F398607

General Info

Members Datasets Scaffolds Average Seq Length
306 218 264 251

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100044648|Ga0075431_1000446483
Length 265
Sequence MPGCSRASGAGLAKAAPVLDLKSVSRSFGGVRAVDQLDLTVGDGEIVGLIGPNGSGKSTTVNLITGLFPVDSGIVYFRGEDIGNLPTHRRLQAGIGRTFQNIRLFGQLSVWQNLWVAQNSPEDRAGRGFLSRWLGGQSAVRGEIEKLLEFSGLLHKQDELASNLAFGEQRRLELARALAAKPKLLLLDEPAAGMNSEEIGQLRARILSLRERGITILLIEHVMELVMGVADRIVVLNFGQKIAEGPPAEIRADPLVRSAYLGGGA

Samples

Sample ID Description Type Environment
1 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221683 Variovorax sp. Root473 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2841760612 Bosea sp. Tri-49 Isolate Nodule
12 2844104063 Bosea sp. Tri-39 Isolate Nodule
13 2851182111 Bosea sp. Tri-44 Isolate Nodule
14 2851246043 Bosea sp. Tri-54 Isolate Nodule
15 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
16 2858950400 Achromobacter sp. K91 Isolate Unclassified
17 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
18 2885198086 Variovorax sp. 679 Isolate Unclassified
19 2885211737 Variovorax sp. 553 Isolate Unclassified
20 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
21 2899924645 Variovorax sp. 369 Isolate Unclassified
22 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
23 2904456579 Variovorax sp. 2002 Isolate Unclassified
24 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
25 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
26 2922368715
27 2928051484 Variovorax sp. 1133 Isolate Unclassified
28 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
29 2928070936 Variovorax gossypii 1167 Isolate Unclassified
30 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
31 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
32 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
33 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
34 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
35 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
36 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
37 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
38 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
39 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
40 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
41 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
42 2941479691
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.56
Metatranscriptomes 0
Isolates 13.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 5.88
Rhizoplane 1.63
Rhizosphere 69.28
Stem 0
Stem Tuber 0
Unclassified 10.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10005063 3300003187 Bacteria 6855
2 rootH1_10044200 3300003323 Bacteria 2681
3 Ga0055526_1000319 3300003771 Bacteria 39897
4 Ga0055524_1000042 3300003775 Bacteria 155404
5 Ga0055540_1001698 3300003792 Bacteria 12684
6 JGI25405J52794_10003863 3300003911 Bacteria 2655
7 JGI25405J52794_10007557 3300003911 Bacteria 2007
8 Ga0065707_10019456 3300005295 Bacteria 1821
9 Ga0070670_100313416 3300005331 Bacteria 1374
10 Ga0070680_100709386 3300005336 Bacteria 866
11 Ga0070689_100104790 3300005340 Bacteria 2243
12 Ga0070668_100446564 3300005347 Bacteria 1111
13 Ga0070673_100147065 3300005364 Bacteria 1993
14 Ga0070688_100186864 3300005365 Bacteria 1441
15 Ga0070659_100177295 3300005366 Bacteria 1748
16 Ga0070659_100401572 3300005366 Bacteria 1157
17 Ga0070667_100796986 3300005367 Bacteria 877
18 Ga0070711_100004309 3300005439 Bacteria 8376
19 Ga0070694_100063085 3300005444 Bacteria 2533
20 Ga0070694_100196064 3300005444 Bacteria 1503
21 Ga0070706_100106728 3300005467 Bacteria 2605
22 Ga0070698_100028670 3300005471 Bacteria 5780
23 Ga0070698_100317699 3300005471 Bacteria 1488
24 Ga0070697_100032015 3300005536 Bacteria 4230
25 Ga0070695_100071463 3300005545 Bacteria 2273
26 Ga0070704_100003128 3300005549 Bacteria 9439
27 Ga0070704_100005603 3300005549 Bacteria 7332
28 Ga0068857_100156370 3300005577 Bacteria 2067
29 Ga0068859_100037098 3300005617 Bacteria 4892
30 Ga0068859_100057919 3300005617 Bacteria 3902
31 Ga0068863_100064509 3300005841 Bacteria 3464
32 Ga0068858_100079562 3300005842 Bacteria 3045
33 Ga0068862_100292127 3300005844 Bacteria 1497
34 Ga0081455_10000373 3300005937 Bacteria 59312
35 Ga0081455_10008897 3300005937 Bacteria 10382
36 Ga0081455_10009640 3300005937 Bacteria 9911
37 Ga0081455_10011291 3300005937 Bacteria 8986
