F400007

General Info

Members Datasets Scaffolds Average Seq Length
309 238 618 120

Family's Representative Sequence

Representative Sequence 3300003577|Ga0007416J51690_1079704|Ga0007416J51690_10797042
Length 128
Sequence MGVAKRMIPGEYILSPNPVICNENRKTVKITVKNTGDRPVQIGSHTHFFEVNKALDFPREKAYGHRLNLPAGTGIRFEPGDSKDVELCEYGGHRIVYGFNGLTMGGLKSSVVKNTALDKARRGLYKGA

Samples

Sample ID Description Type Environment
1 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
7 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
8 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
9 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
10 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
11 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
12 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
13 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
14 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
15 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
99 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
154 3300029273 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 Metatranscriptome Rhizosphere
155 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
172 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
196 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
238 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 5.5
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 4.53
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007416J51690_1079704 3300003577 Unclassified 2048
2 SwRhRL3b_contig_4112765 2162886006 Unclassified 1165
3 MRS1b_contig_2579155 2162886011 Unclassified 1055
4 rootH1_10402240 3300003323 Unclassified 1442
5 JGI26145J50221_1000848 3300003371 Unclassified 2488
6 JGI26142J50222_100358 3300003379 Unclassified 1668
7 JGI26144J50225_100312 3300003380 Unclassified 2088
8 JGI26139J50223_100028 3300003382 Archaea 7241
9 JGI26140J50224_100420 3300003383 Unclassified 1958
10 JGI26137J50245_100046 3300003396 Archaea 6146
11 JGI26130J50248_100031 3300003398 Archaea 7726
12 JGI26136J50244_100484 3300003399 Bacteria 1367
13 JGI26131J50246_100255 3300003400 Unclassified 2428
14 JGI26143J51219_1000262 3300003502 Unclassified 2170
15 JGI26138J51218_100133 3300003504 Unclassified 3461
16 Ga0058862_12048327 3300004803 Unclassified 833
17 Ga0065165_1016189 3300005262 Bacteria 2804
18 Ga0065704_10004669 3300005289 Archaea 4192
19 Ga0065704_10177566 3300005289 Unclassified 1255
20 Ga0065712_10005770 3300005290 Archaea 2787
21 Ga0065712_10081399 3300005290 Bacteria 3010
22 Ga0065715_10003761 3300005293 Bacteria 5305
23 Ga0065715_10005978 3300005293 Archaea 4368
24 Ga0065715_10089943 3300005293 Bacteria 8048
25 Ga0065715_10138808 3300005293 Unclassified 1886
26 Ga0065715_10682320 3300005293 Bacteria 662
27 Ga0065707_10003225 3300005295 Archaea 3860
28 Ga0070676_10160129 3300005328 Unclassified 1448
29 Ga0070676_10804434 3300005328 Bacteria 694
30 Ga0070676_11519736 3300005328 Bacteria 516
31 Ga0070683_100058470 3300005329 Bacteria 3582
32 Ga0070670_100007868 3300005331 Bacteria 9068
33 Ga0070666_10033690 3300005335 Bacteria 3391
34 Ga0070689_100660316 3300005340 Bacteria 910
