F398751

General Info

Members Datasets Scaffolds Average Seq Length
306 223 608 169

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10090919|Ga0307414_100909191
Length 184
Sequence MQPYVGEIAIFAGTFPPVGWEFCNGQSMPISENEVLFQLIGTTYGGDGEETFNLPNLQSRVPIHMGTGPDGTTYQIGEMAGTEQETLTVQQIPSHSHAAAGKITVPVRGDSPVHLASPANASIAVSPGKKFFSKTGSATGTMAPLDMLGAVTSPTGGSQPHENMMPFLAVNYIISMFGIFPSQT

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
153 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
211 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
212 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
213 2643221583 Caulobacter sp. Root655 Isolate Unclassified
214 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
215 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
216 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
217 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
218 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
219 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
220 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
221 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
222 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
223 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.72
Metatranscriptomes 14.71
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.97
Nodule 1.96
Rhizoplane 0.65
Rhizosphere 73.86
Stem 0
Stem Tuber 0
Unclassified 6.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10090919 3300032004 Bacteria 2267
2 Ga0055536_1003626 3300003781 Bacteria 8234
3 Ga0065165_1000123 3300005262 Bacteria 130852
4 Ga0065704_10344379 3300005289 Bacteria 815
5 Ga0065704_10473283 3300005289 Bacteria 683
6 Ga0065712_10251782 3300005290 Bacteria 940
7 Ga0065715_10008980 3300005293 Unclassified 3973
8 Ga0065707_10083232 3300005295 Bacteria 9903
9 Ga0065707_10110068 3300005295 Bacteria 2445
10 Ga0070670_100033105 3300005331 Bacteria 4453
11 Ga0070670_100062685 3300005331 Bacteria 3191
12 Ga0070670_101479759 3300005331 Bacteria 623
13 Ga0068869_100237257 3300005334 Bacteria 1451
14 Ga0068869_100268972 3300005334 Bacteria 1367
15 Ga0070682_100122797 3300005337 Bacteria 1746
16 Ga0068868_100422556 3300005338 Viruses 1154
17 Ga0070689_100420020 3300005340 Bacteria 1133
18 Ga0070692_10312137 3300005345 Viruses 964
19 Ga0070671_100039938 3300005355 Bacteria 3896
20 Ga0070671_100424176 3300005355 Bacteria 1139
21 Ga0070673_100002818 3300005364 Bacteria 10691
22 Ga0070688_100180342 3300005365 Bacteria 1464
23 Ga0070688_100186213 3300005365 Bacteria 1443
24 Ga0070659_100201050 3300005366 Bacteria 1640
25 Ga0070703_10000271 3300005406 Bacteria 24602
26 Ga0070701_10363518 3300005438 Unclassified 907
27 Ga0070700_100018111 3300005441 Bacteria 4043
28 Ga0070678_100250593 3300005456 Viruses 1485
29 Ga0068867_100123706 3300005459 Viruses 2002
30 Ga0070685_10001840 3300005466 Bacteria 11058
31 Ga0070699_100352245 3300005518 Viruses 1326
32 Ga0070684_100947385 3300005535 Bacteria 807
33 Ga0068853_100931014 3300005539 Unclassified 835