38 Ga0081455_10456949 3300005937 Bacteria 871
39 Ga0081538_10003458 3300005981 Bacteria 14918
40 Ga0081540_1002075 3300005983 Bacteria 16709
41 Ga0081539_10011007 3300005985 Bacteria 7240
42 Ga0075363_100140556 3300006048 Bacteria 1359
43 Ga0075364_10231116 3300006051 Bacteria 1256
44 Ga0070716_100044406 3300006173 Bacteria 2490
45 Ga0070712_100033790 3300006175 Bacteria 3462
46 Ga0075362_10000635 3300006177 Bacteria 10304
47 Ga0075362_10038190 3300006177 Bacteria 2109
48 Ga0075369_10025342 3300006186 Bacteria 2465
49 Ga0075369_10219534 3300006186 Bacteria 880
50 Ga0075366_10146961 3300006195 Bacteria 1427
51 Ga0075428_100003227 3300006844 Bacteria 17844
52 Ga0075428_100019082 3300006844 Bacteria 7583
53 Ga0075428_100046171 3300006844 Bacteria 4785
54 Ga0075428_100053656 3300006844 Bacteria 4417
55 Ga0075428_100321989 3300006844 Bacteria 1661
56 Ga0075428_100448786 3300006844 Bacteria 1381
57 Ga0075430_100002931 3300006846 Bacteria 14267
58 Ga0075430_100106178 3300006846 Bacteria 2343
59 Ga0075431_100001233 3300006847 Bacteria 23194
60 Ga0075431_100006064 3300006847 Bacteria 11983
61 Ga0075431_100018632 3300006847 Bacteria 7072
62 Ga0075431_100044648 3300006847 Bacteria 4570
63 Ga0075431_100082083 3300006847 Bacteria 3328
64 Ga0075431_100326372 3300006847 Bacteria 1547
65 Ga0075433_10237014 3300006852 Bacteria 1620
66 Ga0075429_100000132 3300006880 Bacteria 44733
67 Ga0075429_100003717 3300006880 Bacteria 13011
68 Ga0075429_100249192 3300006880 Bacteria 1555
69 Ga0097620_100037096 3300006931 Bacteria 4892
70 Ga0097620_100057919 3300006931 Bacteria 3902
71 Ga0099794_10025019 3300007265 Bacteria 2745
72 Ga0099795_10033391 3300007788 Bacteria 1787
73 Ga0099795_10065441 3300007788 Bacteria 1359
74 Ga0105240_10238294 3300009093 Bacteria 2110
75 Ga0111539_10003310 3300009094 Bacteria 21272
76 Ga0111539_10486200 3300009094 Bacteria 1438
77 Ga0111539_10539271 3300009094 Bacteria 1359
78 Ga0105245_10233168 3300009098 Bacteria 1781
79 Ga0105247_10040633 3300009101 Bacteria 2844
80 Ga0114129_10000199 3300009147 Bacteria 66704
81 Ga0114129_10044453 3300009147 Bacteria 6249
82 Ga0114129_10175366 3300009147 Bacteria 2920
83 Ga0114129_10341827 3300009147 Bacteria 1985
84 Ga0114129_10943635 3300009147 Bacteria 1090
85 Ga0105243_10023629 3300009148 Bacteria 4683
86 Ga0105243_10227626 3300009148 Bacteria 1652
87 Ga0105237_10042744 3300009545 Bacteria 4569
88 Ga0105249_10144969 3300009553 Bacteria 2280
89 Ga0105249_10221693 3300009553 Bacteria 1861
90 Ga0105249_10563167 3300009553 Bacteria 1191
91 Ga0099796_10042833 3300010159 Bacteria 1540
92 Ga0099796_10148905 3300010159 Bacteria 920
93 Ga0105239_10161513 3300010375 Bacteria 2503
94 Ga0157373_10108162 3300013100 Bacteria 1955
95 Ga0157369_10073916 3300013105 Bacteria 3656
96 Ga0163162_10094984 3300013306 Bacteria 3068
97 Ga0163163_10071739 3300014325 Bacteria 3452
98 Ga0163163_10650505 3300014325 Bacteria 1117
99 Ga0157380_10103736 3300014326 Bacteria 2373
100 Ga0182006_1025936 3300015261 Bacteria 2404
101 Ga0209233_1033907 3300025261 Bacteria 1167
102 Ga0209455_1000822 3300025272 Bacteria 16847
103 Ga0209673_1044054 3300025273 Bacteria 1240
104 Ga0209675_1001192 3300025291 Bacteria 15762
105 Ga0209025_1000014 3300025294 Bacteria 865448
106 Ga0209025_1000145 3300025294 Bacteria 181436
107 Ga0209564_1000077 3300025295 Bacteria 281592
108 Ga0209758_1003502 3300025297 Bacteria 14178
109 Ga0209758_1090594 3300025297 Bacteria 897
110 Ga0209050_1007446 3300025298 Bacteria 6132
111 Ga0209256_1000057 3300025299 Bacteria 281592
112 Ga0209051_1000284 3300025303 Bacteria 82589
113 Ga0209051_1004568 3300025303 Bacteria 8471
114 Ga0207653_10055695 3300025885 Bacteria 1324
115 Ga0207710_10043844 3300025900 Bacteria 1991
116 Ga0207688_10043171 3300025901 Bacteria 2510
117 Ga0207684_10113752 3300025910 Bacteria 2317
118 Ga0207695_10370299 3300025913 Bacteria 1319
119 Ga0207693_10015328 3300025915 Bacteria 6152
120 Ga0207694_10075276 3300025924 Bacteria 2642
121 Ga0207650_10020053 3300025925 Bacteria 4709
122 Ga0207690_10514509 3300025932 Bacteria 969
123 Ga0207709_10037184 3300025935 Bacteria 2891
124 Ga0207665_10006888 3300025939 Bacteria 7524
125 Ga0207689_10021878 3300025942 Bacteria 5378
126 Ga0207667_10393161 3300025949 Bacteria 1412
127 Ga0207674_10074288 3300026116 Bacteria 3412
128 Ga0209371_1004961 3300027312 Bacteria 5512
129 Ga0209179_1001549 3300027512 Bacteria 2852
