F399528

General Info

Members Datasets Scaffolds Average Seq Length
308 209 616 69

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100243984|Ga0070670_1002439841
Length 80
Sequence MRHHRSDGTRMISAPSPANAKEDNGLEAAVDQAIAACGGDMRSTIRALIVANEYLEAEAGELMKAVSHAYTRGRFNTYSG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
205 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
206 2791355199
207 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
208 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
209 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 1.3
Rhizoplane 7.47
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100243984 3300005331 Bacteria 1564
2 rootH2_10190462 3300003320 Bacteria 1193
3 JGI25404J52841_10055187 3300003659 Bacteria 833
4 JGI25405J52794_10023518 3300003911 Bacteria 1254
5 JGI25405J52794_10108479 3300003911 Bacteria 622
6 Ga0070658_10133073 3300005327 Bacteria 2073
7 Ga0070690_100223319 3300005330 Bacteria 1321
8 Ga0070677_10221221 3300005333 Bacteria 925
9 Ga0070666_11114265 3300005335 Bacteria 587
10 Ga0070680_100099699 3300005336 Bacteria 2411
11 Ga0070680_100284265 3300005336 Bacteria 1402
12 Ga0070682_100478133 3300005337 Bacteria 960
13 Ga0070682_101090829 3300005337 Bacteria 668
14 Ga0070682_101718644 3300005337 Bacteria 545
15 Ga0068868_100288965 3300005338 Bacteria 1390
16 Ga0070660_100101858 3300005339 Bacteria 2276
17 Ga0070660_100843083 3300005339 Bacteria 772
18 Ga0070675_100291726 3300005354 Bacteria 1436
19 Ga0070671_100681942 3300005355 Bacteria 891
20 Ga0070674_100907063 3300005356 Bacteria 768
21 Ga0070674_100915006 3300005356 Bacteria 765
22 Ga0070709_11109728 3300005434 Bacteria 633
23 Ga0070714_100206996 3300005435 Bacteria 1797
24 Ga0070713_101221067 3300005436 Bacteria 728
25 Ga0070678_100385315 3300005456 Bacteria 1214
26 Ga0070681_10102750 3300005458 Bacteria 2803
27 Ga0068867_100567964 3300005459 Bacteria 985
28 Ga0068867_100911703 3300005459 Bacteria 791
29 Ga0068867_101555167 3300005459 Bacteria 617
30 Ga0070698_100616700 3300005471 Bacteria 1025
31 Ga0070699_101872006 3300005518 Bacteria 549
32 Ga0070679_100364287 3300005530 Bacteria 1393
33 Ga0070679_100436282 3300005530 Bacteria 1255
34 Ga0070684_100008559 3300005535 Bacteria 8008
35 Ga0070697_101971132 3300005536 Bacteria 523
36 Ga0068853_100253513 3300005539 Bacteria 1616
37 Ga0068853_102304986 3300005539 Bacteria 522
38 Ga0070696_100241020 3300005546 Bacteria 1364
39 Ga0070665_100348384 3300005548 Bacteria 1486
40 Ga0070665_102152529 3300005548 Bacteria 562
41 Ga0068855_100173245 3300005563 Bacteria 2443
42 Ga0070664_101261833 3300005564 Bacteria 697
43 Ga0068857_100444739 3300005577 Bacteria 1211
44 Ga0068857_101735144 3300005577 Bacteria 611
45 Ga0068856_100254032 3300005614 Bacteria 1773
46 Ga0068856_100369833 3300005614 Bacteria 1452
47 Ga0068856_100922540 3300005614 Bacteria 892
48 Ga0068856_101032146 3300005614 Bacteria 840
49 Ga0068852_100249979 3300005616 Bacteria 1698