34 Ga0070696_100474410 3300005546 Bacteria 991
35 Ga0070693_100413267 3300005547 Bacteria 938
36 Ga0070665_100000145 3300005548 Bacteria 131599
37 Ga0070704_100718848 3300005549 Unclassified 887
38 Ga0068857_100945560 3300005577 Viruses 828
39 Ga0068856_100006432 3300005614 Bacteria 11528
40 Ga0070702_100113217 3300005615 Bacteria 1686
41 Ga0068852_100717870 3300005616 Viruses 1010
42 Ga0068859_100002668 3300005617 Bacteria 18112
43 Ga0068859_100009955 3300005617 Bacteria 9589
44 Ga0068861_101424976 3300005719 Unclassified 677
45 Ga0068870_10225551 3300005840 Bacteria 1149
46 Ga0068858_101140873 3300005842 Bacteria 766
47 Ga0068862_100018222 3300005844 Bacteria 5845
48 Ga0081455_10610000 3300005937 Bacteria 710
49 Ga0075365_10007613 3300006038 Bacteria 6083
50 Ga0075365_10029151 3300006038 Bacteria 3525
51 Ga0075365_10057146 3300006038 Bacteria 2596
52 Ga0075365_10057467 3300006038 Bacteria 2588
53 Ga0075365_10108701 3300006038 Bacteria 1904
54 Ga0075365_10452945 3300006038 Bacteria 906
55 Ga0075365_10569063 3300006038 Bacteria 801
56 Ga0075368_10001020 3300006042 Bacteria 8755
57 Ga0075363_100014159 3300006048 Bacteria 3888
58 Ga0075363_100166969 3300006048 Bacteria 1248
59 Ga0075364_10014475 3300006051 Bacteria 4875
60 Ga0075364_10042120 3300006051 Bacteria 2967
61 Ga0075364_10303973 3300006051 Bacteria 1086
62 Ga0075362_10018234 3300006177 Bacteria 2901
63 Ga0075362_10044489 3300006177 Bacteria 1969
64 Ga0075367_10075121 3300006178 Bacteria 2038
65 Ga0075366_10065928 3300006195 Bacteria 2154
66 Ga0097621_100460595 3300006237 Bacteria 1147
67 Ga0075370_10003694 3300006353 Bacteria 7328
68 Ga0068871_101095762 3300006358 Bacteria 744
69 Ga0075428_100039304 3300006844 Bacteria 5206
70 Ga0075428_100751304 3300006844 Bacteria 1038
71 Ga0075428_101696203 3300006844 Unclassified 659
72 Ga0075433_10594510 3300006852 Bacteria 972
73 Ga0075429_100058501 3300006880 Bacteria 3357
74 Ga0097620_100002668 3300006931 Bacteria 18112
75 Ga0097620_100009955 3300006931 Bacteria 9589
76 Ga0105240_10052562 3300009093 Bacteria 5120
77 Ga0105240_10996501 3300009093 Bacteria 896
78 Ga0111539_10010768 3300009094 Bacteria 11513
79 Ga0111539_10093138 3300009094 Bacteria 3540
80 Ga0111539_10487670 3300009094 Bacteria 1435
81 Ga0114129_10001359 3300009147 Bacteria 32863
82 Ga0114129_11398574 3300009147 Bacteria 863
83 Ga0105243_11006344 3300009148 Viruses 836
84 Ga0105241_10211308 3300009174 Unclassified 1626
85 Ga0105242_10000271 3300009176 Bacteria 41189
86 Ga0105242_10051582 3300009176 Bacteria 3353
87 Ga0105242_11086010 3300009176 Bacteria 813
88 Ga0105248_10229449 3300009177 Bacteria 2090
89 Ga0105239_10828379 3300010375 Bacteria 1061
90 Ga0105239_10914646 3300010375 Bacteria 1007
91 Ga0105246_10231769 3300011119 Bacteria 1455
92 Ga0105246_10294117 3300011119 Bacteria 1308
93 Ga0157374_10210400 3300013296 Bacteria 1907
94 Ga0163162_10027811 3300013306 Bacteria 5594
95 Ga0163162_10261780 3300013306 Unclassified 1861
96 Ga0163162_10826254 3300013306 Bacteria 1043