35 Ga0070689_102120935 3300005340 Bacteria 515
36 Ga0070687_100731720 3300005343 Bacteria 694
37 Ga0070687_101328738 3300005343 Bacteria 535
38 Ga0070661_100128546 3300005344 Bacteria 1902
39 Ga0070661_100953862 3300005344 Bacteria 710
40 Ga0070669_100002471 3300005353 Bacteria 13389
41 Ga0070675_100281614 3300005354 Bacteria 1461
42 Ga0070675_101173838 3300005354 Bacteria 706
43 Ga0070671_100172576 3300005355 Bacteria 1829
44 Ga0070674_101098912 3300005356 Bacteria 702
45 Ga0070688_100756772 3300005365 Bacteria 757
46 Ga0070659_100018734 3300005366 Bacteria 5226
47 Ga0070667_100027345 3300005367 Bacteria 4745
48 Ga0070710_11502206 3300005437 Bacteria 506
49 Ga0070701_10081561 3300005438 Bacteria 1752
50 Ga0070700_100100066 3300005441 Unclassified 1908
51 Ga0070694_100594673 3300005444 Bacteria 890
52 Ga0070708_100003330 3300005445 Bacteria 12570
53 Ga0070708_101577308 3300005445 Bacteria 611
54 Ga0070663_100072043 3300005455 Bacteria 2516
55 Ga0070663_100904337 3300005455 Bacteria 763
56 Ga0070662_100610178 3300005457 Bacteria 918
57 Ga0070681_11303145 3300005458 Bacteria 649
58 Ga0070706_100177449 3300005467 Archaea 1989
59 Ga0070706_101805593 3300005467 Bacteria 556
60 Ga0070707_100996822 3300005468 Bacteria 803
61 Ga0070698_100552490 3300005471 Unclassified 1091
62 Ga0070699_100121090 3300005518 Archaea 2301
63 Ga0070699_100331893 3300005518 Bacteria 1368
64 Ga0070699_100424201 3300005518 Bacteria 1204
65 Ga0070679_100760040 3300005530 Bacteria 912
66 Ga0070684_100001123 3300005535 Bacteria 19198
67 Ga0070697_100036682 3300005536 Bacteria 3960
68 Ga0070697_100059483 3300005536 Archaea 3112
69 Ga0068853_102058974 3300005539 Bacteria 553
70 Ga0070672_100099955 3300005543 Bacteria 2352
71 Ga0070665_102094815 3300005548 Bacteria 570
72 Ga0068855_100093410 3300005563 Bacteria 3469
73 Ga0070664_100028857 3300005564 Bacteria 4621
74 Ga0070664_100127411 3300005564 Bacteria 2234
75 Ga0070664_100135141 3300005564 Bacteria 2168
76 Ga0068857_100013964 3300005577 Bacteria 6988
77 Ga0068857_100082740 3300005577 Bacteria 2867
78 Ga0068857_101545214 3300005577 Bacteria 647
79 Ga0068854_100002154 3300005578 Bacteria 12087
80 Ga0068856_100078212 3300005614 Bacteria 3279
81 Ga0070702_100100360 3300005615 Bacteria 1774
82 Ga0068852_100395478 3300005616 Bacteria 1358
83 Ga0068852_102371155 3300005616 Bacteria 551
84 Ga0068859_101109480 3300005617 Bacteria 870
85 Ga0068851_10001047 3300005834 Bacteria 11999
86 Ga0068862_100046116 3300005844 Bacteria 3720
87 Ga0068862_100525867 3300005844 Unclassified 1126
88 Ga0081539_10000873 3300005985 Bacteria 57852
89 Ga0075364_10050351 3300006051 Bacteria 2719
90 Ga0075364_10871676 3300006051 Bacteria 613
91 Ga0068871_100577542 3300006358 Bacteria 1020
92 Ga0075428_100024126 3300006844 Bacteria 6728
93 Ga0075431_100062429 3300006847 Bacteria 3844
94 Ga0075433_10102460 3300006852 Bacteria 2535
95 Ga0075434_100068862 3300006871 Archaea 3527
96 Ga0075434_100137457 3300006871 Unclassified 2463
97 Ga0075434_100346269 3300006871 Bacteria 1507
98 Ga0075429_100079173 3300006880 Bacteria 2865
99 Ga0068865_100147828 3300006881 Unclassified 1779