50 Ga0068852_100642425 3300005616 Bacteria 1068
51 Ga0068870_10423336 3300005840 Bacteria 872
52 Ga0081455_10009514 3300005937 Bacteria 9987
53 Ga0081455_10014163 3300005937 Bacteria 7835
54 Ga0081455_10161212 3300005937 Bacteria 1719
55 Ga0081538_10023222 3300005981 Bacteria 4465
56 Ga0081540_1000438 3300005983 Bacteria 41157
57 Ga0081540_1000755 3300005983 Bacteria 29759
58 Ga0081540_1000834 3300005983 Bacteria 28102
59 Ga0081540_1001804 3300005983 Bacteria 17954
60 Ga0081540_1003765 3300005983 Bacteria 11880
61 Ga0081540_1019172 3300005983 Bacteria 4169
62 Ga0081540_1065987 3300005983 Bacteria 1699
63 Ga0070717_10004761 3300006028 Bacteria 9866
64 Ga0070717_10494367 3300006028 Bacteria 1105
65 Ga0070717_10521683 3300006028 Bacteria 1075
66 Ga0075365_10154550 3300006038 Bacteria 1597
67 Ga0075365_10440209 3300006038 Unclassified 920
68 Ga0070715_11014410 3300006163 Bacteria 518
69 Ga0070716_100923356 3300006173 Bacteria 685
70 Ga0070716_101049886 3300006173 Bacteria 647
71 Ga0070716_101472787 3300006173 Bacteria 556
72 Ga0075366_10911592 3300006195 Bacteria 548
73 Ga0097621_100546822 3300006237 Bacteria 1054
74 Ga0097621_100833959 3300006237 Bacteria 856
75 Ga0068871_101986067 3300006358 Bacteria 554
76 Ga0075428_102211225 3300006844 Bacteria 567
77 Ga0068865_100643312 3300006881 Bacteria 900
78 Ga0068865_101461507 3300006881 Bacteria 611
79 Ga0099794_10000898 3300007265 Bacteria 10063
80 Ga0099794_10344346 3300007265 Unclassified 775
81 Ga0099795_10409962 3300007788 Bacteria 617
82 Ga0099795_10445310 3300007788 Bacteria 595
83 Ga0105240_10128148 3300009093 Bacteria 3047
84 Ga0105247_10502130 3300009101 Bacteria 884
85 Ga0105247_11474686 3300009101 Bacteria 554
86 Ga0114129_11061823 3300009147 Bacteria 1016
87 Ga0105243_10137852 3300009148 Bacteria 2078
88 Ga0105243_12929610 3300009148 Bacteria 517
89 Ga0105242_11905221 3300009176 Bacteria 635
90 Ga0105248_12171450 3300009177 Bacteria 632
91 Ga0105248_12626740 3300009177 Bacteria 574
92 Ga0105237_10195637 3300009545 Bacteria 2022
93 Ga0105237_10294032 3300009545 Bacteria 1627
94 Ga0105238_10780308 3300009551 Bacteria 970
95 Ga0105238_10966187 3300009551 Bacteria 872
96 Ga0105238_11327964 3300009551 Bacteria 745
97 Ga0099796_10188259 3300010159 Bacteria 832
98 Ga0099796_10230026 3300010159 Bacteria 763
99 Ga0105239_10083922 3300010375 Bacteria 3509
100 Ga0105239_12275449 3300010375 Bacteria 631
101 Ga0105239_13037800 3300010375 Bacteria 547
102 Ga0105246_10134072 3300011119 Bacteria 1854
103 Ga0105246_12527663 3300011119 Bacteria 506
104 Ga0157374_11291910 3300013296 Bacteria 752
105 Ga0157378_10024915 3300013297 Bacteria 5269
106 Ga0157378_11427983 3300013297 Bacteria 735
107 Ga0157378_11575629 3300013297 Bacteria 702
108 Ga0157372_10067552 3300013307 Bacteria 4017
109 Ga0157372_12485826 3300013307 Bacteria 595
110 Ga0157375_10080427 3300013308 Bacteria 3297
111 Ga0157375_10566147 3300013308 Bacteria 1297