97 Ga0157372_10108478 3300013307 Bacteria 3177
98 Ga0157372_11591795 3300013307 Bacteria 752
99 Ga0157375_10214777 3300013308 Viruses 2081
100 Ga0157375_11324266 3300013308 Bacteria 847
101 Ga0163163_10581898 3300014325 Bacteria 1183
102 Ga0213876_10176026 3300021384 Bacteria 1138
103 Ga0213875_10022046 3300021388 Bacteria 3048
104 Ga0209676_1000555 3300025292 Bacteria 56867
105 Ga0207653_10000026 3300025885 Bacteria 114420
106 Ga0207705_10872219 3300025909 Bacteria 698
107 Ga0207654_10528159 3300025911 Unclassified 836
108 Ga0207686_10000285 3300025934 Bacteria 37479
109 Ga0207686_10040765 3300025934 Bacteria 2826
110 Ga0207686_10682666 3300025934 Bacteria 815
111 Ga0207709_10001808 3300025935 Bacteria 14284
112 Ga0207670_10368725 3300025936 Bacteria 1141
113 Ga0207689_10434810 3300025942 Bacteria 1096
114 Ga0207651_10002277 3300025960 Bacteria 9125
115 Ga0207677_11069743 3300026023 Bacteria 734
116 Ga0207639_10818977 3300026041 Unclassified 868
117 Ga0207708_10051610 3300026075 Bacteria 3132
118 Ga0207702_10008531 3300026078 Bacteria 8638
119 Ga0207641_10961551 3300026088 Viruses 850
120 Ga0207683_10453641 3300026121 Viruses 1182
121 Ga0207698_10684982 3300026142 Viruses 1019
122 Ga0209813_10002212 3300027866 Bacteria 4439
123 Ga0207428_10002898 3300027907 Bacteria 17004
124 Ga0207428_10014710 3300027907 Bacteria 6781
125 Ga0268266_10000173 3300028379 Bacteria 117695
126 Ga0268265_10016718 3300028380 Bacteria 5047
127 Ga0265334_10074988 3300028573 Bacteria 1254
128 Ga0265336_10036771 3300028666 Bacteria 1507
129 Ga0265338_10066538 3300028800 Bacteria 3118
130 Ga0265338_10154840 3300028800 Bacteria 1776
131 Ga0265320_10056617 3300031240 Bacteria 1883
132 Ga0265339_10011054 3300031249 Bacteria 5576
133 Ga0307408_100196352 3300031548 Bacteria 1630
134 Ga0307408_100213791 3300031548 Bacteria 1569
135 Ga0307408_100229305 3300031548 Bacteria 1520
136 Ga0307408_101402056 3300031548 Bacteria 658
137 Ga0265313_10026283 3300031595 Bacteria 3069
138 Ga0307516_10055818 3300031730 Bacteria 3854
139 Ga0307405_10064486 3300031731 Bacteria 2329
140 Ga0307405_10127995 3300031731 Viruses 1750
141 Ga0307406_10414776 3300031901 Bacteria 1071
142 Ga0307406_10801252 3300031901 Bacteria 795
143 Ga0307407_10185154 3300031903 Bacteria 1383
144 Ga0307412_10695955 3300031911 Bacteria 872
145 Ga0307409_100159959 3300031995 Bacteria 1968
146 Ga0307409_102426876 3300031995 Unclassified 553
147 Ga0307416_100171432 3300032002 Bacteria 2021
148 Ga0307416_100223796 3300032002 Viruses 1807
149 Ga0307414_10150331 3300032004 Bacteria 1836
150 Ga0307414_10392782 3300032004 Unclassified 1202
151 Ga0307414_10415109 3300032004 Bacteria 1172
152 Ga0307414_11056808 3300032004 Bacteria 749
153 Ga0307414_11671806 3300032004 Bacteria 594
154 Ga0307411_10497428 3300032005 Bacteria 1030
155 Ga0307411_11282716 3300032005 Bacteria 667
156 Ga0307415_100547762 3300032126 Bacteria 1020
157 Ga0395905_1049771 3300037471 Bacteria 718
158 Ga0436364_0017402 3300037853 Bacteria 3071