130 Ga0209179_1049927 3300027512 Bacteria 895
131 Ga0209588_1001381 3300027671 Bacteria 6326
132 Ga0209588_1037599 3300027671 Bacteria 1558
133 Ga0209588_1062931 3300027671 Bacteria 1199
134 Ga0207428_10056788 3300027907 Bacteria 3109
135 Ga0307515_10298318 3300028794 Bacteria 1299
136 Ga0268256_1004790 3300030500 Bacteria 5498
137 Ga0307513_10157774 3300031456 Bacteria 2166
138 Ga0307516_10019632 3300031730 Bacteria 6995
139 Ga0307405_10003144 3300031731 Bacteria 7512
140 Ga0307407_10115086 3300031903 Bacteria 1695
141 Ga0307416_100060737 3300032002 Bacteria 3080
142 Ga0307416_100302487 3300032002 Bacteria 1591
143 Ga0307415_100049886 3300032126 Bacteria 2833
144 Ga0395899_0120389 3300037312 Bacteria 1881
145 Ga0395900_0025485 3300037418 Bacteria 6054
146 Ga0395900_0105292 3300037418 Bacteria 2898
147 Ga0395900_0141291 3300037418 Bacteria 2466
148 Ga0395898_0014056 3300037466 Bacteria 8226
149 Ga0395898_0179421 3300037466 Bacteria 2024
150 Ga0395901_0088446 3300038443 Bacteria 3240
151 Ga0395901_0149165 3300038443 Bacteria 2457
152 Ga0439453_0001497 3300041408 Bacteria 3021
153 Ga0439465_0147557 3300041413 Bacteria 838
154 Ga0439441_000385 3300042001 Bacteria 4603
155 Ga0439441_003578 3300042001 Bacteria 2300
156 Ga0439432_048570 3300042006 Bacteria 1329
157 Ga0439451_006315 3300042009 Bacteria 2423
158 Ga0439434_0011129 3300042435 Bacteria 2658
159 Ga0466965_0262721 3300044683 Bacteria 928
160 Ga0495627_004726 3300046453 Bacteria 5629
161 Ga0495605_0022269 3300046474 Bacteria 3348
162 Ga0495584_0060338 3300046491 Bacteria 1907
163 Ga0495644_0006350 3300046523 Bacteria 4586
164 Ga0495621_0173987 3300046539 Bacteria 856
165 Ga0495656_0024593 3300046615 Bacteria 2380
166 Ga0495625_0138844 3300046660 Bacteria 1641
167 Ga0495659_0022605 3300046664 Bacteria 2130
168 Ga0495670_0163127 3300046691 Bacteria 1171
169 Ga0495636_0121707 3300047318 Bacteria 1155
170 Ga0495626_0127776 3300048091 Bacteria 1088
171 Ga0496102_0204631 3300048905 Bacteria 1861
172 Ga0496107_0150493 3300048910 Bacteria 1721
173 Ga0496117_0019233 3300048920 Bacteria 5617
174 Ga0496117_0080639 3300048920 Bacteria 2139
175 Ga0496118_0021349 3300048921 Bacteria 5702
176 Ga0496121_0000153 3300048924 Bacteria 150635
177 Ga0496121_0005175 3300048924 Bacteria 16922
178 Ga0496122_0109184 3300048925 Bacteria 1822
179 Ga0496123_0071534 3300048926 Bacteria 2163
180 Ga0496124_0073620 3300048927 Bacteria 2826
181 Ga0496125_0169652 3300048928 Bacteria 1469
182 Ga0496126_0043221 3300048929 Bacteria 4158
183 Ga0496126_0436873 3300048929 Bacteria 1056
184 Ga0501032_0296790 3300049569 Bacteria 1045
185 Ga0501032_0321790 3300049569 Bacteria 998
186 Ga0501033_0026002 3300049570 Bacteria 4405
187 Ga0501033_0160281 3300049570 Bacteria 1620
188 Ga0501034_0015990 3300049571 Bacteria 7702
189 Ga0501034_0421379 3300049571 Bacteria 1256
190 Ga0501034_0445366 3300049571 Bacteria 1213
191 Ga0501036_0086307 3300049572 Bacteria 2653
192 Ga0501036_0116115 3300049572 Bacteria 2261
193 Ga0501036_0130961 3300049572 Bacteria 2118
194 Ga0501037_0025462 3300049573 Bacteria 4372
195 Ga0501037_0049679 3300049573 Bacteria 3071
196 Ga0501039_0238524 3300049575 Bacteria 1430
197 Ga0501040_0033660 3300049576 Bacteria 3473
198 Ga0501040_0227352 3300049576 Bacteria 1328
199 Ga0501042_0059044 3300049578 Bacteria 2739
200 Ga0501042_0346463 3300049578 Bacteria 1074
201 Ga0501043_0011190 3300049579 Bacteria 7027
202 Ga0501043_0026972 3300049579 Bacteria 4508
203 Ga0501046_0087356 3300049580 Bacteria 2403
204 Ga0501046_0093640 3300049580 Bacteria 2309
205 Ga0501047_0004851 3300049581 Bacteria 12633
206 Ga0501048_0356813 3300049582 Bacteria 1043
207 Ga0501068_0059882 3300049584 Bacteria 2312
208 Ga0501070_0082617 3300049586 Bacteria 2659
209 Ga0501071_0083520 3300049587 Bacteria 2340
210 Ga0501072_0071230 3300049588 Bacteria 2747
211 Ga0501072_0181281 3300049588 Bacteria 1680
212 Ga0501074_0348883 3300049590 Bacteria 1050
213 Ga0501075_0476414 3300049591 Bacteria 952
214 Ga0501076_0060553 3300049592 Bacteria 3012
215 Ga0501077_0004079 3300049593 Bacteria 8819
216 Ga0501077_0016835 3300049593 Bacteria 4611
217 Ga0501079_0263927 3300049741 Bacteria 1346
218 Ga0501081_0029021 3300049743 Bacteria 3736
219 Ga0501045_0079970 3300049824 Bacteria 2410
220 Ga0501045_0164367 3300049824 Bacteria 1653
221 nmdc:mga03683_1802_c1 3300050489 Bacteria 6496
222 nmdc:mga03683_28308_c1 3300050489 Bacteria 2227