112 Ga0157375_11004815 3300013308 Bacteria 974
113 Ga0163163_12603798 3300014325 Bacteria 563
114 Ga0163163_12890309 3300014325 Bacteria 536
115 Ga0157380_10924074 3300014326 Bacteria 900
116 Ga0157380_12180765 3300014326 Bacteria 618
117 Ga0157377_10130905 3300014745 Bacteria 1532
118 Ga0157376_10412102 3300014969 Bacteria 1309
119 Ga0163161_10651753 3300017792 Bacteria 872
120 Ga0163161_11814621 3300017792 Bacteria 542
121 Ga0213872_10174401 3300021361 Bacteria 931
122 Ga0213876_10292585 3300021384 Bacteria 865
123 Ga0213876_10313478 3300021384 Bacteria 834
124 Ga0209677_100345 3300025253 Bacteria 29129
125 Ga0207697_10450341 3300025315 Bacteria 571
126 Ga0207688_10329787 3300025901 Bacteria 937
127 Ga0207680_10570712 3300025903 Bacteria 808
128 Ga0207705_11348585 3300025909 Unclassified 544
129 Ga0207684_11045489 3300025910 Bacteria 681
130 Ga0207707_10404773 3300025912 Bacteria 1171
131 Ga0207707_10570663 3300025912 Bacteria 960
132 Ga0207695_10891364 3300025913 Unclassified 769
133 Ga0207671_10987322 3300025914 Bacteria 664
134 Ga0207660_10127586 3300025917 Bacteria 1933
135 Ga0207660_10149637 3300025917 Bacteria 1792
136 Ga0207657_10227584 3300025919 Bacteria 1492
137 Ga0207652_10192607 3300025921 Bacteria 1834
138 Ga0207652_10714736 3300025921 Bacteria 893
139 Ga0207694_11209767 3300025924 Bacteria 639
140 Ga0207659_10076907 3300025926 Bacteria 2455
141 Ga0207659_11503253 3300025926 Bacteria 576
142 Ga0207700_11420023 3300025928 Bacteria 617
143 Ga0207664_10186975 3300025929 Bacteria 1781
144 Ga0207664_10656176 3300025929 Bacteria 943
145 Ga0207690_10075540 3300025932 Bacteria 2337
146 Ga0207669_10250417 3300025937 Bacteria 1319
147 Ga0207669_10266245 3300025937 Bacteria 1285
148 Ga0207669_10391110 3300025937 Bacteria 1086
149 Ga0207704_11622629 3300025938 Unclassified 556
150 Ga0207665_10193978 3300025939 Bacteria 1477
151 Ga0207665_10240739 3300025939 Bacteria 1333
152 Ga0207665_11479053 3300025939 Unclassified 540
153 Ga0207691_10969540 3300025940 Bacteria 710
154 Ga0207711_10795704 3300025941 Bacteria 881
155 Ga0207661_10000231 3300025944 Bacteria 36612
156 Ga0207667_10363764 3300025949 Bacteria 1475
157 Ga0207651_11893599 3300025960 Bacteria 536
158 Ga0207677_11913264 3300026023 Bacteria 551
159 Ga0207639_10244570 3300026041 Bacteria 1562
160 Ga0207639_11612206 3300026041 Bacteria 609
161 Ga0207702_10080224 3300026078 Bacteria 2830
162 Ga0207702_10552272 3300026078 Bacteria 1127
163 Ga0207702_11265462 3300026078 Bacteria 732
164 Ga0207641_10411983 3300026088 Bacteria 1300
165 Ga0207683_10045593 3300026121 Bacteria 3834
166 Ga0207698_10273988 3300026142 Unclassified 1557
167 Ga0207698_11803843 3300026142 Bacteria 627
168 Ga0268265_11248859 3300028380 Unclassified 742
169 Ga0307517_10464570 3300028786 Bacteria 652
170 Ga0307513_10719368 3300031456 Bacteria 704
171 Ga0307509_10507791 3300031507 Bacteria 889
172 Ga0307508_10204715 3300031616 Bacteria 1574
