F399101

General Info

Members Datasets Scaffolds Average Seq Length
307 180 614 148

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100226838|Ga0068864_1002268382
Length 163
Sequence MSVDVVTETVIARPRAEVAAYAADIDHTTAWYENIRSVAWETPPPLEVGSRIGFVAEFLGRRLTYTYEITELVPGERLVMRTAEGPFPMETTYTWADAGPGATRMTLRNRGEPAGFSRVAAPLMARSMRRANARDLARLKAILERADRGRRAADGLCYRSPIG

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.73
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 15.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100226838 3300005618 Bacteria 1726
2 JGI25407J50210_10137457 3300003373 Bacteria 602
3 Ga0070658_10073435 3300005327 Bacteria 2805
4 Ga0070658_10801752 3300005327 Unclassified 818
5 Ga0070683_100097505 3300005329 Bacteria 2765
6 Ga0070683_100120300 3300005329 Bacteria 2480
7 Ga0070680_100569607 3300005336 Bacteria 971
8 Ga0070680_101285668 3300005336 Bacteria 633
9 Ga0070682_100058680 3300005337 Bacteria 2428
10 Ga0070682_100065635 3300005337 Unclassified 2307
11 Ga0070660_100275352 3300005339 Bacteria 1376
12 Ga0070660_100451669 3300005339 Unclassified 1066
13 Ga0070692_10792878 3300005345 Unclassified 646
14 Ga0070668_101661250 3300005347 Unclassified 586
15 Ga0070674_100763011 3300005356 Bacteria 832
16 Ga0070688_100457520 3300005365 Unclassified 955
17 Ga0070709_10113937 3300005434 Bacteria 1821
18 Ga0070714_100154404 3300005435 Bacteria 2071
19 Ga0070714_101681375 3300005435 Unclassified 620
20 Ga0070710_10020659 3300005437 Bacteria 3420
21 Ga0070701_10545088 3300005438 Bacteria 760
22 Ga0070711_100205515 3300005439 Bacteria 1522
23 Ga0070700_100198185 3300005441 Bacteria 1409
24 Ga0070700_100225623 3300005441 Unclassified 1330
25 Ga0070708_100046185 3300005445 Bacteria 3842
26 Ga0070708_100070985 3300005445 Bacteria 3134
27 Ga0070708_100316491 3300005445 Unclassified 1470
28 Ga0070708_100830075 3300005445 Bacteria 869
29 Ga0070681_10291378 3300005458 Bacteria 1542
30 Ga0070685_10748751 3300005466 Bacteria 716
31 Ga0070706_100013745 3300005467 Bacteria 7484
32 Ga0070706_100145100 3300005467 Unclassified 2216
33 Ga0070706_100150381 3300005467 Unclassified 2173
34 Ga0070706_100167796 3300005467 Bacteria 2049
35 Ga0070707_100060620 3300005468 Bacteria 3628
36 Ga0070698_100049105 3300005471 Bacteria 4309
37 Ga0070698_100486423 3300005471 Unclassified 1171
38 Ga0070699_100004372 3300005518 Bacteria 12481
39 Ga0070699_100052442 3300005518 Bacteria 3529
40 Ga0070679_100980272 3300005530 Bacteria 789
41 Ga0070684_100145694 3300005535 Bacteria 2143
42 Ga0070697_100000002 3300005536 Bacteria 418511
43 Ga0070697_100004304 3300005536 Bacteria 10921
44 Ga0070697_100390187 3300005536 Unclassified 1207
45 Ga0070695_100439476 3300005545 Bacteria 997
46 Ga0070696_100255385 3300005546 Bacteria 1327
47 Ga0070665_100023666 3300005548 Bacteria 6184
48 Ga0070665_100446362 3300005548 Bacteria 1303
49 Ga0070664_100277901 3300005564 Bacteria 1510
50 Ga0070664_100387105 3300005564 Bacteria 1277