223 nmdc:mga03n38_119532_c1 3300050490 Bacteria 1293
224 nmdc:mga0k408_563329_c1 3300050493 Bacteria 673
225 nmdc:mga05p37_13365_c1 3300050507 Bacteria 9836
226 nmdc:mga05p37_383_c1 3300050507 Bacteria 47792
227 nmdc:mga05p37_52024_c1 3300050507 Bacteria 5037
228 nmdc:mga05p37_682150_c1 3300050507 Bacteria 1145
229 nmdc:mga09592_12432_c1 3300050508 Bacteria 6934
230 nmdc:mga09592_2227_c1 3300050508 Bacteria 15621
231 nmdc:mga09592_92137_c1 3300050508 Bacteria 2591
232 nmdc:mga0qj67_12765_c1 3300050509 Bacteria 6333
233 nmdc:mga0qj67_14402_c1 3300050509 Bacteria 5979
234 nmdc:mga0qj67_6762_c1 3300050509 Bacteria 8431
235 nmdc:mga0qj67_727_c1 3300050509 Bacteria 22392
236 nmdc:mga0qj67_81930_c1 3300050509 Bacteria 2587
237 nmdc:mga06r32_13556_c1 3300050510 Bacteria 7387
238 nmdc:mga06r32_15820_c1 3300050510 Bacteria 6861
239 nmdc:mga06r32_295266_c1 3300050510 Bacteria 1607
240 nmdc:mga06r32_45933_c1 3300050510 Bacteria 4166
241 nmdc:mga06r32_6053_c1 3300050510 Bacteria 10874
242 nmdc:mga06r32_6349_c1 3300050510 Bacteria 10621
243 nmdc:mga06r32_711_c2 3300050510 Bacteria 27826
244 nmdc:mga06r32_72431_c1 3300050510 Bacteria 3336
245 nmdc:mga08y16_369_c1 3300050511 Bacteria 40785
246 nmdc:mga08y16_560658_c1 3300050511 Bacteria 1155
247 nmdc:mga0rr50_23304_c1 3300050513 Bacteria 4266
248 nmdc:mga0a205_256741_c1 3300050515 Bacteria 1626
249 nmdc:mga0sz30_117077_c1 3300050516 Bacteria 1170
250 Ga0500651_0013124 3300053093 Bacteria 5038
251 Ga0500562_018983 3300053108 Bacteria 1776
252 Ga0500569_131787 3300053109 Bacteria 837
253 Ga0500594_0016263 3300053118 Bacteria 1806
254 Ga0500595_001560 3300053119 Bacteria 12119
255 Ga0500595_003187 3300053119 Bacteria 7762
256 Ga0500607_008340 3300053121 Bacteria 6306
257 Ga0500642_0014953 3300053130 Bacteria 2902
258 Ga0500568_0067016 3300053139 Bacteria 1380
259 Ga0500616_0017366 3300053153 Bacteria 4082
260 Ga0501084_0191134 3300054114 Bacteria 1727
261 Ga0501082_0031482 3300060353 Bacteria 4575
262 Ga0501082_0127442 3300060353 Bacteria 2208
263 Ga0530510_0037145 3300061734 Bacteria 3511
264 Ga0530510_0352064 3300061734 Bacteria 1106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_563329_c1 nmdc:mga0k408_563329_c1_13_636 204
2 3300010159 Ga0099796_10042833 Ga0099796_100428332 233
3 3300009147 Ga0114129_10341827 Ga0114129_103418272 238
4 iso_pu_bacteria 2721755755 2723843215 239
5 iso_pu_bacteria 2874604998 2874609345 239
6 3300050515 nmdc:mga0a205_256741_c1 nmdc:mga0a205_256741_c1_525_1256 240
7 3300003911 JGI25405J52794_10003863 JGI25405J52794_100038634 243
8 3300003911 JGI25405J52794_10007557 JGI25405J52794_100075572 243
9 3300005937 Ga0081455_10008897 Ga0081455_1000889710 243
10 3300005983 Ga0081540_1002075 Ga0081540_100207510 243
11 3300005444 Ga0070694_100196064 Ga0070694_1001960642 244
12 3300005471 Ga0070698_100317699 Ga0070698_1003176992 244
13 3300005937 Ga0081455_10000373 Ga0081455_100003738 244
14 3300006844 Ga0075428_100019082 Ga0075428_1000190824 244
15 3300006846 Ga0075430_100002931 Ga0075430_10000293115 244
16 3300006847 Ga0075431_100018632 Ga0075431_1000186322 244
17 3300007265 Ga0099794_10025019 Ga0099794_100250193 244
18 3300027671 Ga0209588_1037599 Ga0209588_10375992 244
19 3300049572 Ga0501036_0130961 Ga0501036_0130961_729_1472 244
20 3300049578 Ga0501042_0346463 Ga0501042_0346463_172_915 244
21 3300050509 nmdc:mga0qj67_727_c1 nmdc:mga0qj67_727_c1_16472_17215 244
22 3300050510 nmdc:mga06r32_13556_c1 nmdc:mga06r32_13556_c1_5580_6323 244
23 3300005336 Ga0070680_100709386 Ga0070680_1007093861 245
24 3300005444 Ga0070694_100063085 Ga0070694_1000630853 245
25 3300005471 Ga0070698_100028670 Ga0070698_1000286704 245
26 3300005545 Ga0070695_100071463 Ga0070695_1000714633 245
27 3300005549 Ga0070704_100003128 Ga0070704_1000031287 245
28 3300005549 Ga0070704_100005603 Ga0070704_1000056037 245
29 3300005617 Ga0068859_100037098 Ga0068859_1000370985 245
30 3300006844 Ga0075428_100448786 Ga0075428_1004487862 245
31 3300006847 Ga0075431_100326372 Ga0075431_1003263722 245
32 3300006880 Ga0075429_100000132 Ga0075429_10000013223 245
33 3300006931 Ga0097620_100037096 Ga0097620_1000370961 245
34 3300009094 Ga0111539_10539271 Ga0111539_105392712 245
35 3300009147 Ga0114129_10175366 Ga0114129_101753662 245
36 3300025885 Ga0207653_10055695 Ga0207653_100556952 245
37 3300049576 Ga0501040_0033660 Ga0501040_0033660_2147_2893 245