173 Ga0307516_10002704 3300031730 Bacteria 23386
174 Ga0307516_10014283 3300031730 Bacteria 8409
175 Ga0307412_12299853 3300031911 Bacteria 503
176 Ga0307416_101363600 3300032002 Bacteria 815
177 Ga0307510_10030150 3300033180 Bacteria 6155
178 Ga0373930_0177064 3300034816 Bacteria 546
179 Ga0373950_0032870 3300034818 Bacteria 967
180 Ga0373949_0042132 3300035090 Bacteria 1126
181 Ga0373957_0458752 3300035120 Bacteria 552
182 Ga0373960_0020795 3300035121 Bacteria 1739
183 Ga0373943_0017632 3300035170 Bacteria 3268
184 Ga0373946_0149734 3300035171 Bacteria 1088
185 Ga0373962_0370561 3300035242 Bacteria 521
186 Ga0373931_0002361 3300035691 Bacteria 8344
187 Ga0373931_0723727 3300035691 Bacteria 659
188 Ga0373927_0011596 3300035695 Bacteria 5870
189 Ga0373927_0040305 3300035695 Bacteria 3030
190 Ga0373947_0046494 3300035725 Bacteria 2599
191 Ga0373947_0108611 3300035725 Bacteria 1751
192 Ga0373947_0599957 3300035725 Bacteria 750
193 Ga0373937_0396853 3300036401 Bacteria 1309
194 Ga0373937_0678988 3300036401 Bacteria 976
195 Ga0373925_0027201 3300037068 Bacteria 4188
196 Ga0373925_0268368 3300037068 Bacteria 1372
197 Ga0373925_0475454 3300037068 Bacteria 1025
198 Ga0395898_0178078 3300037466 Bacteria 2032
199 Ga0395905_0095310 3300037471 Bacteria 2793
200 Ga0395901_0216556 3300038443 Bacteria 2003
201 Ga0436365_0061103 3300039437 Unclassified 778
202 Ga0436365_1452792 3300039437 Bacteria 2409
203 Ga0436360_0374920 3300039438 Bacteria 1967
204 Ga0436361_0061447 3300039447 Bacteria 1417
205 Ga0436361_0598638 3300039447 Bacteria 790
206 Ga0436362_0817523 3300039453 Bacteria 662
207 Ga0451847_0305399 3300041503 Unclassified 657
208 Ga0466965_0410488 3300044683 Bacteria 749
209 Ga0466964_0147409 3300044706 Bacteria 1088
210 Ga0466970_0291049 3300044765 Bacteria 920
211 Ga0466957_0537819 3300044842 Bacteria 813
212 Ga0466957_0612847 3300044842 Bacteria 763
213 Ga0466958_0182531 3300045836 Bacteria 1332
214 Ga0495603_0908563 3300046455 Bacteria 500
215 Ga0495590_0383245 3300046457 Bacteria 538
216 Ga0495638_0046153 3300046460 Bacteria 2738
217 Ga0495580_0107654 3300046472 Bacteria 1936
218 Ga0495582_0136707 3300046473 Bacteria 1387
219 Ga0495582_0308388 3300046473 Bacteria 910
220 Ga0495605_0199944 3300046474 Bacteria 871
221 Ga0495639_0263407 3300046475 Bacteria 854
222 Ga0495639_0426560 3300046475 Bacteria 672
223 Ga0495664_0586451 3300046477 Bacteria 663
224 Ga0495594_0658200 3300046499 Bacteria 593
225 Ga0495630_0152284 3300046517 Bacteria 1760
226 Ga0495632_0138963 3300046519 Bacteria 1128
227 Ga0495654_0292119 3300046530 Unclassified 668
228 Ga0495667_0325802 3300046559 Bacteria 972
229 Ga0495668_0032848 3300046616 Bacteria 2918
230 Ga0495611_0477531 3300046648 Bacteria 567
231 Ga0495625_0309982 3300046660 Bacteria 1008
232 Ga0495625_0725465 3300046660 Bacteria 585
233 Ga0495635_0357903 3300046663 Bacteria 973
234 Ga0495588_0041732 3300046674 Bacteria 2344
235 Ga0495588_0056850 3300046674 Bacteria 2020