159 Ga0436365_0002673 3300039437 Bacteria 3955
160 Ga0436365_0908445 3300039437 Bacteria 1192
161 Ga0436365_1576939 3300039437 Bacteria 1009
162 Ga0436361_0758912 3300039447 Bacteria 1402
163 Ga0451833_0251561 3300041491 Bacteria 1715
164 Ga0451845_0466243 3300041501 Bacteria 831
165 Ga0439431_0006927 3300041997 Bacteria 2520
166 Ga0439449_0145323 3300042007 Bacteria 884
167 Ga0439457_090794 3300042014 Bacteria 707
168 Ga0450890_020514 3300042127 Bacteria 895
169 Ga0439446_0005636 3300042156 Bacteria 3226
170 Ga0450893_0057349 3300042532 Bacteria 739
171 Ga0451577_0982331 3300042876 Bacteria 759
172 Ga0466966_0045725 3300044684 Bacteria 2798
173 Ga0466966_0104543 3300044684 Bacteria 1749
174 Ga0466961_0016093 3300044693 Bacteria 4802
175 Ga0466963_0149437 3300044694 Bacteria 1622
176 Ga0466964_0051091 3300044706 Bacteria 1697
177 Ga0453684_0000670 3300044712 Bacteria 122645
178 Ga0453684_0002703 3300044712 Bacteria 42086
179 Ga0453684_0457495 3300044712 Bacteria 1420
180 Ga0453684_0772274 3300044712 Bacteria 1038
181 Ga0466957_0487410 3300044842 Bacteria 853
182 Ga0466959_0023817 3300045049 Bacteria 4533
183 Ga0466958_0001634 3300045836 Bacteria 10787
184 Ga0495629_0080233 3300046459 Bacteria 2278
185 Ga0495616_0076839 3300046513 Bacteria 1604
186 Ga0495643_0000286 3300046522 Bacteria 72166
187 Ga0495621_0251780 3300046539 Bacteria 722
188 Ga0495659_0019682 3300046664 Bacteria 2259
189 Ga0495658_0241922 3300046683 Bacteria 1133
190 Ga0495613_0132800 3300046689 Bacteria 1782
191 Ga0495670_0588614 3300046691 Bacteria 606
192 Ga0495673_0000377 3300047469 Bacteria 53346
193 Ga0496102_0162369 3300048905 Bacteria 2102
194 Ga0496112_0263181 3300048915 Unclassified 1674
195 Ga0496124_0027969 3300048927 Bacteria 5050
196 Ga0496124_0087430 3300048927 Bacteria 2549
197 Ga0501308_003075 3300049128 Bacteria 1517
198 Ga0501309_007703 3300049129 Bacteria 1340
199 Ga0501305_004817 3300049161 Bacteria 1607
200 Ga0501307_000885 3300049162 Bacteria 2297
201 Ga0501292_003714 3300049515 Bacteria 2054
202 Ga0501311_001638 3300049527 Bacteria 2000
203 Ga0501321_002776 3300049537 Bacteria 1551
204 Ga0501322_003352 3300049538 Bacteria 1035
205 Ga0501323_003469 3300049539 Bacteria 1612
206 Ga0501075_0354383 3300049591 Bacteria 1118
207 Ga0501217_030512 3300049661 Bacteria 1324
208 Ga0501249_009938 3300049679 Bacteria 1983
209 Ga0501256_022145 3300049685 Bacteria 674
210 Ga0501259_083794 3300049688 Unclassified 705
211 Ga0501225_0038574 3300049705 Bacteria 1316
212 Ga0501079_1378385 3300049741 Bacteria 555
213 Ga0501081_0531881 3300049743 Bacteria 877
214 Ga0501045_0733776 3300049824 Bacteria 728
215 nmdc:mga03683_13942_c1 3300050489 Bacteria 2966
216 nmdc:mga03683_4996_c1 3300050489 Bacteria 4439
217 nmdc:mga03683_577246_c1 3300050489 Bacteria 549
218 nmdc:mga03n38_129679_c1 3300050490 Bacteria 1248
219 nmdc:mga03n38_47990_c1 3300050490 Bacteria 1893
220 nmdc:mga00v17_118500_c1 3300050491 Bacteria 1684
221 nmdc:mga00v17_17200_c1 3300050491 Bacteria 4087
