F398333

General Info

Members Datasets Scaffolds Average Seq Length
305 197 303 76

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_1642043|Ga0501034_1642043_17_295
Length 92
Sequence MFYFLPMEVGAMRVSEKGQVTIPGEIRRSAGLLPGTEVEFVQEGGEVRLRRKERGRRPTRREGEVSSALERLRGSATIRMSTDEIMALTRGG

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
135 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.98
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 2.62
Rhizosphere 95.08
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005574 3300003214 Bacteria 2400
2 rootH2_10253690 3300003320 Bacteria 1444
3 Ga0065704_10391061 3300005289 Unclassified 762
4 Ga0065712_10776449 3300005290 Bacteria 501
5 Ga0065707_10162100 3300005295 Bacteria 1554
6 Ga0070676_10566241 3300005328 Archaea 815
7 Ga0070676_11541830 3300005328 Bacteria 512
8 Ga0070683_100004698 3300005329 Bacteria 11288
9 Ga0070690_100223275 3300005330 Bacteria 1321
10 Ga0070670_101943260 3300005331 Unclassified 542
11 Ga0068869_100160167 3300005334 Unclassified 1751
12 Ga0068869_100901993 3300005334 Bacteria 765
13 Ga0070666_10909595 3300005335 Unclassified 651
14 Ga0070680_100111100 3300005336 Bacteria 2281
15 Ga0068868_100114287 3300005338 Bacteria 2196
16 Ga0068868_100417759 3300005338 Unclassified 1161
17 Ga0068868_100891832 3300005338 Unclassified 808
18 Ga0068868_102327119 3300005338 Unclassified 511
19 Ga0070689_100201843 3300005340 Bacteria 1624
20 Ga0070661_101196886 3300005344 Bacteria 635
21 Ga0070661_101451558 3300005344 Unclassified 578
22 Ga0070669_100699402 3300005353 Unclassified 856
23 Ga0070675_100762255 3300005354 Unclassified 883
24 Ga0070675_101137101 3300005354 Unclassified 718
25 Ga0070688_100874826 3300005365 Unclassified 707
26 Ga0070703_10056767 3300005406 Bacteria 1269
27 Ga0070703_10462631 3300005406 Unclassified 564
28 Ga0070701_10123488 3300005438 Bacteria 1462
29 Ga0070705_100320499 3300005440 Bacteria 1119
30 Ga0070700_100048933 3300005441 Bacteria 2622
31 Ga0070694_100177413 3300005444 Bacteria 1574
32 Ga0070694_100310447 3300005444 Bacteria 1211
33 Ga0070694_101261757 3300005444 Unclassified 620
34 Ga0070708_100009524 3300005445 Bacteria 7831
35 Ga0070708_100624465 3300005445 Bacteria 1016
36 Ga0070708_101031953 3300005445 Viruses 771
37 Ga0070681_10799895 3300005458 Unclassified 860
38 Ga0068867_100164676 3300005459 Bacteria 1751
39 Ga0070706_102067013 3300005467 Bacteria 515
40 Ga0070707_100498735 3300005468 Unclassified 1179
41 Ga0070707_101254565 3300005468 Bacteria 707
42 Ga0070707_101565659 3300005468 Bacteria 626
43 Ga0070698_100400279 3300005471 Unclassified 1306
44 Ga0070698_100469503 3300005471 Unclassified 1195
45 Ga0070699_102221062 3300005518 Bacteria 501
46 Ga0070684_100163315 3300005535 Bacteria 2021
47 Ga0070697_100041111 3300005536 Bacteria 3741
48 Ga0070697_101349351 3300005536 Bacteria 636
49 Ga0070686_100287977 3300005544 Bacteria 1214
50 Ga0070686_101716705 3300005544 Unclassified 533
51 Ga0070695_100254430 3300005545 Unclassified 1280
52 Ga0070695_100744139 3300005545 Archaea 781
53 Ga0070695_100995810 3300005545 Unclassified 681
54 Ga0070696_100234811 3300005546 Bacteria 1381
55 Ga0070696_100258336 3300005546 Bacteria 1320
56 Ga0070704_100266806 3300005549 Bacteria 1412
57 Ga0070704_100285066 3300005549 Bacteria 1370
58 Ga0070704_101381943 3300005549 Bacteria 646
59 Ga0070664_100128350 3300005564 Bacteria 2226
60 Ga0070664_100149014 3300005564 Bacteria 2065
61 Ga0068857_100227168 3300005577 Bacteria 1706
62 Ga0068857_101034184 3300005577 Unclassified 791
63 Ga0068857_101047602 3300005577 Unclassified 786