236 Ga0495658_0129415 3300046683 Bacteria 1535
237 Ga0495669_0668758 3300046684 Bacteria 505
238 Ga0495581_0213500 3300047315 Bacteria 1128
239 Ga0495581_0861088 3300047315 Bacteria 518
240 Ga0495604_0588736 3300047317 Bacteria 714
241 Ga0495604_0850644 3300047317 Bacteria 572
242 Ga0495636_0442466 3300047318 Bacteria 623
243 Ga0495674_0087622 3300047319 Bacteria 2664
244 Ga0495674_0835944 3300047319 Bacteria 714
245 Ga0495674_1165425 3300047319 Bacteria 584
246 Ga0495676_0007055 3300047321 Bacteria 10307
247 Ga0495680_0364245 3300047322 Bacteria 1004
248 Ga0495673_0094996 3300047469 Bacteria 1213
249 Ga0495684_0207287 3300047471 Bacteria 1443
250 Ga0496100_0269135 3300048903 Bacteria 1266
251 Ga0496101_0006978 3300048904 Bacteria 7292
252 Ga0496101_0673034 3300048904 Bacteria 817
253 Ga0496102_0082480 3300048905 Bacteria 2965
254 Ga0496102_1475834 3300048905 Bacteria 599
255 Ga0496104_1506753 3300048907 Bacteria 575
256 Ga0496105_1273341 3300048908 Bacteria 538
257 Ga0496108_0017553 3300048911 Bacteria 5856
258 Ga0496109_0015032 3300048912 Bacteria 6736
259 Ga0496109_0186199 3300048912 Bacteria 1950
260 Ga0496110_0022951 3300048913 Bacteria 5303
261 Ga0496111_0390708 3300048914 Bacteria 1028
262 Ga0496112_0004436 3300048915 Bacteria 11886
263 Ga0496112_0019737 3300048915 Bacteria 6371
264 Ga0496112_0163796 3300048915 Bacteria 2190
265 Ga0496112_1483070 3300048915 Bacteria 592
266 Ga0496113_0150345 3300048916 Bacteria 1836
267 Ga0496113_0172322 3300048916 Bacteria 1714
268 Ga0496114_0007466 3300048917 Bacteria 8643
269 Ga0496114_0423016 3300048917 Bacteria 1180
270 Ga0496115_0019724 3300048918 Bacteria 5192
271 Ga0496115_0175444 3300048918 Unclassified 1772
272 Ga0496115_0388390 3300048918 Bacteria 1134
273 Ga0496118_0557360 3300048921 Bacteria 557
274 Ga0496119_0318752 3300048922 Unclassified 762
275 Ga0496121_0010298 3300048924 Bacteria 10577
276 Ga0496121_0396593 3300048924 Bacteria 905
277 Ga0496121_0749975 3300048924 Bacteria 580
278 Ga0496122_0300868 3300048925 Bacteria 865
279 Ga0496124_0429026 3300048927 Bacteria 908
280 Ga0496126_0194090 3300048929 Bacteria 1718
281 Ga0496126_0844256 3300048929 Bacteria 699
282 Ga0501033_0620681 3300049570 Bacteria 740
283 Ga0501047_0019941 3300049581 Bacteria 6437
284 Ga0501069_0430361 3300049585 Bacteria 783
285 Ga0501070_0178835 3300049586 Bacteria 1746
286 Ga0501073_0128290 3300049589 Bacteria 1758
287 Ga0501074_0054846 3300049590 Bacteria 2874
288 Ga0501080_0030990 3300049742 Bacteria 4983
289 Ga0501044_0070228 3300049823 Bacteria 3563
290 nmdc:mga0yw44_143073_c1 3300050492 Bacteria 1555
291 nmdc:mga0yw44_369921_c1 3300050492 Bacteria 967
292 nmdc:mga0k408_721085_c1 3300050493 Bacteria 583
293 Ga0495595_0009502 3300053084 Bacteria 4025
294 Ga0495595_0622291 3300053084 Bacteria 552
295 Ga0495619_0006065 3300053085 Bacteria 7655
296 Ga0500595_027872 3300053119 Bacteria 1930
297 Ga0500614_274644 3300053123 Bacteria 527