222 nmdc:mga00v17_193152_c1 3300050491 Bacteria 1315
223 nmdc:mga00v17_62284_c1 3300050491 Bacteria 2295
224 nmdc:mga0yw44_135300_c1 3300050492 Bacteria 1598
225 nmdc:mga0yw44_188215_c1 3300050492 Bacteria 1361
226 nmdc:mga0yw44_251716_c1 3300050492 Bacteria 1176
227 nmdc:mga0yw44_4455_c1 3300050492 Bacteria 6425
228 nmdc:mga0yw44_44789_c1 3300050492 Bacteria 2649
229 nmdc:mga0yw44_4759_c1 3300050492 Bacteria 6288
230 nmdc:mga0yw44_573166_c1 3300050492 Bacteria 767
231 nmdc:mga0k408_69273_c1 3300050493 Bacteria 1739
232 nmdc:mga06z11_33670_c1 3300050494 Bacteria 2508
233 nmdc:mga04h51_5173_c1 3300050495 Bacteria 3310
234 nmdc:mga07m45_351660_c1 3300050496 Bacteria 856
235 nmdc:mga07m45_41595_c1 3300050496 Bacteria 2574
236 nmdc:mga05p37_1675_c1 3300050507 Bacteria 25766
237 nmdc:mga05p37_292721_c1 3300050507 Bacteria 1937
238 nmdc:mga09592_85531_c1 3300050508 Bacteria 2690
239 nmdc:mga08y16_31879_c1 3300050511 Bacteria 5542
240 nmdc:mga08y16_35247_c1 3300050511 Bacteria 5256
241 nmdc:mga0a205_241763_c1 3300050515 Unclassified 1686
242 Ga0500578_0008913 3300053086 Bacteria 6537
243 Ga0500644_0093914 3300053088 Bacteria 1128
244 Ga0500583_0374692 3300053092 Unclassified 686
245 Ga0500652_083542 3300053131 Unclassified 1331
246 Ga0500561_0130430 3300053137 Unclassified 773
247 Ga0500568_0002257 3300053139 Bacteria 11517
248 Ga0500573_0000034 3300053140 Bacteria 113547
249 Ga0500604_0000014 3300053151 Bacteria 92128
250 Ga0500616_0001169 3300053153 Bacteria 26764
251 Ga0500587_000570 3300053739 Bacteria 4564
252 Ga0501084_0775026 3300054114 Bacteria 808
253 Ga0587093_002138 3300059478 Bacteria 1793
254 Ga0587093_008215 3300059478 Viruses 1184
255 Ga0587066_128135 3300059490 Bacteria 607
256 Ga0587070_007002 3300059491 Bacteria 1546
257 Ga0587070_075008 3300059491 Bacteria 730
258 Ga0587077_059031 3300059493 Bacteria 826
259 Ga0587083_0089511 3300059505 Bacteria 748
260 Ga0587085_007249 3300059506 Viruses 1377
261 Ga0587086_002698 3300059507 Bacteria 1713
262 Ga0587088_009864 3300059508 Bacteria 1385
263 Ga0587091_052959 3300059511 Bacteria 839
264 Ga0587092_001585 3300059512 Bacteria 2259
265 Ga0587092_008624 3300059512 Viruses 1351
266 Ga0587094_019560 3300059513 Bacteria 972
267 Ga0587098_005112 3300059604 Bacteria 1272
268 Ga0587106_005130 3300059605 Bacteria 1481
269 Ga0587125_014355 3300059607 Bacteria 866
270 Ga0587101_045241 3300059623 Bacteria 740
271 Ga0587109_021410 3300059624 Bacteria 1155
272 Ga0587117_002358 3300059627 Bacteria 1751
273 Ga0587117_007307 3300059627 Bacteria 1262
274 Ga0587127_017569 3300059629 Bacteria 613
275 Ga0587062_000099 3300059639 Bacteria 4288
276 Ga0587062_002340 3300059639 Viruses 1790
277 Ga0587067_009586 3300059640 Bacteria 1448
278 Ga0587068_014994 3300059641 Bacteria 1214
279 Ga0587069_010499 3300059642 Bacteria 1219
280 Ga0587069_011683 3300059642 Bacteria 1177
281 Ga0587072_011618 3300059643 Bacteria 1442
282 Ga0587072_012699 3300059643 Bacteria 1395
283 Ga0587079_060561 3300059647 Unclassified 819