64 Ga0068852_100179740 3300005616 Unclassified 1989
65 Ga0068859_100126190 3300005617 Bacteria 2628
66 Ga0068859_100544104 3300005617 Bacteria 1256
67 Ga0068859_102878664 3300005617 Unclassified 527
68 Ga0068864_100420258 3300005618 Bacteria 1274
69 Ga0068864_100477943 3300005618 Bacteria 1196
70 Ga0068864_102018664 3300005618 Unclassified 583
71 Ga0068861_100230253 3300005719 Bacteria 1571
72 Ga0068861_100706542 3300005719 Unclassified 937
73 Ga0068861_102000681 3300005719 Unclassified 578
74 Ga0068870_10118906 3300005840 Unclassified 1519
75 Ga0068863_100432452 3300005841 Bacteria 1290
76 Ga0068863_100967832 3300005841 Unclassified 853
77 Ga0068858_100298322 3300005842 Bacteria 1537
78 Ga0068860_100110161 3300005843 Bacteria 2631
79 Ga0068860_100666415 3300005843 Bacteria 1049
80 Ga0068860_101335836 3300005843 Bacteria 738
81 Ga0068860_101915268 3300005843 Bacteria 614
82 Ga0068862_100071331 3300005844 Bacteria 2999
83 Ga0068862_100169291 3300005844 Bacteria 1955
84 Ga0068862_101749279 3300005844 Bacteria 630
85 Ga0075432_10524385 3300006058 Unclassified 531
86 Ga0070716_100888094 3300006173 Bacteria 697
87 Ga0097621_100465247 3300006237 Unclassified 1141
88 Ga0097621_101730970 3300006237 Unclassified 595
89 Ga0068871_100456570 3300006358 Bacteria 1146
90 Ga0075433_11468156 3300006852 Unclassified 589
91 Ga0075434_100522857 3300006871 Bacteria 1207
92 Ga0075429_100413679 3300006880 Bacteria 1181
93 Ga0068865_100188749 3300006881 Bacteria 1592
94 Ga0097620_100126178 3300006931 Bacteria 2628
95 Ga0097620_100544091 3300006931 Bacteria 1256
96 Ga0097620_102878508 3300006931 Unclassified 527
97 Ga0099794_10008321 3300007265 Bacteria 4302
98 Ga0111539_10017323 3300009094 Bacteria 8916
99 Ga0111539_10794965 3300009094 Bacteria 1101
100 Ga0105245_12549600 3300009098 Archaea 565
101 Ga0105247_10447386 3300009101 Unclassified 931
102 Ga0114129_10383247 3300009147 Bacteria 1856
103 Ga0114129_11055969 3300009147 Bacteria 1019
104 Ga0105241_12419608 3300009174 Unclassified 525
105 Ga0105242_10706099 3300009176 Bacteria 987
106 Ga0105242_13086660 3300009176 Bacteria 516
107 Ga0105248_10116884 3300009177 Unclassified 3008
108 Ga0105248_10195120 3300009177 Bacteria 2281
109 Ga0105237_12044513 3300009545 Unclassified 582
110 Ga0105238_11452499 3300009551 Unclassified 714
111 Ga0105249_10057983 3300009553 Bacteria 3549
112 Ga0105239_12076691 3300010375 Unclassified 660
113 Ga0157374_10141730 3300013296 Bacteria 2334
114 Ga0157374_10252238 3300013296 Unclassified 1737
115 Ga0157378_10553287 3300013297 Bacteria 1156
116 Ga0163162_10364098 3300013306 Bacteria 1579
117 Ga0157372_10447832 3300013307 Plasmid 1505
118 Ga0157375_11506672 3300013308 Unclassified 794
119 Ga0157375_11630819 3300013308 Unclassified 763
120 Ga0163163_12723588 3300014325 Unclassified 551
121 Ga0157380_10002828 3300014326 Bacteria 11801
122 Ga0157380_10593109 3300014326 Unclassified 1095
123 Ga0157380_13256951 3300014326 Bacteria 519
124 Ga0157379_10766919 3300014968 Bacteria 909
125 Ga0157379_11156828 3300014968 Bacteria 743
126 Ga0163161_10422099 3300017792 Bacteria 1073
127 Ga0207688_10278664 3300025901 Bacteria 1018
128 Ga0207688_10287985 3300025901 Bacteria 1002
129 Ga0207680_10450146 3300025903 Unclassified 914
130 Ga0207645_10666288 3300025907 Bacteria 707
131 Ga0207643_10123378 3300025908 Unclassified 1536
132 Ga0207707_10968350 3300025912 Unclassified 700
133 Ga0207649_11267252 3300025920 Unclassified 583
134 Ga0207646_10398601 3300025922 Unclassified 1243
135 Ga0207681_11718878 3300025923 Unclassified 524
136 Ga0207681_11776471 3300025923 Unclassified 515