100 Ga0075436_100058198 3300006914 Archaea 2669
101 Ga0075436_100298462 3300006914 Bacteria 1154
102 Ga0075436_100992150 3300006914 Bacteria 630
103 Ga0097620_101109600 3300006931 Bacteria 870
104 Ga0075435_100077383 3300007076 Archaea 2727
105 Ga0075435_100445000 3300007076 Unclassified 1117
106 Ga0105240_10016234 3300009093 Bacteria 10092
107 Ga0111539_10000245 3300009094 Bacteria 65047
108 Ga0111539_10281075 3300009094 Unclassified 1937
109 Ga0111539_11762431 3300009094 Bacteria 718
110 Ga0105245_11331428 3300009098 Bacteria 767
111 Ga0114129_10008457 3300009147 Archaea 14665
112 Ga0114129_10008883 3300009147 Bacteria 14329
113 Ga0114129_10072540 3300009147 Bacteria 4799
114 Ga0105243_11695139 3300009148 Bacteria 661
115 Ga0105241_10015384 3300009174 Bacteria 5603
116 Ga0105242_10937484 3300009176 Bacteria 869
117 Ga0105248_10173443 3300009177 Bacteria 2431
118 Ga0105237_12081692 3300009545 Bacteria 576
119 Ga0105238_10002249 3300009551 Bacteria 19487
120 Ga0105238_10560507 3300009551 Bacteria 1147
121 Ga0105249_10000497 3300009553 Bacteria 36352
122 Ga0105239_10324102 3300010375 Bacteria 1737
123 Ga0105239_10688054 3300010375 Archaea 1169
124 Ga0105246_10405923 3300011119 Bacteria 1133
125 Ga0157371_11034813 3300013102 Bacteria 628
126 Ga0157378_12569388 3300013297 Bacteria 561
127 Ga0163162_10455574 3300013306 Bacteria 1411
128 Ga0163162_11332450 3300013306 Unclassified 816
129 Ga0157375_10645916 3300013308 Unclassified 1215
130 Ga0163163_10027301 3300014325 Bacteria 5467
131 Ga0157380_10549839 3300014326 Bacteria 1132
132 Ga0157377_10137894 3300014745 Bacteria 1496
133 Ga0157379_11572030 3300014968 Bacteria 641
134 Ga0206350_11425102 3300020080 Archaea 1445
135 Ga0256743_104857 3300023436 Bacteria 2432
136 Ga0256720_141903 3300023438 Bacteria 2531
137 Ga0209436_101673 3300025208 Bacteria 7363
138 Ga0207426_1012132 3300025302 Bacteria 3251
139 Ga0207697_10067144 3300025315 Bacteria 1499
140 Ga0207680_10298808 3300025903 Bacteria 1122
141 Ga0207645_10291576 3300025907 Bacteria 1085
142 Ga0207645_10536393 3300025907 Bacteria 793
143 Ga0207684_10209334 3300025910 Bacteria 1682
144 Ga0207649_10098357 3300025920 Bacteria 1931
145 Ga0207652_10868027 3300025921 Bacteria 798
146 Ga0207646_10099103 3300025922 Bacteria 2612
147 Ga0207681_10042279 3300025923 Bacteria 3043
148 Ga0207681_10158198 3300025923 Bacteria 1705
149 Ga0207694_10623597 3300025924 Bacteria 907
150 Ga0207650_10008616 3300025925 Bacteria 6963
151 Ga0207659_10444571 3300025926 Bacteria 1091
152 Ga0207687_11265304 3300025927 Bacteria 634
153 Ga0207644_10108146 3300025931 Bacteria 2099
154 Ga0207690_10028454 3300025932 Bacteria 3543
155 Ga0207690_10267403 3300025932 Bacteria 1327
156 Ga0207706_10337973 3300025933 Bacteria 1310
157 Ga0207706_10446308 3300025933 Bacteria 1119
158 Ga0207686_10213967 3300025934 Bacteria 1387
159 Ga0207709_11859285 3300025935 Bacteria 501
160 Ga0207670_10209596 3300025936 Bacteria 1485
161 Ga0207669_11004642 3300025937 Bacteria 701
162 Ga0207704_10116809 3300025938 Unclassified 1816
163 Ga0207691_10117971 3300025940 Bacteria 2354
164 Ga0207691_10138384 3300025940 Bacteria 2146