51 Ga0070664_100786941 3300005564 Bacteria 889
52 Ga0068857_100047167 3300005577 Bacteria 3824
53 Ga0068857_100293992 3300005577 Unclassified 1496
54 Ga0068852_101861340 3300005616 Unclassified 624
55 Ga0068858_101308319 3300005842 Bacteria 713
56 Ga0081538_10039921 3300005981 Bacteria 3002
57 Ga0081538_10075902 3300005981 Bacteria 1820
58 Ga0070717_10016400 3300006028 Bacteria 5743
59 Ga0070717_10204359 3300006028 Bacteria 1731
60 Ga0070717_10828328 3300006028 Unclassified 842
61 Ga0075432_10014297 3300006058 Bacteria 2703
62 Ga0070715_10589991 3300006163 Bacteria 650
63 Ga0070712_100222748 3300006175 Bacteria 1494
64 Ga0070712_100837947 3300006175 Bacteria 790
65 Ga0075428_100030427 3300006844 Bacteria 5971
66 Ga0075428_100137066 3300006844 Bacteria 2661
67 Ga0075428_101192222 3300006844 Bacteria 803
68 Ga0075430_100055910 3300006846 Bacteria 3318
69 Ga0075431_100004662 3300006847 Bacteria 13470
70 Ga0075431_100703760 3300006847 Bacteria 988
71 Ga0075431_100995240 3300006847 Bacteria 805
72 Ga0075433_10011080 3300006852 Bacteria 7252
73 Ga0075433_10271936 3300006852 Bacteria 1502
74 Ga0075433_10316349 3300006852 Bacteria 1381
75 Ga0075434_100000569 3300006871 Bacteria 28397
76 Ga0075429_100041523 3300006880 Bacteria 4006
77 Ga0075436_100500287 3300006914 Unclassified 889
78 Ga0111539_10087289 3300009094 Bacteria 3665
79 Ga0111539_10592277 3300009094 Bacteria 1291
80 Ga0111539_11929297 3300009094 Bacteria 685
81 Ga0105245_10085892 3300009098 Unclassified 2885
82 Ga0105245_10959274 3300009098 Bacteria 898
83 Ga0105245_10998252 3300009098 Bacteria 881
84 Ga0105245_11300488 3300009098 Bacteria 776
85 Ga0114129_10001891 3300009147 Bacteria 28562
86 Ga0114129_10007691 3300009147 Bacteria 15337
87 Ga0114129_10113958 3300009147 Bacteria 3728
88 Ga0114129_11315181 3300009147 Bacteria 895
89 Ga0114129_11419579 3300009147 Bacteria 856
90 Ga0105243_10589561 3300009148 Unclassified 1068
91 Ga0105239_10658679 3300010375 Bacteria 1196
92 Ga0105246_10005797 3300011119 Bacteria 7532
93 Ga0105246_10065813 3300011119 Bacteria 2535
94 Ga0157370_10521640 3300013104 Bacteria 1090
95 Ga0157372_10249649 3300013307 Bacteria 2059
96 Ga0157372_11488922 3300013307 Bacteria 780
97 Ga0157380_10259173 3300014326 Bacteria 1578
98 Ga0182008_10878179 3300014497 Bacteria 526
99 Ga0157376_10187834 3300014969 Bacteria 1893
100 Ga0157376_12157468 3300014969 Unclassified 596
101 Ga0206353_10606826 3300020082 Bacteria 1012
102 Ga0207692_10040145 3300025898 Bacteria 2308
103 Ga0207688_10681522 3300025901 Bacteria 650
104 Ga0207699_10394948 3300025906 Bacteria 984
105 Ga0207699_10621550 3300025906 Bacteria 788
106 Ga0207705_10134327 3300025909 Bacteria 1843
107 Ga0207684_10040875 3300025910 Bacteria 3931
108 Ga0207684_10072067 3300025910 Bacteria 2935
109 Ga0207684_10152514 3300025910 Unclassified 1988
110 Ga0207684_10520794 3300025910 Bacteria 1018
111 Ga0207707_10403440 3300025912 Bacteria 1173
112 Ga0207693_10030073 3300025915 Bacteria 4288