38 3300049578 Ga0501042_0059044 Ga0501042_0059044_1496_2242 245
39 3300049586 Ga0501070_0082617 Ga0501070_0082617_130_876 245
40 3300049588 Ga0501072_0071230 Ga0501072_0071230_1320_2066 245
41 3300049593 Ga0501077_0016835 Ga0501077_0016835_2671_3417 245
42 3300049743 Ga0501081_0029021 Ga0501081_0029021_1862_2608 245
43 3300049824 Ga0501045_0079970 Ga0501045_0079970_1196_1942 245
44 3300050507 nmdc:mga05p37_52024_c1 nmdc:mga05p37_52024_c1_3823_4569 245
45 3300050508 nmdc:mga09592_12432_c1 nmdc:mga09592_12432_c1_564_1310 245
46 3300050510 nmdc:mga06r32_295266_c1 nmdc:mga06r32_295266_c1_552_1298 245
47 3300050510 nmdc:mga06r32_6349_c1 nmdc:mga06r32_6349_c1_5112_5858 245
48 3300050513 nmdc:mga0rr50_23304_c1 nmdc:mga0rr50_23304_c1_2607_3353 245
49 3300060353 Ga0501082_0031482 Ga0501082_0031482_544_1290 245
50 3300005439 Ga0070711_100004309 Ga0070711_1000043094 246
51 3300005536 Ga0070697_100032015 Ga0070697_1000320153 246
52 3300005937 Ga0081455_10009640 Ga0081455_100096406 246
53 3300005937 Ga0081455_10011291 Ga0081455_100112915 246
54 3300005937 Ga0081455_10456949 Ga0081455_104569491 246
55 3300006051 Ga0075364_10231116 Ga0075364_102311161 246
56 3300006173 Ga0070716_100044406 Ga0070716_1000444062 246
57 3300006175 Ga0070712_100033790 Ga0070712_1000337903 246
58 3300006195 Ga0075366_10146961 Ga0075366_101469611 246
59 3300006844 Ga0075428_100046171 Ga0075428_1000461712 246
60 3300006844 Ga0075428_100321989 Ga0075428_1003219892 246
61 3300006846 Ga0075430_100106178 Ga0075430_1001061783 246
62 3300006847 Ga0075431_100006064 Ga0075431_10000606411 246
63 3300006847 Ga0075431_100082083 Ga0075431_1000820833 246
64 3300006852 Ga0075433_10237014 Ga0075433_102370142 246
65 3300006880 Ga0075429_100249192 Ga0075429_1002491922 246
66 3300007788 Ga0099795_10033391 Ga0099795_100333912 246
67 3300007788 Ga0099795_10065441 Ga0099795_100654412 246
68 3300009147 Ga0114129_10044453 Ga0114129_100444535 246
69 3300009147 Ga0114129_10943635 Ga0114129_109436352 246
70 3300009553 Ga0105249_10144969 Ga0105249_101449692 246
71 3300010159 Ga0099796_10148905 Ga0099796_101489052 246
72 3300013306 Ga0163162_10094984 Ga0163162_100949843 246
73 3300025915 Ga0207693_10015328 Ga0207693_100153286 246
74 3300025939 Ga0207665_10006888 Ga0207665_100068885 246
75 3300027512 Ga0209179_1001549 Ga0209179_10015491 246
76 3300027512 Ga0209179_1049927 Ga0209179_10499271 246
77 3300027671 Ga0209588_1001381 Ga0209588_10013815 246
78 3300027671 Ga0209588_1062931 Ga0209588_10629311 246
79 3300031730 Ga0307516_10019632 Ga0307516_100196326 246
80 3300032002 Ga0307416_100302487 Ga0307416_1003024872 246
81 3300037418 Ga0395900_0105292 Ga0395900_0105292_619_1368 246
82 3300037466 Ga0395898_0014056 Ga0395898_0014056_2343_3092 246
83 3300038443 Ga0395901_0149165 Ga0395901_0149165_370_1119 246
84 3300041413 Ga0439465_0147557 Ga0439465_0147557_13_762 246
85 3300042001 Ga0439441_000385 Ga0439441_000385_3266_4015 246
86 3300046474 Ga0495605_0022269 Ga0495605_0022269_1500_2249 246
87 3300046491 Ga0495584_0060338 Ga0495584_0060338_750_1499 246
88 3300046523 Ga0495644_0006350 Ga0495644_0006350_3373_4122 246
89 3300046539 Ga0495621_0173987 Ga0495621_0173987_37_786 246
90 3300046615 Ga0495656_0024593 Ga0495656_0024593_844_1593 246
91 3300046660 Ga0495625_0138844 Ga0495625_0138844_440_1189 246
92 3300046664 Ga0495659_0022605 Ga0495659_0022605_892_1641 246
93 3300046691 Ga0495670_0163127 Ga0495670_0163127_385_1134 246
94 3300047318 Ga0495636_0121707 Ga0495636_0121707_232_981 246
95 3300048091 Ga0495626_0127776 Ga0495626_0127776_101_850 246
96 3300048905 Ga0496102_0204631 Ga0496102_0204631_576_1325 246
97 3300048910 Ga0496107_0150493 Ga0496107_0150493_797_1546 246
98 3300049572 Ga0501036_0116115 Ga0501036_0116115_885_1634 246
99 3300049576 Ga0501040_0227352 Ga0501040_0227352_65_814 246
100 3300049580 Ga0501046_0087356 Ga0501046_0087356_1269_2018 246
101 3300049582 Ga0501048_0356813 Ga0501048_0356813_78_827 246
102 3300049584 Ga0501068_0059882 Ga0501068_0059882_968_1717 246
103 3300049587 Ga0501071_0083520 Ga0501071_0083520_1057_1806 246
104 3300049588 Ga0501072_0181281 Ga0501072_0181281_477_1226 246
105 3300049591 Ga0501075_0476414 Ga0501075_0476414_185_934 246
106 3300049592 Ga0501076_0060553 Ga0501076_0060553_2173_2922 246
107 3300049593 Ga0501077_0004079 Ga0501077_0004079_6367_7116 246
108 3300049741 Ga0501079_0263927 Ga0501079_0263927_366_1115 246