298 Ga0500628_020695 3300053129 Bacteria 1326
299 Ga0500604_0239578 3300053151 Unclassified 627
300 Ga0500620_116242 3300053155 Bacteria 937
301 Ga0500638_192122 3300053162 Bacteria 871
302 Ga0500637_0162825 3300053178 Bacteria 1285
303 2513705377 2513237102 Bacteria 7703324
304 2528858125 2528768022 Bacteria 10457665
305 2793076798
306 2889040990 2889033259 Bacteria 9099371
307 2922392145 2922386360 Bacteria 7017218
308 8056680579 8056673599 Bacteria 7871253
309 Ga0070670_100243984
310 rootH2_10190462
311 JGI25404J52841_10055187
312 JGI25405J52794_10023518
313 JGI25405J52794_10108479
314 Ga0070658_10133073
315 Ga0070690_100223319
316 Ga0070677_10221221
317 Ga0070666_11114265
318 Ga0070680_100099699
319 Ga0070680_100284265
320 Ga0070682_100478133
321 Ga0070682_101090829
322 Ga0070682_101718644
323 Ga0068868_100288965
324 Ga0070660_100101858
325 Ga0070660_100843083
326 Ga0070675_100291726
327 Ga0070671_100681942
328 Ga0070674_100907063
329 Ga0070674_100915006
330 Ga0070709_11109728
331 Ga0070714_100206996
332 Ga0070713_101221067
333 Ga0070678_100385315
334 Ga0070681_10102750
335 Ga0068867_100567964
336 Ga0068867_100911703
337 Ga0068867_101555167
338 Ga0070698_100616700
339 Ga0070699_101872006
340 Ga0070679_100364287
341 Ga0070679_100436282
342 Ga0070684_100008559
343 Ga0070697_101971132
344 Ga0068853_100253513
345 Ga0068853_102304986
346 Ga0070696_100241020
347 Ga0070665_100348384
348 Ga0070665_102152529
349 Ga0068855_100173245
350 Ga0070664_101261833
351 Ga0068857_100444739
352 Ga0068857_101735144
353 Ga0068856_100254032
354 Ga0068856_100369833
355 Ga0068856_100922540
356 Ga0068856_101032146
357 Ga0068852_100249979
358 Ga0068852_100642425
359 Ga0068870_10423336
360 Ga0081455_10009514
361 Ga0081455_10014163
362 Ga0081455_10161212
363 Ga0081538_10023222
364 Ga0081540_1000438
365 Ga0081540_1000755
366 Ga0081540_1000834
367 Ga0081540_1001804
368 Ga0081540_1003765
369 Ga0081540_1019172
370 Ga0081540_1065987
371 Ga0070717_10004761
372 Ga0070717_10494367
373 Ga0070717_10521683
374 Ga0075365_10154550
375 Ga0075365_10440209
376 Ga0070715_11014410
377 Ga0070716_100923356
378 Ga0070716_101049886
379 Ga0070716_101472787
380 Ga0075366_10911592
381 Ga0097621_100546822
382 Ga0097621_100833959
383 Ga0068871_101986067
384 Ga0075428_102211225
385 Ga0068865_100643312
386 Ga0068865_101461507
387 Ga0099794_10000898
388 Ga0099794_10344346
389 Ga0099795_10409962
390 Ga0099795_10445310
391 Ga0105240_10128148
392 Ga0105247_10502130
393 Ga0105247_11474686
394 Ga0114129_11061823
395 Ga0105243_10137852
396 Ga0105243_12929610
397 Ga0105242_11905221
398 Ga0105248_12171450
399 Ga0105248_12626740
400 Ga0105237_10195637
401 Ga0105237_10294032
402 Ga0105238_10780308
403 Ga0105238_10966187
404 Ga0105238_11327964
405 Ga0099796_10188259
406 Ga0099796_10230026
407 Ga0105239_10083922
408 Ga0105239_12275449
409 Ga0105239_13037800
410 Ga0105246_10134072
411 Ga0105246_12527663
412 Ga0157374_11291910
413 Ga0157378_10024915