113 Ga0207663_10353451 3300025916 Bacteria 1113
114 Ga0207660_10370646 3300025917 Bacteria 1150
115 Ga0207660_11146836 3300025917 Bacteria 633
116 Ga0207657_10080651 3300025919 Bacteria 2735
117 Ga0207652_10075390 3300025921 Bacteria 2940
118 Ga0207646_10034876 3300025922 Bacteria 4548
119 Ga0207646_10079268 3300025922 Bacteria 2936
120 Ga0207659_11715392 3300025926 Unclassified 535
121 Ga0207687_10178690 3300025927 Unclassified 1643
122 Ga0207664_10383903 3300025929 Bacteria 1247
123 Ga0207664_11127929 3300025929 Bacteria 701
124 Ga0207686_11030583 3300025934 Bacteria 669
125 Ga0207709_10351057 3300025935 Unclassified 1113
126 Ga0207709_10437229 3300025935 Bacteria 1008
127 Ga0207661_10146405 3300025944 Bacteria 2038
128 Ga0207661_10620363 3300025944 Unclassified 993
129 Ga0207679_10681256 3300025945 Bacteria 932
130 Ga0207679_10836462 3300025945 Bacteria 840
131 Ga0207668_11002990 3300025972 Bacteria 746
132 Ga0207703_11347649 3300026035 Bacteria 686
133 Ga0207708_10021122 3300026075 Bacteria 4910
134 Ga0207708_11110899 3300026075 Bacteria 689
135 Ga0207676_10049427 3300026095 Bacteria 3272
136 Ga0207676_10903970 3300026095 Unclassified 866
137 Ga0207674_10021637 3300026116 Bacteria 6924
138 Ga0207674_11365512 3300026116 Unclassified 678
139 Ga0207675_100201368 3300026118 Bacteria 1912
140 Ga0207675_100384868 3300026118 Bacteria 1380
141 Ga0207698_10265969 3300026142 Unclassified 1578
142 Ga0207428_10136883 3300027907 Bacteria 1872
143 Ga0268266_10010939 3300028379 Bacteria 7898
144 Ga0307513_10274711 3300031456 Bacteria 1466
145 Ga0307513_11026984 3300031456 Unclassified 535
146 Ga0307405_10080658 3300031731 Bacteria 2125
147 Ga0307405_10355007 3300031731 Bacteria 1132
148 Ga0307405_10638688 3300031731 Bacteria 874
149 Ga0307410_10102556 3300031852 Unclassified 2053
150 Ga0307406_10227804 3300031901 Bacteria 1390
151 Ga0307406_10347385 3300031901 Bacteria 1158
152 Ga0307407_10437582 3300031903 Bacteria 946
153 Ga0307412_10076473 3300031911 Bacteria 2300
154 Ga0307409_100004714 3300031995 Bacteria 7720
155 Ga0307409_100081832 3300031995 Bacteria 2612
156 Ga0307409_100752898 3300031995 Bacteria 978
157 Ga0307416_100005533 3300032002 Bacteria 7770
158 Ga0307416_100286984 3300032002 Bacteria 1627
159 Ga0307416_100435902 3300032002 Bacteria 1359
160 Ga0307416_100990086 3300032002 Bacteria 943
161 Ga0307416_102949135 3300032002 Unclassified 569
162 Ga0307414_11119325 3300032004 Bacteria 727
163 Ga0307411_10111554 3300032005 Bacteria 1958
164 Ga0307415_100001390 3300032126 Bacteria 11555
165 Ga0307415_100039797 3300032126 Bacteria 3110
166 Ga0307415_100742109 3300032126 Bacteria 890
167 Ga0373926_0055230 3300035083 Bacteria 1439
168 Ga0373945_0413646 3300035116 Unclassified 592
169 Ga0373943_0015384 3300035170 Bacteria 3474
170 Ga0373946_0004398 3300035171 Bacteria 5046
171 Ga0373961_0342571 3300035241 Bacteria 562
172 Ga0373962_0102077 3300035242 Bacteria 896