109 3300049824 Ga0501045_0164367 Ga0501045_0164367_399_1148 246
110 3300050507 nmdc:mga05p37_13365_c1 nmdc:mga05p37_13365_c1_7447_8196 246
111 3300050508 nmdc:mga09592_92137_c1 nmdc:mga09592_92137_c1_640_1389 246
112 3300050509 nmdc:mga0qj67_12765_c1 nmdc:mga0qj67_12765_c1_526_1275 246
113 3300050509 nmdc:mga0qj67_14402_c1 nmdc:mga0qj67_14402_c1_3363_4112 246
114 3300050509 nmdc:mga0qj67_81930_c1 nmdc:mga0qj67_81930_c1_387_1136 246
115 3300050510 nmdc:mga06r32_15820_c1 nmdc:mga06r32_15820_c1_4304_5053 246
116 3300050510 nmdc:mga06r32_45933_c1 nmdc:mga06r32_45933_c1_1879_2628 246
117 3300050510 nmdc:mga06r32_6053_c1 nmdc:mga06r32_6053_c1_3270_4019 246
118 3300050510 nmdc:mga06r32_72431_c1 nmdc:mga06r32_72431_c1_1458_2207 246
119 3300050511 nmdc:mga08y16_560658_c1 nmdc:mga08y16_560658_c1_283_1032 246
120 3300054114 Ga0501084_0191134 Ga0501084_0191134_182_931 246
121 3300060353 Ga0501082_0127442 Ga0501082_0127442_858_1607 246
122 3300061734 Ga0530510_0037145 Ga0530510_0037145_1701_2450 246
123 3300061734 Ga0530510_0352064 Ga0530510_0352064_270_1019 246
124 3300005295 Ga0065707_10019456 Ga0065707_100194562 247
125 3300005331 Ga0070670_100313416 Ga0070670_1003134162 247
126 3300005340 Ga0070689_100104790 Ga0070689_1001047903 247
127 3300005347 Ga0070668_100446564 Ga0070668_1004465641 247
128 3300005364 Ga0070673_100147065 Ga0070673_1001470652 247
129 3300005365 Ga0070688_100186864 Ga0070688_1001868642 247
130 3300005366 Ga0070659_100177295 Ga0070659_1001772952 247
131 3300005467 Ga0070706_100106728 Ga0070706_1001067282 247
132 3300005577 Ga0068857_100156370 Ga0068857_1001563702 247
133 3300005617 Ga0068859_100057919 Ga0068859_1000579195 247
134 3300005841 Ga0068863_100064509 Ga0068863_1000645092 247
135 3300005842 Ga0068858_100079562 Ga0068858_1000795622 247
136 3300005844 Ga0068862_100292127 Ga0068862_1002921272 247
137 3300005981 Ga0081538_10003458 Ga0081538_100034586 247
138 3300005985 Ga0081539_10011007 Ga0081539_100110072 247
139 3300006844 Ga0075428_100003227 Ga0075428_1000032275 247
140 3300006844 Ga0075428_100053656 Ga0075428_1000536562 247
141 3300006847 Ga0075431_100001233 Ga0075431_10000123323 247
142 3300006880 Ga0075429_100003717 Ga0075429_10000371713 247
143 3300006931 Ga0097620_100057919 Ga0097620_1000579192 247
144 3300009094 Ga0111539_10003310 Ga0111539_1000331022 247
145 3300009094 Ga0111539_10486200 Ga0111539_104862002 247
146 3300009098 Ga0105245_10233168 Ga0105245_102331682 247
147 3300009101 Ga0105247_10040633 Ga0105247_100406332 247
148 3300009147 Ga0114129_10000199 Ga0114129_1000019922 247
149 3300009148 Ga0105243_10023629 Ga0105243_100236294 247
150 3300009553 Ga0105249_10221693 Ga0105249_102216932 247
151 3300009553 Ga0105249_10563167 Ga0105249_105631672 247
152 3300014325 Ga0163163_10071739 Ga0163163_100717394 247
153 3300014325 Ga0163163_10650505 Ga0163163_106505051 247
154 3300014326 Ga0157380_10103736 Ga0157380_101037361 247
155 3300025900 Ga0207710_10043844 Ga0207710_100438442 247
156 3300025901 Ga0207688_10043171 Ga0207688_100431712 247
157 3300025910 Ga0207684_10113752 Ga0207684_101137523 247
158 3300025925 Ga0207650_10020053 Ga0207650_100200534 247
159 3300025932 Ga0207690_10514509 Ga0207690_105145092 247
160 3300025935 Ga0207709_10037184 Ga0207709_100371842 247
161 3300025942 Ga0207689_10021878 Ga0207689_100218783 247
162 3300026116 Ga0207674_10074288 Ga0207674_100742882 247
163 3300027907 Ga0207428_10056788 Ga0207428_100567882 247
164 3300041408 Ga0439453_0001497 Ga0439453_0001497_280_1032 247
165 3300042001 Ga0439441_003578 Ga0439441_003578_1378_2130 247
166 3300042006 Ga0439432_048570 Ga0439432_048570_153_905 247
167 3300042435 Ga0439434_0011129 Ga0439434_0011129_1488_2240 247
168 3300050507 nmdc:mga05p37_383_c1 nmdc:mga05p37_383_c1_24216_24968 247
169 3300050507 nmdc:mga05p37_682150_c1 nmdc:mga05p37_682150_c1_37_789 247
170 3300050508 nmdc:mga09592_2227_c1 nmdc:mga09592_2227_c1_9945_10697 247
171 3300050509 nmdc:mga0qj67_6762_c1 nmdc:mga0qj67_6762_c1_7664_8416 247
172 3300050510 nmdc:mga06r32_711_c2 nmdc:mga06r32_711_c2_19107_19859 247
173 3300050511 nmdc:mga08y16_369_c1 nmdc:mga08y16_369_c1_20303_21055 247
174 3300042009 Ga0439451_006315 Ga0439451_006315_1444_2199 248
175 3300049590 Ga0501074_0348883 Ga0501074_0348883_164_1027 248
176 iso_pu_bacteria 2524023205 2524442409 249
177 iso_pu_bacteria 2744054633 2745078290 249
178 iso_pu_bacteria 2857576091 2857580869 249
