006_1060476
365 Ga0163161_10114741
366 Ga0206353_11021888
367 Ga0213873_10035160
368 Ga0213872_10000008
369 Ga0213876_10029492
370 Ga0213875_10067620
371 Ga0224712_10001401
372 Ga0209672_100333
373 Ga0209759_1003791
374 Ga0209256_1027508
375 Ga0207426_1036141
376 Ga0207642_10025371
377 Ga0207647_10001079
378 Ga0207705_10004091
379 Ga0207684_10017269
380 Ga0207695_10007704
381 Ga0207657_10000380
382 Ga0207646_10045979
383 Ga0207646_10095700
384 Ga0207694_10241659
385 Ga0207700_10386767
386 Ga0207664_10001799
387 Ga0207704_10216449
388 Ga0207665_10033029
389 Ga0207667_10001946
390 Ga0207667_10018175
391 Ga0207640_10175202
392 Ga0207703_10083714
393 Ga0207675_100342139
394 Ga0209282_1000035
395 Ga0265337_1003455
396 Ga0265319_1004385
397 Ga0265323_10001525
398 Ga0265322_10002513
399 Ga0265336_10000178
400 Ga0265324_10000008
401 Ga0265324_10027743
402 Ga0307511_10000145
403 Ga0265332_10016846
404 Ga0265320_10000366
405 Ga0265320_10004236
406 Ga0265325_10000765
407 Ga0265340_10000292
408 Ga0265339_10083293
409 Ga0265327_10042188
410 Ga0265316_10021588
411 Ga0265316_10023079
412 Ga0265316_10060174
413 Ga0265316_10085110
414 Ga0265316_10163691
415 Ga0265316_10180637
416 Ga0307509_10168251
417 Ga0307508_10052722
418 Ga0307508_10271679
419 Ga0265314_10000304
420 Ga0265314_10030790
421 Ga0265314_10053282
422 Ga0265314_10097499
423 Ga0265342_10048934
424 Ga0265342_10153243
425 Ga0316576_10001372
426 Ga0307406_10258319
427 Ga0316593_10075480
428 Ga0307507_10189526
429 Ga0373934_0022079
430 Ga0373949_0001208
431 Ga0373923_0115154
432 Ga0373954_0004847
433 Ga0373954_0043371
434 Ga0373943_0064505
435 Ga0373955_0010133
436 Ga0373924_0034872
437 Ga0373935_0040810
438 Ga0373927_0005315
439 Ga0373927_0141344
440 Ga0373937_0013516
441 Ga0373937_0081776
442 Ga0373937_0258753
443 Ga0373937_0456436
444 Ga0316582_0097456
445 Ga0373925_0415446
446 Ga0395899_0009762
447 Ga0395899_0069712
448 Ga0395900_0000026
449 Ga0395900_0000628
450 Ga0395900_0082081
451 Ga0395900_0107854
452 Ga0395900_0120634
453 Ga0395898_0000085
454 Ga0395898_0000344
455 Ga0395898_0047281
456 Ga0395898_0048780
457 Ga0395898_0062301
458 Ga0395898_0599755
459 Ga0436364_0874538
460 Ga0395901_0000039
461 Ga0395901_0000090
462 Ga0395901_0000831
463 Ga0395901_0050403
464 Ga0395901_0140466
465 Ga0395901_0279236
466 Ga0400489_35688
467 Ga0436361_0252128
468 Ga0436361_0900991
469 Ga0436362_0865730
470 Ga0439448_0000029
471 Ga0451577_0008684
472 Ga0451577_0042712
473 Ga0451577_0150548
474 Ga0451577_0395781
475 Ga0466969_0000240
476 Ga0466973_0005575
477 Ga0466977_0000020
478 Ga0453683_0060033
479 Ga0466965_0011510
480 Ga0466966_0000046
481 Ga0466966_0007183
482 Ga0466966_0096642
483 Ga0466961_0000098
484 Ga0466961_0025333
485 Ga0466961_0145077
486 Ga0466963_0002263
487 Ga0466963_0015756
488 Ga0466963_0034958
489 Ga0453684_0020818
490 Ga0453684_0228413
491 Ga0466971_0005866
492 Ga0466971_0031561
493 Ga0466971_0035730
494 Ga0466971_0112300
495 Ga0466957_0001125
496 Ga0466957_0009964
497 Ga0466957_0010316
498 Ga0466960_0006117
499 Ga0466959_0029398
500 Ga0466959_0105734
501 Ga0451576_0001259
502 Ga0451576_0099122
503 Ga0466958_0002689
504 Ga0466958_0009235
505 Ga0466958_0017619
506 Ga0466958_0054195
507 Ga0495592_0138968
508 Ga0495603_0027535
509 Ga0495629_0050010
510 Ga0495629_0063396
511 Ga0495651_0018324
512 Ga0495653_0030803
513 Ga0495580_0000423
514 Ga0495580_0000858
515 Ga0495605_0000788
516 Ga0495594_0017001
517 Ga0495596_0000470
518 Ga0495596_0005206
519 Ga0495607_0106029
520 Ga0495610_0042478
521 Ga0495616_0009604
522 Ga0495618_0135500
523 Ga0495620_0000079