173 Ga0373924_0014986 3300035410 Bacteria 2938
174 Ga0373935_0070567 3300035692 Bacteria 2252
175 Ga0373927_0019692 3300035695 Bacteria 4425
176 Ga0373947_0016807 3300035725 Bacteria 4203
177 Ga0373925_0006338 3300037068 Bacteria 8713
178 Ga0373925_0616982 3300037068 Bacteria 893
179 Ga0395899_0012561 3300037312 Bacteria 6492
180 Ga0395899_0095045 3300037312 Bacteria 2156
181 Ga0395899_0621723 3300037312 Unclassified 686
182 Ga0395900_0015572 3300037418 Bacteria 7752
183 Ga0395900_0023052 3300037418 Bacteria 6370
184 Ga0395900_0256142 3300037418 Bacteria 1749
185 Ga0395900_1389815 3300037418 Bacteria 615
186 Ga0395898_0030396 3300037466 Bacteria 5405
187 Ga0395898_0251234 3300037466 Bacteria 1686
188 Ga0395905_0003639 3300037471 Bacteria 16380
189 Ga0395905_0043492 3300037471 Bacteria 4214
190 Ga0395905_0279699 3300037471 Bacteria 1555
191 Ga0395905_0341055 3300037471 Bacteria 1390
192 Ga0395901_0009398 3300038443 Bacteria 9918
193 Ga0395901_0015028 3300038443 Bacteria 7871
194 Ga0395901_0019764 3300038443 Bacteria 6887
195 Ga0395901_0186259 3300038443 Bacteria 2177
196 Ga0395901_0334230 3300038443 Bacteria 1566
197 Ga0242420_054592 3300038996 Bacteria 787
198 Ga0466963_0007298 3300044694 Bacteria 6591
199 Ga0466963_0208222 3300044694 Bacteria 1368
200 Ga0466964_0029301 3300044706 Bacteria 2172
201 Ga0466970_0265117 3300044765 Bacteria 964
202 Ga0466959_1108799 3300045049 Bacteria 526
203 Ga0466958_0011581 3300045836 Bacteria 4970
204 Ga0466958_0316945 3300045836 Unclassified 1002
205 Ga0466967_0183314 3300045976 Bacteria 1975
206 Ga0466967_0406487 3300045976 Bacteria 1325
207 Ga0466967_0914603 3300045976 Bacteria 873
208 Ga0495582_0068181 3300046473 Bacteria 1966
209 Ga0495582_0904816 3300046473 Bacteria 510
210 Ga0495620_0120148 3300046515 Bacteria 1036
211 Ga0495630_0213922 3300046517 Bacteria 1471
212 Ga0495665_0506126 3300046531 Unclassified 608
213 Ga0495588_0242253 3300046674 Bacteria 951
214 Ga0495647_0363646 3300046681 Bacteria 660
215 Ga0495658_0058451 3300046683 Bacteria 2206
216 Ga0495658_0078213 3300046683 Bacteria 1936
217 Ga0495624_0047610 3300046690 Bacteria 2724
218 Ga0495624_0089239 3300046690 Bacteria 1903
219 Ga0495581_0222000 3300047315 Bacteria 1105
220 Ga0495674_0550496 3300047319 Bacteria 918
221 Ga0495676_0084365 3300047321 Bacteria 2397
222 Ga0496100_0031852 3300048903 Bacteria 3282
223 Ga0496100_0829693 3300048903 Bacteria 725
224 Ga0496100_0837309 3300048903 Bacteria 721
225 Ga0496101_0045219 3300048904 Bacteria 3153
226 Ga0496101_0630916 3300048904 Bacteria 847
227 Ga0496101_0914004 3300048904 Bacteria 691
228 Ga0496102_0012980 3300048905 Bacteria 7215
229 Ga0496102_0100388 3300048905 Bacteria 2688
230 Ga0496102_0179635 3300048905 Bacteria 1994
231 Ga0496102_0319952 3300048905 Bacteria 1461
232 Ga0496102_0948709 3300048905 Unclassified 781
233 Ga0496103_0119866 3300048906 Unclassified 1675
234 Ga0496104_1076621 3300048907 Unclassified 708
235 Ga0496105_0714515 3300048908 Bacteria 768