179 iso_pu_bacteria 2885409591 2885418375 249
180 iso_pu_bacteria 2922368715 2922371482 249
181 iso_pu_bacteria 2935638405 2935646731 249
182 iso_pu_bacteria 2935665750 2935674824 249
183 iso_pu_bacteria 2935675223 2935681032 249
184 iso_pu_bacteria 2935684952 2935690644 249
185 iso_pu_bacteria 2935713505 2935717660 249
186 iso_pu_bacteria 2935722832 2935727190 249
187 iso_pu_bacteria 2935732158 2935735960 249
188 iso_pu_bacteria 2935741537 2935744769 249
189 iso_pu_bacteria 2935750917 2935755653 249
190 iso_pu_bacteria 2935827899 2935836079 249
191 iso_pu_bacteria 2940556831 2940561066 249
192 3300006847 Ga0075431_100044648 Ga0075431_1000446483 250
193 iso_pu_bacteria 2643221594 2643979814 250
194 iso_pu_bacteria 2643221683 2644469501 250
195 iso_pu_bacteria 2808606395 2809033760 250
196 iso_pu_bacteria 2858950400 2858956361 250
197 iso_pu_bacteria 2941479691 2941484870 250
198 3300006177 Ga0075362_10038190 Ga0075362_100381903 251
199 3300049575 Ga0501039_0238524 Ga0501039_0238524_453_1217 251
200 3300050489 nmdc:mga03683_28308_c1 nmdc:mga03683_28308_c1_1238_2002 251
201 iso_pu_bacteria 2841760612 2841765986 251
202 iso_pu_bacteria 2844104063 2844105752 251
203 iso_pu_bacteria 2851182111 2851185396 251
204 iso_pu_bacteria 2851246043 2851246108 251
205 iso_pu_bacteria 2917699015 2917703916 251
206 3300005367 Ga0070667_100796986 Ga0070667_1007969861 253
207 3300006186 Ga0075369_10025342 Ga0075369_100253422 253
208 3300025297 Ga0209758_1003502 Ga0209758_10035025 253
209 3300031903 Ga0307407_10115086 Ga0307407_101150862 253
210 3300032002 Ga0307416_100060737 Ga0307416_1000607374 253
211 3300032126 Ga0307415_100049886 Ga0307415_1000498863 253
212 3300037418 Ga0395900_0025485 Ga0395900_0025485_2601_3362 253
213 3300037466 Ga0395898_0179421 Ga0395898_0179421_1067_1828 253
214 3300038443 Ga0395901_0088446 Ga0395901_0088446_398_1159 253
215 3300048920 Ga0496117_0080639 Ga0496117_0080639_479_1243 253
216 3300048924 Ga0496121_0005175 Ga0496121_0005175_8553_9317 253
217 3300048929 Ga0496126_0436873 Ga0496126_0436873_147_911 253
218 3300050516 nmdc:mga0sz30_117077_c1 nmdc:mga0sz30_117077_c1_302_1069 253
219 3300053093 Ga0500651_0013124 Ga0500651_0013124_150_914 253
220 3300053118 Ga0500594_0016263 Ga0500594_0016263_171_935 253
221 3300053119 Ga0500595_001560 Ga0500595_001560_871_1635 253
222 3300053119 Ga0500595_003187 Ga0500595_003187_5814_6578 253
223 3300053130 Ga0500642_0014953 Ga0500642_0014953_323_1087 253
224 3300053139 Ga0500568_0067016 Ga0500568_0067016_167_931 253
225 3300003771 Ga0055526_1000319 Ga0055526_100031911 254
226 3300003775 Ga0055524_1000042 Ga0055524_100004219 254
227 3300006186 Ga0075369_10219534 Ga0075369_102195342 254
228 3300025261 Ga0209233_1033907 Ga0209233_10339072 254
229 3300025272 Ga0209455_1000822 Ga0209455_100082215 254
230 3300025273 Ga0209673_1044054 Ga0209673_10440542 254
231 3300025291 Ga0209675_1001192 Ga0209675_10011922 254
232 3300025294 Ga0209025_1000014 Ga0209025_1000014244 254
233 3300025295 Ga0209564_1000077 Ga0209564_1000077248 254
234 3300025298 Ga0209050_1007446 Ga0209050_10074462 254
235 3300025299 Ga0209256_1000057 Ga0209256_1000057248 254
236 3300025303 Ga0209051_1004568 Ga0209051_10045682 254
237 3300027312 Ga0209371_1004961 Ga0209371_10049614 254
238 3300028794 Ga0307515_10298318 Ga0307515_102983181 254
239 3300030500 Ga0268256_1004790 Ga0268256_10047905 254
240 3300031456 Ga0307513_10157774 Ga0307513_101577742 254
241 3300031731 Ga0307405_10003144 Ga0307405_100031442 254
242 3300037312 Ga0395899_0120389 Ga0395899_0120389_204_968 254
243 3300037418 Ga0395900_0141291 Ga0395900_0141291_1653_2417 254
244 3300044683 Ga0466965_0262721 Ga0466965_0262721_151_915 254
245 3300048920 Ga0496117_0019233 Ga0496117_0019233_2193_2957 254
246 3300048921 Ga0496118_0021349 Ga0496118_0021349_1049_1813 254
247 3300048924 Ga0496121_0000153 Ga0496121_0000153_78865_79629 254
248 3300048928 Ga0496125_0169652 Ga0496125_0169652_446_1252 254
249 3300048929 Ga0496126_0043221 Ga0496126_0043221_1591_2397 254
250 3300049569 Ga0501032_0296790 Ga0501032_0296790_23_787 254
251 3300049569 Ga0501032_0321790 Ga0501032_0321790_212_976 254
252 3300049570 Ga0501033_0026002 Ga0501033_0026002_3293_4057 254
253 3300049570 Ga0501033_0160281 Ga0501033_0160281_259_1023 254
254 3300049571 Ga0501034_0015990 Ga0501034_0015990_2066_2830 254
255 3300049571 Ga0501034_0421379 Ga0501034_0421379_453_1217 254