165 Ga0207691_10749662 3300025940 Bacteria 822
166 Ga0207711_10127335 3300025941 Bacteria 2280
167 Ga0207689_11105291 3300025942 Bacteria 668
168 Ga0207661_10043377 3300025944 Bacteria 3549
169 Ga0207679_10078410 3300025945 Bacteria 2516
170 Ga0207651_11524988 3300025960 Bacteria 602
171 Ga0207712_10058811 3300025961 Bacteria 2717
172 Ga0207658_10166548 3300025986 Bacteria 1811
173 Ga0207678_10205734 3300026067 Bacteria 1683
174 Ga0207676_11936809 3300026095 Bacteria 588
175 Ga0207674_10032971 3300026116 Bacteria 5427
176 Ga0207674_10043808 3300026116 Bacteria 4612
177 Ga0207698_10546243 3300026142 Bacteria 1135
178 Ga0207698_11845450 3300026142 Bacteria 619
179 Ga0209969_1000082 3300027360 Archaea 11724
180 Ga0209967_1000108 3300027364 Archaea 11004
181 Ga0209981_1005750 3300027378 Unclassified 1652
182 Ga0209996_1000969 3300027395 Unclassified 3409
183 Ga0209984_1043480 3300027424 Bacteria 650
184 Ga0209984_1043532 3300027424 Bacteria 650
185 Ga0210000_1000841 3300027462 Unclassified 4258
186 Ga0209968_1000295 3300027526 Archaea 8451
187 Ga0209999_1002140 3300027543 Unclassified 3462
188 Ga0209982_1000199 3300027552 Archaea 6971
189 Ga0209970_1001209 3300027614 Unclassified 4548
190 Ga0210002_1000307 3300027617 Archaea 6744
191 Ga0209983_1001673 3300027665 Archaea 4914
192 Ga0209983_1010782 3300027665 Unclassified 1868
193 Ga0209971_1003851 3300027682 Archaea 3550
194 Ga0209971_1011291 3300027682 Unclassified 2116
195 Ga0209966_1001021 3300027695 Archaea 5214
196 Ga0209998_10001830 3300027717 Archaea 5039
197 Ga0209974_10047862 3300027876 Bacteria 1433
198 Ga0268266_11959922 3300028379 Bacteria 559
199 Ga0268265_10047069 3300028380 Bacteria 3229
200 Ga0268265_10479211 3300028380 Unclassified 1168
201 Ga0268264_10833750 3300028381 Bacteria 923
202 Ga0311000_135344 3300029272 Bacteria 856
203 Ga0311008_118010 3300029273 Bacteria 916
204 Ga0310981_1045658 3300029285 Bacteria 2513
205 Ga0307405_10102703 3300031731 Archaea 1921
206 Ga0307413_10305027 3300031824 Archaea 1209
207 Ga0307410_10020337 3300031852 Archaea 4058
208 Ga0307406_10163535 3300031901 Archaea 1603
209 Ga0307407_10602247 3300031903 Bacteria 818
210 Ga0307409_100589112 3300031995 Archaea 1097
211 Ga0307409_101404350 3300031995 Bacteria 724
212 Ga0307416_100063262 3300032002 Archaea 3029
213 Ga0307414_10030780 3300032004 Archaea 3511
214 Ga0307411_10017018 3300032005 Archaea 4130
215 Ga0307415_100061843 3300032126 Archaea 2594
216 Ga0373949_0212822 3300035090 Unclassified 585
217 Ga0373945_0483629 3300035116 Unclassified 550
218 Ga0373961_0000353 3300035241 Archaea 19925
219 Ga0373925_1235482 3300037068 Bacteria 614
220 Ga0373925_1576929 3300037068 Bacteria 537
221 Ga0451853_3067947 3300041512 Bacteria 561
222 Ga0439443_031584 3300042003 Unclassified 874
223 Ga0450923_079298 3300042125 Bacteria 737
224 Ga0451577_0039928 3300042876 Bacteria 4215
225 Ga0451577_0710664 3300042876 Unclassified 910
226 Ga0439440_0002103 3300042993 Archaea 3721
227 Ga0453684_0052935 3300044712 Bacteria 5303
228 Ga0466967_2388225 3300045976 Unclassified 524
229 Ga0495590_0133406 3300046457 Bacteria 894
230 Ga0495632_0000420 3300046519 Bacteria 40173