284 Ga0587079_075924 3300059647 Unclassified 759
285 Ga0587108_014196 3300059653 Bacteria 706
286 Ga0587061_00115 3300060244 Bacteria 2295
287 Ga0587071_017993 3300060344 Bacteria 1266
288 Ga0587111_0009384 3300060346 Bacteria 1649
289 Ga0587111_0013367 3300060346 Viruses 1465
290 Ga0466962_0016188 3300061719 Bacteria 3597
291 2511122493 2510917020 Bacteria 5657507
292 2512933672 2512875016 Bacteria 6529530
293 2563929361 2563366752 Bacteria 4961801
294 2643923238 2643221583 Bacteria 5218014
295 2876364073 2876363079 Bacteria 6544991
296 2903453825 2903448605 Bacteria 7357801
297 2903525767 2903521522 Bacteria 6525694
298 2903532686 2903528002 Bacteria 6586099
299 2937853892 2937848649 Bacteria 6983481
300 2963645531 2963644680 Bacteria 6530403
301 2968085135 2968083720 Bacteria 7351627
302 2977924686 2977922695 Bacteria 6956781
303 3004218477 3004211236 Bacteria 7417683
304 3004222890 3004218560 Bacteria 7421728
305 Ga0307414_10090919
306 Ga0055536_1003626
307 Ga0065165_1000123
308 Ga0065704_10344379
309 Ga0065704_10473283
310 Ga0065712_10251782
311 Ga0065715_10008980
312 Ga0065707_10083232
313 Ga0065707_10110068
314 Ga0070670_100033105
315 Ga0070670_100062685
316 Ga0070670_101479759
317 Ga0068869_100237257
318 Ga0068869_100268972
319 Ga0070682_100122797
320 Ga0068868_100422556
321 Ga0070689_100420020
322 Ga0070692_10312137
323 Ga0070671_100039938
324 Ga0070671_100424176
325 Ga0070673_100002818
326 Ga0070688_100180342
327 Ga0070688_100186213
328 Ga0070659_100201050
329 Ga0070703_10000271
330 Ga0070701_10363518
331 Ga0070700_100018111
332 Ga0070678_100250593
333 Ga0068867_100123706
334 Ga0070685_10001840
335 Ga0070699_100352245
336 Ga0070684_100947385
337 Ga0068853_100931014
338 Ga0070696_100474410
339 Ga0070693_100413267
340 Ga0070665_100000145
341 Ga0070704_100718848
342 Ga0068857_100945560
343 Ga0068856_100006432
344 Ga0070702_100113217
345 Ga0068852_100717870
346 Ga0068859_100002668
347 Ga0068859_100009955
348 Ga0068861_101424976
349 Ga0068870_10225551
350 Ga0068858_101140873
351 Ga0068862_100018222
352 Ga0081455_10610000
353 Ga0075365_10007613
354 Ga0075365_10029151
355 Ga0075365_10057146
356 Ga0075365_10057467
357 Ga0075365_10108701
358 Ga0075365_10452945
359 Ga0075365_10569063
360 Ga0075368_10001020
361 Ga0075363_100014159
362 Ga0075363_100166969
363 Ga0075364_10014475
364 Ga0075364_10042120
365 Ga0075364_10303973
366 Ga0075362_10018234
367 Ga0075362_10044489
368 Ga0075367_10075121
369 Ga0075366_10065928
370 Ga0097621_100460595
371 Ga0075370_10003694
372 Ga0068871_101095762
373 Ga0075428_100039304
374 Ga0075428_100751304
375 Ga0075428_101696203
376 Ga0075433_10594510
377 Ga0075429_100058501
378 Ga0097620_100002668
379 Ga0097620_100009955
380 Ga0105240_10052562
381 Ga0105240_10996501
382 Ga0111539_10010768
383 Ga0111539_10093138
384 Ga0111539_10487670
385 Ga0114129_10001359
386 Ga0114129_11398574
387 Ga0105243_11006344
388 Ga0105241_10211308
389 Ga0105242_10000271
390 Ga0105242_10051582
391 Ga0105242_11086010
392 Ga0105248_10229449
393 Ga0105239_10828379