236 Ga0496106_0001913 3300048909 Bacteria 15606
237 Ga0496106_0186100 3300048909 Bacteria 1650
238 Ga0496106_0237680 3300048909 Unclassified 1455
239 Ga0496106_0503733 3300048909 Bacteria 973
240 Ga0496106_1196665 3300048909 Bacteria 593
241 Ga0496107_0014063 3300048910 Bacteria 5602
242 Ga0496107_0024204 3300048910 Bacteria 4295
243 Ga0496107_0166136 3300048910 Bacteria 1636
244 Ga0496107_0354045 3300048910 Bacteria 1092
245 Ga0496107_0631551 3300048910 Bacteria 790
246 Ga0496108_0240260 3300048911 Unclassified 1575
247 Ga0496109_0036940 3300048912 Bacteria 4411
248 Ga0496109_0250249 3300048912 Bacteria 1669
249 Ga0496109_0449526 3300048912 Bacteria 1217
250 Ga0496110_0166266 3300048913 Unclassified 2000
251 Ga0496110_0988216 3300048913 Bacteria 749
252 Ga0496111_0088047 3300048914 Unclassified 2273
253 Ga0496111_0839310 3300048914 Bacteria 664
254 Ga0496112_0003198 3300048915 Bacteria 13478
255 Ga0496113_0307235 3300048916 Bacteria 1270
256 Ga0496113_0961083 3300048916 Unclassified 674
257 Ga0496114_0399432 3300048917 Bacteria 1217
258 Ga0496126_0145938 3300048929 Bacteria 2032
259 Ga0501032_0034490 3300049569 Bacteria 3464
260 Ga0501033_0084903 3300049570 Bacteria 2320
261 Ga0501036_0042829 3300049572 Bacteria 3833
262 Ga0501039_0006952 3300049575 Bacteria 8612
263 Ga0501040_0239623 3300049576 Bacteria 1293
264 Ga0501041_0002218 3300049577 Bacteria 10978
265 Ga0501042_0059255 3300049578 Bacteria 2734
266 Ga0501046_0090445 3300049580 Bacteria 2355
267 Ga0501048_0144134 3300049582 Bacteria 1685
268 Ga0501067_0041792 3300049583 Unclassified 2546
269 Ga0501067_0044461 3300049583 Bacteria 2467
270 Ga0501067_0552608 3300049583 Bacteria 645
271 Ga0501068_0000226 3300049584 Bacteria 27345
272 Ga0501068_0077703 3300049584 Unclassified 2033
273 Ga0501069_0007648 3300049585 Bacteria 5667
274 Ga0501069_0513229 3300049585 Unclassified 716
275 Ga0501071_0072202 3300049587 Bacteria 2517
276 Ga0501072_0046627 3300049588 Bacteria 3411
277 Ga0501072_0307745 3300049588 Bacteria 1260
278 Ga0501072_1250023 3300049588 Bacteria 576
279 Ga0501075_0012548 3300049591 Bacteria 6026
280 Ga0501076_0005010 3300049592 Bacteria 9480
281 Ga0501077_0002031 3300049593 Bacteria 12215
282 Ga0501209_191493 3300049656 Bacteria 627
283 Ga0501079_0032958 3300049741 Bacteria 3984
284 Ga0501081_0012422 3300049743 Bacteria 5596
285 Ga0501045_0004787 3300049824 Bacteria 9353
286 Ga0501045_0327587 3300049824 Bacteria 1140
287 nmdc:mga05p37_465379_c2 3300050507 Bacteria 1159
288 nmdc:mga05p37_7081_c1 3300050507 Bacteria 13224
289 nmdc:mga09592_383801_c1 3300050508 Bacteria 1215
290 nmdc:mga09592_70029_c1 3300050508 Bacteria 2976
291 nmdc:mga09592_870240_c1 3300050508 Bacteria 759
292 nmdc:mga0qj67_106158_c1 3300050509 Bacteria 1265
293 nmdc:mga0qj67_12903_c1 3300050509 Bacteria 6304
294 nmdc:mga06r32_314405_c1 3300050510 Bacteria 1552
295 nmdc:mga06r32_412783_c1 3300050510 Bacteria 1332
296 nmdc:mga08y16_262009_c1 3300050511 Bacteria 1785