524 Ga0495637_0003365
525 Ga0495666_0000943
526 Ga0495652_0037708
527 Ga0495665_0002643
528 Ga0495640_0025211
529 Ga0495640_0061810
530 Ga0495586_0011015
531 Ga0495609_0014307
532 Ga0495597_0006212
533 Ga0495667_0080076
534 Ga0495634_0010122
535 Ga0495635_0018550
536 Ga0495635_0148677
537 Ga0495661_0003938
538 Ga0495613_0143930
539 Ga0495624_0023246
540 Ga0495624_0173973
541 Ga0495670_0004239
542 Ga0495671_0000408
543 Ga0495671_0000532
544 Ga0495649_0042001
545 Ga0495600_0073210
546 Ga0495581_0094331
547 Ga0495604_0003862
548 Ga0495604_0015686
549 Ga0495604_0021561
550 Ga0495674_0118190
551 Ga0495672_0059233
552 Ga0495676_0000208
553 Ga0495680_0006926
554 Ga0495680_0094151
555 Ga0495675_0014789
556 Ga0495673_0000205
557 Ga0495673_0000233
558 Ga0495673_0087540
559 Ga0495684_0117505
560 Ga0495686_0047593
561 Ga0495593_0007457
562 Ga0495614_0002972
563 Ga0496106_0000014
564 Ga0496116_0096191
565 Ga0496117_0134391
566 Ga0496118_0073338
567 Ga0496121_0018589
568 Ga0496121_0074330
569 Ga0496122_0010587
570 Ga0496123_0006912
571 Ga0496124_0104680
572 Ga0496125_0112284
573 Ga0501032_0037593
574 Ga0501034_0000069
575 Ga0501034_0044518
576 Ga0501036_0002490
577 Ga0501039_0024463
578 Ga0501042_0003022
579 Ga0501043_0112567
580 Ga0501047_0084754
581 Ga0501048_0005060
582 Ga0501073_0102973
583 Ga0501074_0023301
584 Ga0501076_0134696
585 Ga0501044_0356841
586 nmdc:mga0yw44_49046_c1
587 nmdc:mga0k408_145308_c1
588 nmdc:mga05p37_36602_c1
589 nmdc:mga05p37_666223_c1
590 nmdc:mga09592_186809_c1
591 nmdc:mga08y16_9689_c1
592 Ga0500651_0049041
593 Ga0500641_0003851
594 Ga0500655_000084
595 Ga0500559_0004196
596 Ga0500590_000885
597 Ga0500616_0000090
598 Ga0500622_0001574
599 Ga0500567_000358
600 Ga0500570_000131
601 Ga0500625_000038
602 Ga0466962_0000995
603 Ga0466962_0007520
604 Ga0466962_0062019
605 Ga0530510_0142483
606 2514043424
607 2588109324
608 2600809641
609 2795784741
610 2817618692
611 2844851948
612 2851155430
613 2858696749
614 2867370900
615 2939631855
616 2939634915
617 2990093711
618 2997602178
619 8048135890
620 8057569840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

50

157

0.99

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

202

335

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

235

373

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9725 111 331
4b7x-assembly5.cif.gz_J crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9683 6 335
4b7c-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9645 4 335
4b7x-assembly3.cif.gz_L crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9629 4 335
4b7x-assembly5.cif.gz_J crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9626 6 335
ID Description Score Start End Superfamily
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9768 9 235 3.40.50.2300
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9725 9 235 3.40.50.2300
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9695 5 125 3.90.180.10
af_Q2G2D7_8_231_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9663 11 235 3.90.180.10
af_Q2QVJ8_160_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9647 151 331 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N0ZHK2-F1-model_v4 NADP-dependent oxidoreductase 0.9879 171 336 GO:0016628
AF-A0A2P5KA35-F1-model_v4 Zinc-binding dehydrogenase 0.9866 167 336 GO:0016628
AF-A0A3D2GQ20-F1-model_v4 NADP-dependent oxidoreductase 0.9815 40 336 GO:0016628
AF-A0A2E9Y0W9-F1-model_v4 NADP-dependent oxidoreductase 0.9804 3 336 GO:0016628
AF-A0A537NL61-F1-model_v4 NADP-dependent oxidoreductase 0.9793 1 236 GO:0016628

Map