414 Ga0157378_11427983
415 Ga0157378_11575629
416 Ga0157372_10067552
417 Ga0157372_12485826
418 Ga0157375_10080427
419 Ga0157375_10566147
420 Ga0157375_11004815
421 Ga0163163_12603798
422 Ga0163163_12890309
423 Ga0157380_10924074
424 Ga0157380_12180765
425 Ga0157377_10130905
426 Ga0157376_10412102
427 Ga0163161_10651753
428 Ga0163161_11814621
429 Ga0213872_10174401
430 Ga0213876_10292585
431 Ga0213876_10313478
432 Ga0209677_100345
433 Ga0207697_10450341
434 Ga0207688_10329787
435 Ga0207680_10570712
436 Ga0207705_11348585
437 Ga0207684_11045489
438 Ga0207707_10404773
439 Ga0207707_10570663
440 Ga0207695_10891364
441 Ga0207671_10987322
442 Ga0207660_10127586
443 Ga0207660_10149637
444 Ga0207657_10227584
445 Ga0207652_10192607
446 Ga0207652_10714736
447 Ga0207694_11209767
448 Ga0207659_10076907
449 Ga0207659_11503253
450 Ga0207700_11420023
451 Ga0207664_10186975
452 Ga0207664_10656176
453 Ga0207690_10075540
454 Ga0207669_10250417
455 Ga0207669_10266245
456 Ga0207669_10391110
457 Ga0207704_11622629
458 Ga0207665_10193978
459 Ga0207665_10240739
460 Ga0207665_11479053
461 Ga0207691_10969540
462 Ga0207711_10795704
463 Ga0207661_10000231
464 Ga0207667_10363764
465 Ga0207651_11893599
466 Ga0207677_11913264
467 Ga0207639_10244570
468 Ga0207639_11612206
469 Ga0207702_10080224
470 Ga0207702_10552272
471 Ga0207702_11265462
472 Ga0207641_10411983
473 Ga0207683_10045593
474 Ga0207698_10273988
475 Ga0207698_11803843
476 Ga0268265_11248859
477 Ga0307517_10464570
478 Ga0307513_10719368
479 Ga0307509_10507791
480 Ga0307508_10204715
481 Ga0307516_10002704
482 Ga0307516_10014283
483 Ga0307412_12299853
484 Ga0307416_101363600
485 Ga0307510_10030150
486 Ga0373930_0177064
487 Ga0373950_0032870
488 Ga0373949_0042132
489 Ga0373957_0458752
490 Ga0373960_0020795
491 Ga0373943_0017632
492 Ga0373946_0149734
493 Ga0373962_0370561
494 Ga0373931_0002361
495 Ga0373931_0723727
496 Ga0373927_0011596
497 Ga0373927_0040305
498 Ga0373947_0046494
499 Ga0373947_0108611
500 Ga0373947_0599957
501 Ga0373937_0396853
502 Ga0373937_0678988
503 Ga0373925_0027201
504 Ga0373925_0268368
505 Ga0373925_0475454
506 Ga0395898_0178078
507 Ga0395905_0095310
508 Ga0395901_0216556
509 Ga0436365_0061103
510 Ga0436365_1452792
511 Ga0436360_0374920
512 Ga0436361_0061447
513 Ga0436361_0598638
514 Ga0436362_0817523
515 Ga0451847_0305399
516 Ga0466965_0410488
517 Ga0466964_0147409
518 Ga0466970_0291049
519 Ga0466957_0537819
520 Ga0466957_0612847
521 Ga0466958_0182531
522 Ga0495603_0908563
523 Ga0495590_0383245
524 Ga0495638_0046153
525 Ga0495580_0107654
526 Ga0495582_0136707
527 Ga0495582_0308388
528 Ga0495605_0199944
529 Ga0495639_0263407
530 Ga0495639_0426560
531 Ga0495664_0586451
532 Ga0495594_0658200
533 Ga0495630_0152284
534 Ga0495632_0138963
535 Ga0495654_0292119
536 Ga0495667_0325802
537 Ga0495668_0032848
538 Ga0495611_0477531
539 Ga0495625_0309982
540 Ga0495625_0725465
541 Ga0495635_0357903
542 Ga0495588_0041732
543 Ga0495588_0056850