297 nmdc:mga0n895_1449156_c1 3300050512 Bacteria 654
298 nmdc:mga0n895_431_c1 3300050512 Bacteria 28183
299 nmdc:mga0rr50_170183_c1 3300050513 Bacteria 1775
300 nmdc:mga0rr50_170790_c1 3300050513 Bacteria 1772
301 nmdc:mga08x19_413485_c1 3300050514 Unclassified 947
302 nmdc:mga0a205_130109_c1 3300050515 Bacteria 2418
303 nmdc:mga0a205_625180_c1 3300050515 Bacteria 929
304 Ga0501082_0019713 3300060353 Bacteria 5815
305 Ga0466962_0084353 3300061719 Bacteria 1520
306 Ga0530510_0005274 3300061734 Bacteria 8926
307 Ga0530510_0051566 3300061734 Bacteria 2973
308 Ga0068864_100226838
309 JGI25407J50210_10137457
310 Ga0070658_10073435
311 Ga0070658_10801752
312 Ga0070683_100097505
313 Ga0070683_100120300
314 Ga0070680_100569607
315 Ga0070680_101285668
316 Ga0070682_100058680
317 Ga0070682_100065635
318 Ga0070660_100275352
319 Ga0070660_100451669
320 Ga0070692_10792878
321 Ga0070668_101661250
322 Ga0070674_100763011
323 Ga0070688_100457520
324 Ga0070709_10113937
325 Ga0070714_100154404
326 Ga0070714_101681375
327 Ga0070710_10020659
328 Ga0070701_10545088
329 Ga0070711_100205515
330 Ga0070700_100198185
331 Ga0070700_100225623
332 Ga0070708_100046185
333 Ga0070708_100070985
334 Ga0070708_100316491
335 Ga0070708_100830075
336 Ga0070681_10291378
337 Ga0070685_10748751
338 Ga0070706_100013745
339 Ga0070706_100145100
340 Ga0070706_100150381
341 Ga0070706_100167796
342 Ga0070707_100060620
343 Ga0070698_100049105
344 Ga0070698_100486423
345 Ga0070699_100004372
346 Ga0070699_100052442
347 Ga0070679_100980272
348 Ga0070684_100145694
349 Ga0070697_100000002
350 Ga0070697_100004304
351 Ga0070697_100390187
352 Ga0070695_100439476
353 Ga0070696_100255385
354 Ga0070665_100023666
355 Ga0070665_100446362
356 Ga0070664_100277901
357 Ga0070664_100387105
358 Ga0070664_100786941
359 Ga0068857_100047167
360 Ga0068857_100293992
361 Ga0068852_101861340
362 Ga0068858_101308319
363 Ga0081538_10039921
364 Ga0081538_10075902
365 Ga0070717_10016400
366 Ga0070717_10204359
367 Ga0070717_10828328
368 Ga0075432_10014297
369 Ga0070715_10589991
370 Ga0070712_100222748
371 Ga0070712_100837947
372 Ga0075428_100030427
373 Ga0075428_100137066
374 Ga0075428_101192222
375 Ga0075430_100055910
376 Ga0075431_100004662
377 Ga0075431_100703760
378 Ga0075431_100995240
379 Ga0075433_10011080
380 Ga0075433_10271936
381 Ga0075433_10316349
382 Ga0075434_100000569
383 Ga0075429_100041523
384 Ga0075436_100500287
385 Ga0111539_10087289
386 Ga0111539_10592277
387 Ga0111539_11929297
388 Ga0105245_10085892
389 Ga0105245_10959274
390 Ga0105245_10998252
391 Ga0105245_11300488
392 Ga0114129_10001891
393 Ga0114129_10007691
394 Ga0114129_10113958
395 Ga0114129_11315181
396 Ga0114129_11419579
397 Ga0105243_10589561
398 Ga0105239_10658679
399 Ga0105246_10005797
400 Ga0105246_10065813
401 Ga0157370_10521640
402 Ga0157372_10249649
403 Ga0157372_11488922
404 Ga0157380_10259173
405 Ga0182008_10878179
406 Ga0157376_10187834
407 Ga0157376_12157468