231 Ga0495613_0105622 3300046689 Bacteria 2033
232 Ga0495660_0010375 3300046810 Bacteria 5419
233 Ga0495581_0212951 3300047315 Bacteria 1130
234 Ga0495626_0009622 3300048091 Bacteria 5213
235 Ga0496102_0413499 3300048905 Unclassified 1267
236 Ga0496104_0069057 3300048907 Bacteria 3358
237 Ga0496104_0445785 3300048907 Bacteria 1206
238 Ga0496105_0017487 3300048908 Bacteria 5750
239 Ga0496106_0469020 3300048909 Archaea 1011
240 Ga0496106_1550862 3300048909 Bacteria 508
241 Ga0496108_0001171 3300048911 Bacteria 20463
242 Ga0496109_0003672 3300048912 Bacteria 12818
243 Ga0496110_0058970 3300048913 Bacteria 3381
244 Ga0496111_0041491 3300048914 Bacteria 3302
245 Ga0496111_0290170 3300048914 Bacteria 1213
246 Ga0496112_0000228 3300048915 Bacteria 36314
247 Ga0496112_0091101 3300048915 Unclassified 3018
248 Ga0496114_0115857 3300048917 Bacteria 2300
249 Ga0501307_001027 3300049162 Archaea 2198
250 Ga0495678_002240 3300049459 Bacteria 13483
251 Ga0501291_153588 3300049514 Unclassified 522
252 Ga0501315_004034 3300049531 Bacteria 1509
253 Ga0501317_003092 3300049533 Archaea 1628
254 Ga0501321_004068 3300049537 Bacteria 1378
255 Ga0501327_15328 3300049543 Unclassified 541
256 Ga0501333_005171 3300049549 Archaea 840
257 Ga0501031_0170735 3300049568 Archaea 1421
258 Ga0501036_0226826 3300049572 Archaea 1568
259 Ga0501037_0090641 3300049573 Archaea 2211
260 Ga0501039_0056813 3300049575 Bacteria 3032
261 Ga0501039_0139197 3300049575 Archaea 1906
262 Ga0501040_0124147 3300049576 Bacteria 1813
263 Ga0501041_0014711 3300049577 Bacteria 4646
264 Ga0501041_0208050 3300049577 Archaea 1227
265 Ga0501046_0187921 3300049580 Archaea 1542
266 Ga0501048_0550150 3300049582 Archaea 828
267 Ga0501068_0058020 3300049584 Bacteria 2348
268 Ga0501071_0001713 3300049587 Bacteria 12866
269 Ga0501072_0021387 3300049588 Bacteria 5016
270 Ga0501074_0061920 3300049590 Bacteria 2696
271 Ga0501075_0081829 3300049591 Bacteria 2445
272 Ga0501075_0454387 3300049591 Bacteria 977
273 Ga0501076_0035096 3300049592 Bacteria 3923
274 Ga0501077_0023705 3300049593 Bacteria 3891
275 Ga0501259_162560 3300049688 Unclassified 558
276 Ga0501261_009706 3300049690 Archaea 1258
277 Ga0501225_0091289 3300049705 Unclassified 882
278 Ga0501079_0158932 3300049741 Archaea 1762
279 Ga0501079_1183947 3300049741 Bacteria 602
280 Ga0501080_0791061 3300049742 Bacteria 832
281 Ga0501081_0378797 3300049743 Bacteria 1045
282 Ga0501083_0265297 3300049744 Bacteria 1117
283 Ga0501044_0211640 3300049823 Archaea 1893
284 Ga0501045_0035609 3300049824 Bacteria 3614
285 nmdc:mga00v17_219002_c1 3300050491 Bacteria 1232
286 nmdc:mga00v17_762334_c1 3300050491 Bacteria 618
287 nmdc:mga05p37_323389_c1 3300050507 Bacteria 1825
288 nmdc:mga05p37_32841_c1 3300050507 Bacteria 6351
289 nmdc:mga09592_139239_c1 3300050508 Unclassified 2091
290 nmdc:mga09592_590853_c1 3300050508 Bacteria 952
291 nmdc:mga06r32_1450376_c1 3300050510 Bacteria 627
292 nmdc:mga06r32_99646_c1 3300050510 Bacteria 2850
293 nmdc:mga08y16_1218829_c1 3300050511 Bacteria 722
294 nmdc:mga08y16_22969_c1 3300050511 Bacteria 6584
295 nmdc:mga0n895_111643_c1 3300050512 Bacteria 2750