394 Ga0105239_10914646
395 Ga0105246_10231769
396 Ga0105246_10294117
397 Ga0157374_10210400
398 Ga0163162_10027811
399 Ga0163162_10261780
400 Ga0163162_10826254
401 Ga0157372_10108478
402 Ga0157372_11591795
403 Ga0157375_10214777
404 Ga0157375_11324266
405 Ga0163163_10581898
406 Ga0213876_10176026
407 Ga0213875_10022046
408 Ga0209676_1000555
409 Ga0207653_10000026
410 Ga0207705_10872219
411 Ga0207654_10528159
412 Ga0207686_10000285
413 Ga0207686_10040765
414 Ga0207686_10682666
415 Ga0207709_10001808
416 Ga0207670_10368725
417 Ga0207689_10434810
418 Ga0207651_10002277
419 Ga0207677_11069743
420 Ga0207639_10818977
421 Ga0207708_10051610
422 Ga0207702_10008531
423 Ga0207641_10961551
424 Ga0207683_10453641
425 Ga0207698_10684982
426 Ga0209813_10002212
427 Ga0207428_10002898
428 Ga0207428_10014710
429 Ga0268266_10000173
430 Ga0268265_10016718
431 Ga0265334_10074988
432 Ga0265336_10036771
433 Ga0265338_10066538
434 Ga0265338_10154840
435 Ga0265320_10056617
436 Ga0265339_10011054
437 Ga0307408_100196352
438 Ga0307408_100213791
439 Ga0307408_100229305
440 Ga0307408_101402056
441 Ga0265313_10026283
442 Ga0307516_10055818
443 Ga0307405_10064486
444 Ga0307405_10127995
445 Ga0307406_10414776
446 Ga0307406_10801252
447 Ga0307407_10185154
448 Ga0307412_10695955
449 Ga0307409_100159959
450 Ga0307409_102426876
451 Ga0307416_100171432
452 Ga0307416_100223796
453 Ga0307414_10150331
454 Ga0307414_10392782
455 Ga0307414_10415109
456 Ga0307414_11056808
457 Ga0307414_11671806
458 Ga0307411_10497428
459 Ga0307411_11282716
460 Ga0307415_100547762
461 Ga0395905_1049771
462 Ga0436364_0017402
463 Ga0436365_0002673
464 Ga0436365_0908445
465 Ga0436365_1576939
466 Ga0436361_0758912
467 Ga0451833_0251561
468 Ga0451845_0466243
469 Ga0439431_0006927
470 Ga0439449_0145323
471 Ga0439457_090794
472 Ga0450890_020514
473 Ga0439446_0005636
474 Ga0450893_0057349
475 Ga0451577_0982331
476 Ga0466966_0045725
477 Ga0466966_0104543
478 Ga0466961_0016093
479 Ga0466963_0149437
480 Ga0466964_0051091
481 Ga0453684_0000670
482 Ga0453684_0002703
483 Ga0453684_0457495
484 Ga0453684_0772274
485 Ga0466957_0487410
486 Ga0466959_0023817
487 Ga0466958_0001634
488 Ga0495629_0080233
489 Ga0495616_0076839
490 Ga0495643_0000286
491 Ga0495621_0251780
492 Ga0495659_0019682
493 Ga0495658_0241922
494 Ga0495613_0132800
495 Ga0495670_0588614
496 Ga0495673_0000377
497 Ga0496102_0162369
498 Ga0496112_0263181
499 Ga0496124_0027969
500 Ga0496124_0087430
501 Ga0501308_003075
502 Ga0501309_007703
503 Ga0501305_004817
504 Ga0501307_000885
505 Ga0501292_003714
506 Ga0501311_001638
507 Ga0501321_002776
508 Ga0501322_003352
509 Ga0501323_003469
510 Ga0501075_0354383
511 Ga0501217_030512
512 Ga0501249_009938
513 Ga0501256_022145
514 Ga0501259_083794
515 Ga0501225_0038574
516 Ga0501079_1378385
517 Ga0501081_0531881
518 Ga0501045_0733776
519 nmdc:mga03683_13942_c1
520 nmdc:mga03683_4996_c1
521 nmdc:mga03683_577246_c1
522 nmdc:mga03n38_129679_c1
523 nmdc:mga03n38_47990_c1
524 nmdc:mga00v17_118500_c1