408 Ga0206353_10606826
409 Ga0207692_10040145
410 Ga0207688_10681522
411 Ga0207699_10394948
412 Ga0207699_10621550
413 Ga0207705_10134327
414 Ga0207684_10040875
415 Ga0207684_10072067
416 Ga0207684_10152514
417 Ga0207684_10520794
418 Ga0207707_10403440
419 Ga0207693_10030073
420 Ga0207663_10353451
421 Ga0207660_10370646
422 Ga0207660_11146836
423 Ga0207657_10080651
424 Ga0207652_10075390
425 Ga0207646_10034876
426 Ga0207646_10079268
427 Ga0207659_11715392
428 Ga0207687_10178690
429 Ga0207664_10383903
430 Ga0207664_11127929
431 Ga0207686_11030583
432 Ga0207709_10351057
433 Ga0207709_10437229
434 Ga0207661_10146405
435 Ga0207661_10620363
436 Ga0207679_10681256
437 Ga0207679_10836462
438 Ga0207668_11002990
439 Ga0207703_11347649
440 Ga0207708_10021122
441 Ga0207708_11110899
442 Ga0207676_10049427
443 Ga0207676_10903970
444 Ga0207674_10021637
445 Ga0207674_11365512
446 Ga0207675_100201368
447 Ga0207675_100384868
448 Ga0207698_10265969
449 Ga0207428_10136883
450 Ga0268266_10010939
451 Ga0307513_10274711
452 Ga0307513_11026984
453 Ga0307405_10080658
454 Ga0307405_10355007
455 Ga0307405_10638688
456 Ga0307410_10102556
457 Ga0307406_10227804
458 Ga0307406_10347385
459 Ga0307407_10437582
460 Ga0307412_10076473
461 Ga0307409_100004714
462 Ga0307409_100081832
463 Ga0307409_100752898
464 Ga0307416_100005533
465 Ga0307416_100286984
466 Ga0307416_100435902
467 Ga0307416_100990086
468 Ga0307416_102949135
469 Ga0307414_11119325
470 Ga0307411_10111554
471 Ga0307415_100001390
472 Ga0307415_100039797
473 Ga0307415_100742109
474 Ga0373926_0055230
475 Ga0373945_0413646
476 Ga0373943_0015384
477 Ga0373946_0004398
478 Ga0373961_0342571
479 Ga0373962_0102077
480 Ga0373924_0014986
481 Ga0373935_0070567
482 Ga0373927_0019692
483 Ga0373947_0016807
484 Ga0373925_0006338
485 Ga0373925_0616982
486 Ga0395899_0012561
487 Ga0395899_0095045
488 Ga0395899_0621723
489 Ga0395900_0015572
490 Ga0395900_0023052
491 Ga0395900_0256142
492 Ga0395900_1389815
493 Ga0395898_0030396
494 Ga0395898_0251234
495 Ga0395905_0003639
496 Ga0395905_0043492
497 Ga0395905_0279699
498 Ga0395905_0341055
499 Ga0395901_0009398
500 Ga0395901_0015028
501 Ga0395901_0019764
502 Ga0395901_0186259
503 Ga0395901_0334230
504 Ga0242420_054592
505 Ga0466963_0007298
506 Ga0466963_0208222
507 Ga0466964_0029301
508 Ga0466970_0265117
509 Ga0466959_1108799
510 Ga0466958_0011581
511 Ga0466958_0316945
512 Ga0466967_0183314
513 Ga0466967_0406487
514 Ga0466967_0914603
515 Ga0495582_0068181
516 Ga0495582_0904816
517 Ga0495620_0120148
518 Ga0495630_0213922
519 Ga0495665_0506126
520 Ga0495588_0242253
521 Ga0495647_0363646
522 Ga0495658_0058451
523 Ga0495658_0078213
524 Ga0495624_0047610
525 Ga0495624_0089239
526 Ga0495581_0222000
527 Ga0495674_0550496
528 Ga0495676_0084365
529 Ga0496100_0031852
530 Ga0496100_0829693
531 Ga0496100_0837309
532 Ga0496101_0045219
533 Ga0496101_0630916
534 Ga0496101_0914004
535 Ga0496102_0012980
536 Ga0496102_0100388
537 Ga0496102_0179635