296 nmdc:mga0n895_346233_c1 3300050512 Bacteria 1505
297 nmdc:mga0n895_51110_c1 3300050512 Archaea 4054
298 nmdc:mga0rr50_123686_c1 3300050513 Bacteria 2063
299 nmdc:mga0rr50_139209_c1 3300050513 Archaea 1951
300 nmdc:mga0rr50_1856393_c1 3300050513 Unclassified 507
301 nmdc:mga0rr50_730541_c1 3300050513 Bacteria 845
302 nmdc:mga0a205_166204_c1 3300050515 Bacteria 2102
303 nmdc:mga0a205_22699_c1 3300050515 Bacteria 2831
304 Ga0501084_0460059 3300054114 Archaea 1076
305 Ga0587089_008733 3300059509 Archaea 1230
306 Ga0587075_003209 3300059644 Bacteria 1801
307 Ga0587076_003601 3300059645 Unclassified 1862
308 2821136615 2821136567 Bacteria 8080116
309 2904468640 2904467357 Bacteria 8057758
310 Ga0007416J51690_1079704
311 SwRhRL3b_contig_4112765
312 MRS1b_contig_2579155
313 rootH1_10402240
314 JGI26145J50221_1000848
315 JGI26142J50222_100358
316 JGI26144J50225_100312
317 JGI26139J50223_100028
318 JGI26140J50224_100420
319 JGI26137J50245_100046
320 JGI26130J50248_100031
321 JGI26136J50244_100484
322 JGI26131J50246_100255
323 JGI26143J51219_1000262
324 JGI26138J51218_100133
325 Ga0058862_12048327
326 Ga0065165_1016189
327 Ga0065704_10004669
328 Ga0065704_10177566
329 Ga0065712_10005770
330 Ga0065712_10081399
331 Ga0065715_10003761
332 Ga0065715_10005978
333 Ga0065715_10089943
334 Ga0065715_10138808
335 Ga0065715_10682320
336 Ga0065707_10003225
337 Ga0070676_10160129
338 Ga0070676_10804434
339 Ga0070676_11519736
340 Ga0070683_100058470
341 Ga0070670_100007868
342 Ga0070666_10033690
343 Ga0070689_100660316
344 Ga0070689_102120935
345 Ga0070687_100731720
346 Ga0070687_101328738
347 Ga0070661_100128546
348 Ga0070661_100953862
349 Ga0070669_100002471
350 Ga0070675_100281614
351 Ga0070675_101173838
352 Ga0070671_100172576
353 Ga0070674_101098912
354 Ga0070688_100756772
355 Ga0070659_100018734
356 Ga0070667_100027345
357 Ga0070710_11502206
358 Ga0070701_10081561
359 Ga0070700_100100066
360 Ga0070694_100594673
361 Ga0070708_100003330
362 Ga0070708_101577308
363 Ga0070663_100072043
364 Ga0070663_100904337
365 Ga0070662_100610178
366 Ga0070681_11303145
367 Ga0070706_100177449
368 Ga0070706_101805593
369 Ga0070707_100996822
370 Ga0070698_100552490
371 Ga0070699_100121090
372 Ga0070699_100331893
373 Ga0070699_100424201
374 Ga0070679_100760040
375 Ga0070684_100001123
376 Ga0070697_100036682
377 Ga0070697_100059483
378 Ga0068853_102058974
379 Ga0070672_100099955
380 Ga0070665_102094815
381 Ga0068855_100093410
382 Ga0070664_100028857
383 Ga0070664_100127411
384 Ga0070664_100135141
385 Ga0068857_100013964
386 Ga0068857_100082740
387 Ga0068857_101545214
388 Ga0068854_100002154
389 Ga0068856_100078212
390 Ga0070702_100100360
391 Ga0068852_100395478
392 Ga0068852_102371155
393 Ga0068859_101109480
394 Ga0068851_10001047
395 Ga0068862_100046116
396 Ga0068862_100525867
397 Ga0081539_10000873
398 Ga0075364_10050351
399 Ga0075364_10871676
400 Ga0068871_100577542
401 Ga0075428_100024126
402 Ga0075431_100062429
403 Ga0075433_10102460
404 Ga0075434_100068862
405 Ga0075434_100137457
406 Ga0075434_100346269
407 Ga0075429_100079173
408 Ga0068865_100147828
409 Ga0075436_100058198
410 Ga0075436_100298462