544 Ga0495658_0129415
545 Ga0495669_0668758
546 Ga0495581_0213500
547 Ga0495581_0861088
548 Ga0495604_0588736
549 Ga0495604_0850644
550 Ga0495636_0442466
551 Ga0495674_0087622
552 Ga0495674_0835944
553 Ga0495674_1165425
554 Ga0495676_0007055
555 Ga0495680_0364245
556 Ga0495673_0094996
557 Ga0495684_0207287
558 Ga0496100_0269135
559 Ga0496101_0006978
560 Ga0496101_0673034
561 Ga0496102_0082480
562 Ga0496102_1475834
563 Ga0496104_1506753
564 Ga0496105_1273341
565 Ga0496108_0017553
566 Ga0496109_0015032
567 Ga0496109_0186199
568 Ga0496110_0022951
569 Ga0496111_0390708
570 Ga0496112_0004436
571 Ga0496112_0019737
572 Ga0496112_0163796
573 Ga0496112_1483070
574 Ga0496113_0150345
575 Ga0496113_0172322
576 Ga0496114_0007466
577 Ga0496114_0423016
578 Ga0496115_0019724
579 Ga0496115_0175444
580 Ga0496115_0388390
581 Ga0496118_0557360
582 Ga0496119_0318752
583 Ga0496121_0010298
584 Ga0496121_0396593
585 Ga0496121_0749975
586 Ga0496122_0300868
587 Ga0496124_0429026
588 Ga0496126_0194090
589 Ga0496126_0844256
590 Ga0501033_0620681
591 Ga0501047_0019941
592 Ga0501069_0430361
593 Ga0501070_0178835
594 Ga0501073_0128290
595 Ga0501074_0054846
596 Ga0501080_0030990
597 Ga0501044_0070228
598 nmdc:mga0yw44_143073_c1
599 nmdc:mga0yw44_369921_c1
600 nmdc:mga0k408_721085_c1
601 Ga0495595_0009502
602 Ga0495595_0622291
603 Ga0495619_0006065
604 Ga0500595_027872
605 Ga0500614_274644
606 Ga0500628_020695
607 Ga0500604_0239578
608 Ga0500620_116242
609 Ga0500638_192122
610 Ga0500637_0162825
611 2513705377
612 2528858125
613 2793076798
614 2889040990
615 2922392145
616 8056680579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ojl-assembly1.cif.gz_A-2 crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding 0.8227 9 37
1ojl-assembly2.cif.gz_D-3 crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding 0.8153 9 37
2dhy-assembly1.cif.gz_A solution structure of the cue domain in the human cue domain containing protein 1 (cuedc1) 0.758 19 41
8f53-assembly1.cif.gz_A top-down design of protein architectures with reinforcement learning 0.6995 12 47
2dah-assembly1.cif.gz_A solution structure of the c-terminal uba domain in the human ubiquilin 3 0.5868 8 40
ID Description Score Start End Superfamily
af_Q96EP0_529_589_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.8378 19 51 1.10.8.10
1ojlE03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.831 10 37 1.10.10.60
1ojlA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8227 9 37 1.10.10.60
1ojlD03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8153 9 37 1.10.10.60
2dhyA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.758 19 41 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A2S4VA91-F1-model_v4 Uncharacterized protein 0.7649 4 42
AF-I9N1L7-F1-model_v4 Uncharacterized protein 0.7414 1 62
AF-A0A1X7FK21-F1-model_v4 Dehydrogenase 0.7238 1 54
AF-A0A4T3FB73-F1-model_v4 deleted 0.6726 1 69
AF-A0A4T3FB73-F1-model_v4 deleted 0.6635 1 69

Map