538 Ga0496102_0319952
539 Ga0496102_0948709
540 Ga0496103_0119866
541 Ga0496104_1076621
542 Ga0496105_0714515
543 Ga0496106_0001913
544 Ga0496106_0186100
545 Ga0496106_0237680
546 Ga0496106_0503733
547 Ga0496106_1196665
548 Ga0496107_0014063
549 Ga0496107_0024204
550 Ga0496107_0166136
551 Ga0496107_0354045
552 Ga0496107_0631551
553 Ga0496108_0240260
554 Ga0496109_0036940
555 Ga0496109_0250249
556 Ga0496109_0449526
557 Ga0496110_0166266
558 Ga0496110_0988216
559 Ga0496111_0088047
560 Ga0496111_0839310
561 Ga0496112_0003198
562 Ga0496113_0307235
563 Ga0496113_0961083
564 Ga0496114_0399432
565 Ga0496126_0145938
566 Ga0501032_0034490
567 Ga0501033_0084903
568 Ga0501036_0042829
569 Ga0501039_0006952
570 Ga0501040_0239623
571 Ga0501041_0002218
572 Ga0501042_0059255
573 Ga0501046_0090445
574 Ga0501048_0144134
575 Ga0501067_0041792
576 Ga0501067_0044461
577 Ga0501067_0552608
578 Ga0501068_0000226
579 Ga0501068_0077703
580 Ga0501069_0007648
581 Ga0501069_0513229
582 Ga0501071_0072202
583 Ga0501072_0046627
584 Ga0501072_0307745
585 Ga0501072_1250023
586 Ga0501075_0012548
587 Ga0501076_0005010
588 Ga0501077_0002031
589 Ga0501209_191493
590 Ga0501079_0032958
591 Ga0501081_0012422
592 Ga0501045_0004787
593 Ga0501045_0327587
594 nmdc:mga05p37_465379_c2
595 nmdc:mga05p37_7081_c1
596 nmdc:mga09592_383801_c1
597 nmdc:mga09592_70029_c1
598 nmdc:mga09592_870240_c1
599 nmdc:mga0qj67_106158_c1
600 nmdc:mga0qj67_12903_c1
601 nmdc:mga06r32_314405_c1
602 nmdc:mga06r32_412783_c1
603 nmdc:mga08y16_262009_c1
604 nmdc:mga0n895_1449156_c1
605 nmdc:mga0n895_431_c1
606 nmdc:mga0rr50_170183_c1
607 nmdc:mga0rr50_170790_c1
608 nmdc:mga08x19_413485_c1
609 nmdc:mga0a205_130109_c1
610 nmdc:mga0a205_625180_c1
611 Ga0501082_0019713
612 Ga0466962_0084353
613 Ga0530510_0005274
614 Ga0530510_0051566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

2

144

0.88

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

144

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8685 4 145
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8616 4 141
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.8549 2 141
2rez-assembly1.cif.gz_A tetracenomycin aro/cyc nai structure 0.8545 1 147
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8444 1 148
ID Description Score Start End Superfamily
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8802 4 148 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8789 2 139 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.865 4 142 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8633 5 141 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8588 4 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0Q5NSP1-F1-model_v4 ATPase 0.9882 3 148
AF-A0A4P5W861-F1-model_v4 ATPase 0.981 2 144
AF-A0A5S5CB35-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9782 3 146
AF-A0A5A9DVG9-F1-model_v4 ATPase 0.9762 3 144
AF-A0A1C4XGT0-F1-model_v4 Uncharacterized membrane protein 0.9733 2 149

Map