411 Ga0075436_100992150
412 Ga0097620_101109600
413 Ga0075435_100077383
414 Ga0075435_100445000
415 Ga0105240_10016234
416 Ga0111539_10000245
417 Ga0111539_10281075
418 Ga0111539_11762431
419 Ga0105245_11331428
420 Ga0114129_10008457
421 Ga0114129_10008883
422 Ga0114129_10072540
423 Ga0105243_11695139
424 Ga0105241_10015384
425 Ga0105242_10937484
426 Ga0105248_10173443
427 Ga0105237_12081692
428 Ga0105238_10002249
429 Ga0105238_10560507
430 Ga0105249_10000497
431 Ga0105239_10324102
432 Ga0105239_10688054
433 Ga0105246_10405923
434 Ga0157371_11034813
435 Ga0157378_12569388
436 Ga0163162_10455574
437 Ga0163162_11332450
438 Ga0157375_10645916
439 Ga0163163_10027301
440 Ga0157380_10549839
441 Ga0157377_10137894
442 Ga0157379_11572030
443 Ga0206350_11425102
444 Ga0256743_104857
445 Ga0256720_141903
446 Ga0209436_101673
447 Ga0207426_1012132
448 Ga0207697_10067144
449 Ga0207680_10298808
450 Ga0207645_10291576
451 Ga0207645_10536393
452 Ga0207684_10209334
453 Ga0207649_10098357
454 Ga0207652_10868027
455 Ga0207646_10099103
456 Ga0207681_10042279
457 Ga0207681_10158198
458 Ga0207694_10623597
459 Ga0207650_10008616
460 Ga0207659_10444571
461 Ga0207687_11265304
462 Ga0207644_10108146
463 Ga0207690_10028454
464 Ga0207690_10267403
465 Ga0207706_10337973
466 Ga0207706_10446308
467 Ga0207686_10213967
468 Ga0207709_11859285
469 Ga0207670_10209596
470 Ga0207669_11004642
471 Ga0207704_10116809
472 Ga0207691_10117971
473 Ga0207691_10138384
474 Ga0207691_10749662
475 Ga0207711_10127335
476 Ga0207689_11105291
477 Ga0207661_10043377
478 Ga0207679_10078410
479 Ga0207651_11524988
480 Ga0207712_10058811
481 Ga0207658_10166548
482 Ga0207678_10205734
483 Ga0207676_11936809
484 Ga0207674_10032971
485 Ga0207674_10043808
486 Ga0207698_10546243
487 Ga0207698_11845450
488 Ga0209969_1000082
489 Ga0209967_1000108
490 Ga0209981_1005750
491 Ga0209996_1000969
492 Ga0209984_1043480
493 Ga0209984_1043532
494 Ga0210000_1000841
495 Ga0209968_1000295
496 Ga0209999_1002140
497 Ga0209982_1000199
498 Ga0209970_1001209
499 Ga0210002_1000307
500 Ga0209983_1001673
501 Ga0209983_1010782
502 Ga0209971_1003851
503 Ga0209971_1011291
504 Ga0209966_1001021
505 Ga0209998_10001830
506 Ga0209974_10047862
507 Ga0268266_11959922
508 Ga0268265_10047069
509 Ga0268265_10479211
510 Ga0268264_10833750
511 Ga0311000_135344
512 Ga0311008_118010
513 Ga0310981_1045658
514 Ga0307405_10102703
515 Ga0307413_10305027
516 Ga0307410_10020337
517 Ga0307406_10163535
518 Ga0307407_10602247
519 Ga0307409_100589112
520 Ga0307409_101404350
521 Ga0307416_100063262
522 Ga0307414_10030780
523 Ga0307411_10017018
524 Ga0307415_100061843
525 Ga0373949_0212822
526 Ga0373945_0483629
527 Ga0373961_0000353
528 Ga0373925_1235482
529 Ga0373925_1576929
530 Ga0451853_3067947
531 Ga0439443_031584
532 Ga0450923_079298
533 Ga0451577_0039928
534 Ga0451577_0710664
535 Ga0439440_0002103
536 Ga0453684_0052935
537 Ga0466967_2388225
538 Ga0495590_0133406
539 Ga0495632_0000420
540 Ga0495613_0105622
541 Ga0495660_0010375
542 Ga0495581_0212951
543 Ga0495626_0009622
544 Ga0496102_0413499
545 Ga0496104_0069057
546 Ga0496104_0445785
547 Ga0496105_0017487
548 Ga0496106_0469020