256 3300049571 Ga0501034_0445366 Ga0501034_0445366_352_1116 254
257 3300049572 Ga0501036_0086307 Ga0501036_0086307_65_829 254
258 3300049573 Ga0501037_0025462 Ga0501037_0025462_1034_1798 254
259 3300049573 Ga0501037_0049679 Ga0501037_0049679_440_1204 254
260 3300049579 Ga0501043_0011190 Ga0501043_0011190_339_1103 254
261 3300049579 Ga0501043_0026972 Ga0501043_0026972_1315_2079 254
262 3300049580 Ga0501046_0093640 Ga0501046_0093640_165_929 254
263 3300049581 Ga0501047_0004851 Ga0501047_0004851_7943_8707 254
264 3300053108 Ga0500562_018983 Ga0500562_018983_736_1500 254
265 3300053109 Ga0500569_131787 Ga0500569_131787_32_796 254
266 3300053121 Ga0500607_008340 Ga0500607_008340_2031_2831 254
267 3300053153 Ga0500616_0017366 Ga0500616_0017366_1669_2553 254
268 iso_pu_bacteria 2599185214 2599622332 254
269 iso_pu_bacteria 2599185226 2599674576 254
270 iso_pu_bacteria 2599185227 2599680261 254
271 iso_pu_bacteria 2599185229 2599692277 254
272 iso_pu_bacteria 2885198086 2885202371 254
273 iso_pu_bacteria 2885211737 2885216024 254
274 iso_pu_bacteria 2899924645 2899929852 254
275 iso_pu_bacteria 2904449895 2904451716 254
276 iso_pu_bacteria 2904456579 2904461795 254
277 iso_pu_bacteria 2904541872 2904546511 254
278 iso_pu_bacteria 2928051484 2928054556 254
279 iso_pu_bacteria 2928064002 2928070144 254
280 iso_pu_bacteria 2928070936 2928074237 254
281 iso_pu_bacteria 2929160207 2929165957 254
282 3300003187 JGI25151J46595_10005063 JGI25151J46595_100050634 258
283 3300003323 rootH1_10044200 rootH1_100442002 258
284 3300003792 Ga0055540_1001698 Ga0055540_10016989 258
285 3300005366 Ga0070659_100401572 Ga0070659_1004015722 258
286 3300006048 Ga0075363_100140556 Ga0075363_1001405562 258
287 3300006177 Ga0075362_10000635 Ga0075362_100006356 258
288 3300009093 Ga0105240_10238294 Ga0105240_102382942 258
289 3300009148 Ga0105243_10227626 Ga0105243_102276262 258
290 3300009545 Ga0105237_10042744 Ga0105237_100427443 258
291 3300010375 Ga0105239_10161513 Ga0105239_101615133 258
292 3300013100 Ga0157373_10108162 Ga0157373_101081622 258
293 3300013105 Ga0157369_10073916 Ga0157369_100739162 258
294 3300015261 Ga0182006_1025936 Ga0182006_10259363 258
295 3300025294 Ga0209025_1000145 Ga0209025_100014595 258
296 3300025297 Ga0209758_1090594 Ga0209758_10905941 258
297 3300025303 Ga0209051_1000284 Ga0209051_100028472 258
298 3300025913 Ga0207695_10370299 Ga0207695_103702991 258
299 3300025924 Ga0207694_10075276 Ga0207694_100752763 258
300 3300025949 Ga0207667_10393161 Ga0207667_103931612 258
301 3300046453 Ga0495627_004726 Ga0495627_004726_4405_5196 258
302 3300048925 Ga0496122_0109184 Ga0496122_0109184_71_850 258
303 3300048926 Ga0496123_0071534 Ga0496123_0071534_151_927 258
304 3300048927 Ga0496124_0073620 Ga0496124_0073620_1178_1954 258
305 3300050489 nmdc:mga03683_1802_c1 nmdc:mga03683_1802_c1_5156_5932 258
306 3300050490 nmdc:mga03n38_119532_c1 nmdc:mga03n38_119532_c1_219_995 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

192

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

265

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9479 5 236
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9464 5 236
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9423 7 236
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9422 7 236
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9398 7 236
ID Description Score Start End Superfamily
af_Q60273_1_105_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9369 169 212 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 6 249 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9315 5 236 3.40.50.300
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9305 7 244 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 3 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538JJF5-F1-model_v4 ABC transporter ATP-binding protein 0.9629 6 248 GO:0005524
GO:0005886
GO:0016887
AF-A0A6I3I9P9-F1-model_v4 deleted 0.9422 2 196
AF-A0A364P0C7-F1-model_v4 ABC transporter ATP-binding protein 0.9406 7 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A1Y3N5W7-F1-model_v4 ABC transporter domain-containing protein 0.9388 21 236 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A7W0CJP9-F1-model_v4 Iron complex transport system ATP-binding protein 0.9372 5 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.6 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map