525 nmdc:mga00v17_17200_c1
526 nmdc:mga00v17_193152_c1
527 nmdc:mga00v17_62284_c1
528 nmdc:mga0yw44_135300_c1
529 nmdc:mga0yw44_188215_c1
530 nmdc:mga0yw44_251716_c1
531 nmdc:mga0yw44_4455_c1
532 nmdc:mga0yw44_44789_c1
533 nmdc:mga0yw44_4759_c1
534 nmdc:mga0yw44_573166_c1
535 nmdc:mga0k408_69273_c1
536 nmdc:mga06z11_33670_c1
537 nmdc:mga04h51_5173_c1
538 nmdc:mga07m45_351660_c1
539 nmdc:mga07m45_41595_c1
540 nmdc:mga05p37_1675_c1
541 nmdc:mga05p37_292721_c1
542 nmdc:mga09592_85531_c1
543 nmdc:mga08y16_31879_c1
544 nmdc:mga08y16_35247_c1
545 nmdc:mga0a205_241763_c1
546 Ga0500578_0008913
547 Ga0500644_0093914
548 Ga0500583_0374692
549 Ga0500652_083542
550 Ga0500561_0130430
551 Ga0500568_0002257
552 Ga0500573_0000034
553 Ga0500604_0000014
554 Ga0500616_0001169
555 Ga0500587_000570
556 Ga0501084_0775026
557 Ga0587093_002138
558 Ga0587093_008215
559 Ga0587066_128135
560 Ga0587070_007002
561 Ga0587070_075008
562 Ga0587077_059031
563 Ga0587083_0089511
564 Ga0587085_007249
565 Ga0587086_002698
566 Ga0587088_009864
567 Ga0587091_052959
568 Ga0587092_001585
569 Ga0587092_008624
570 Ga0587094_019560
571 Ga0587098_005112
572 Ga0587106_005130
573 Ga0587125_014355
574 Ga0587101_045241
575 Ga0587109_021410
576 Ga0587117_002358
577 Ga0587117_007307
578 Ga0587127_017569
579 Ga0587062_000099
580 Ga0587062_002340
581 Ga0587067_009586
582 Ga0587068_014994
583 Ga0587069_010499
584 Ga0587069_011683
585 Ga0587072_011618
586 Ga0587072_012699
587 Ga0587079_060561
588 Ga0587079_075924
589 Ga0587108_014196
590 Ga0587061_00115
591 Ga0587071_017993
592 Ga0587111_0009384
593 Ga0587111_0013367
594 Ga0466962_0016188
595 2511122493
596 2512933672
597 2563929361
598 2643923238
599 2876364073
600 2903453825
601 2903525767
602 2903532686
603 2937853892
604 2963645531
605 2968085135
606 2977924686
607 3004218477
608 3004222890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

6

62

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8712 6 59
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.4237 6 163
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.411 6 163
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.3942 6 163
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.3925 6 164
ID Description Score Start End Superfamily
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8637 10 59 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8491 6 59 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.655 10 59 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6146 6 59 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.5951 4 55 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A2X0SK75-F1-model_v4 Phage tail collar domain-containing protein 0.9715 3 61
AF-A0A537UIU5-F1-model_v4 Phage tail collar domain-containing protein 0.8634 2 171
AF-A0A533TTP2-F1-model_v4 Phage tail protein 0.8534 3 75
AF-A0A1Y5E6L1-F1-model_v4 Phage tail collar domain-containing protein 0.8475 1 171
AF-A0A537LTI6-F1-model_v4 Phage tail collar domain-containing protein 0.8432 1 74

Map