549 Ga0496106_1550862
550 Ga0496108_0001171
551 Ga0496109_0003672
552 Ga0496110_0058970
553 Ga0496111_0041491
554 Ga0496111_0290170
555 Ga0496112_0000228
556 Ga0496112_0091101
557 Ga0496114_0115857
558 Ga0501307_001027
559 Ga0495678_002240
560 Ga0501291_153588
561 Ga0501315_004034
562 Ga0501317_003092
563 Ga0501321_004068
564 Ga0501327_15328
565 Ga0501333_005171
566 Ga0501031_0170735
567 Ga0501036_0226826
568 Ga0501037_0090641
569 Ga0501039_0056813
570 Ga0501039_0139197
571 Ga0501040_0124147
572 Ga0501041_0014711
573 Ga0501041_0208050
574 Ga0501046_0187921
575 Ga0501048_0550150
576 Ga0501068_0058020
577 Ga0501071_0001713
578 Ga0501072_0021387
579 Ga0501074_0061920
580 Ga0501075_0081829
581 Ga0501075_0454387
582 Ga0501076_0035096
583 Ga0501077_0023705
584 Ga0501259_162560
585 Ga0501261_009706
586 Ga0501225_0091289
587 Ga0501079_0158932
588 Ga0501079_1183947
589 Ga0501080_0791061
590 Ga0501081_0378797
591 Ga0501083_0265297
592 Ga0501044_0211640
593 Ga0501045_0035609
594 nmdc:mga00v17_219002_c1
595 nmdc:mga00v17_762334_c1
596 nmdc:mga05p37_323389_c1
597 nmdc:mga05p37_32841_c1
598 nmdc:mga09592_139239_c1
599 nmdc:mga09592_590853_c1
600 nmdc:mga06r32_1450376_c1
601 nmdc:mga06r32_99646_c1
602 nmdc:mga08y16_1218829_c1
603 nmdc:mga08y16_22969_c1
604 nmdc:mga0n895_111643_c1
605 nmdc:mga0n895_346233_c1
606 nmdc:mga0n895_51110_c1
607 nmdc:mga0rr50_123686_c1
608 nmdc:mga0rr50_139209_c1
609 nmdc:mga0rr50_1856393_c1
610 nmdc:mga0rr50_730541_c1
611 nmdc:mga0a205_166204_c1
612 nmdc:mga0a205_22699_c1
613 Ga0501084_0460059
614 Ga0587089_008733
615 Ga0587075_003209
616 Ga0587076_003601
617 2821136615
618 2904468640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00699

Urease_beta

Urease beta subunit

9

106

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kns-assembly1.cif.gz_F cryo-em structure of jack bean urease 0.9764 13 122
4goa-assembly1.cif.gz_A crystal structure of jack bean urease inhibited with fluoride 0.9751 13 122
4g7e-assembly1.cif.gz_B-3 crystal structure of pigeon pea urease 0.9729 13 122
4g7e-assembly1.cif.gz_A crystal structure of pigeon pea urease 0.9722 13 122
3qga-assembly1.cif.gz_A 3.0 a model of iron containing urease urea2b2 from helicobacter mustelae 0.9425 5 120
ID Description Score Start End Superfamily
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.9829 19 122 2.10.150.10
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.9425 5 120 2.10.150.10
1s3tB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8972 1 119 2.10.150.10
1a5kB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8971 1 101 2.10.150.10
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8971 19 122 2.10.150.10
ID Description Score Start End GO Terms
AF-A0A3C0N2Z2-F1-model_v4 Urease subunit beta 1.015 28 77 GO:0009039
GO:0035550
GO:0043419
AF-A0A4Q3HQA4-F1-model_v4 deleted 1.002 22 101
AF-A0A436HHA9-F1-model_v4 Urease subunit beta (EC 3.5.1.5) 1.002 34 101 GO:0009039
GO:0035550
GO:0043419
AF-A0A382FG45-F1-model_v4 Urease subunit beta 1.002 36 102 GO:0009039
GO:0035550
GO:0043419
AF-A0A382SCE5-F1-model_v4 Uncharacterized protein 1.002 58 118 GO:0009039
GO:0035550
GO:0043419

Map