137 Ga0207650_11240242 3300025925 Unclassified 635
138 Ga0207659_10454047 3300025926 Unclassified 1080
139 Ga0207690_11871333 3300025932 Unclassified 501
140 Ga0207670_10201859 3300025936 Bacteria 1511
141 Ga0207665_10068513 3300025939 Bacteria 2418
142 Ga0207711_11858253 3300025941 Unclassified 545
143 Ga0207689_10007895 3300025942 Bacteria 9294
144 Ga0207689_10515063 3300025942 Bacteria 1003
145 Ga0207689_10606094 3300025942 Unclassified 921
146 Ga0207661_10001960 3300025944 Bacteria 14161
147 Ga0207679_10390695 3300025945 Unclassified 1222
148 Ga0207679_10424210 3300025945 Bacteria 1174
149 Ga0207712_10275140 3300025961 Bacteria 1372
150 Ga0207677_10000019 3300026023 Bacteria 138434
151 Ga0207677_10323552 3300026023 Unclassified 1282
152 Ga0207677_11038220 3300026023 Bacteria 745
153 Ga0207703_10425318 3300026035 Bacteria 1236
154 Ga0207641_10055206 3300026088 Bacteria 3373
155 Ga0207641_11288488 3300026088 Unclassified 731
156 Ga0207641_11660087 3300026088 Bacteria 641
157 Ga0207648_10188800 3300026089 Bacteria 1826
158 Ga0207676_10351551 3300026095 Bacteria 1363
159 Ga0207676_11067858 3300026095 Unclassified 797
160 Ga0207676_11758150 3300026095 Unclassified 618
161 Ga0207676_12119232 3300026095 Bacteria 561
162 Ga0207674_10136500 3300026116 Bacteria 2414
163 Ga0207675_100138434 3300026118 Bacteria 2311
164 Ga0207675_100854812 3300026118 Unclassified 925
165 Ga0207675_101419593 3300026118 Unclassified 715
166 Ga0207698_10507407 3300026142 Unclassified 1175
167 Ga0209588_1068868 3300027671 Bacteria 1143
168 Ga0209998_10019368 3300027717 Bacteria 1450
169 Ga0207428_10334911 3300027907 Bacteria 1115
170 Ga0268265_10037280 3300028380 Bacteria 3567
171 Ga0268265_11125969 3300028380 Bacteria 780
172 Ga0268264_10112769 3300028381 Bacteria 2384
173 Ga0268264_10631093 3300028381 Unclassified 1059
174 Ga0268264_10776776 3300028381 Unclassified 956
175 Ga0268264_11207907 3300028381 Unclassified 766
176 Ga0265323_10025597 3300028653 Bacteria 2231
177 Ga0265330_10004332 3300031235 Bacteria 7216
178 Ga0265328_10156589 3300031239 Unclassified 858
179 Ga0265325_10176680 3300031241 Unclassified 996
180 Ga0265325_10387365 3300031241 Bacteria 614
181 Ga0265329_10000577 3300031242 Bacteria 18976
182 Ga0265339_10012769 3300031249 Bacteria 5107
183 Ga0265339_10097714 3300031249 Bacteria 1532
184 Ga0265339_10238526 3300031249 Unclassified 884
185 Ga0265327_10115373 3300031251 Bacteria 1278
186 Ga0265327_10184643 3300031251 Unclassified 952
187 Ga0265316_10000313 3300031344 Bacteria 53907
188 Ga0265316_10367141 3300031344 Unclassified 1040
189 Ga0265316_10754729 3300031344 Bacteria 684
190 Ga0307513_10853651 3300031456 Bacteria 617
191 Ga0316575_10048945 3300031665 Unclassified 1682
192 Ga0316575_10052007 3300031665 Bacteria 1631
193 Ga0316579_10024896 3300031691 Bacteria 2697
194 Ga0316579_10036739 3300031691 Bacteria 2260
195 Ga0316579_10508231 3300031691 Bacteria 583
196 Ga0316579_10542494 3300031691 Bacteria 563
197 Ga0265314_10017819 3300031711 Bacteria 5563
198 Ga0265342_10000325 3300031712 Bacteria 53808
199 Ga0265342_10007175 3300031712 Bacteria 8200
200 Ga0316576_10015840 3300031727 Bacteria 5072
201 Ga0316578_10025067 3300031728 Bacteria 3349
202 Ga0316578_10154142 3300031728 Bacteria 1384
203 Ga0316577_10010794 3300031733 Bacteria 4938
204 Ga0307410_11891660 3300031852 Unclassified 531
205 Ga0307409_101259340 3300031995 Unclassified 764
206 Ga0307409_101673847 3300031995 Bacteria 665
207 Ga0307416_100679761 3300032002 Bacteria 1117
208 Ga0307411_10170866 3300032005 Bacteria 1639
209 Ga0307415_100641257 3300032126 Bacteria 951
210 Ga0316583_10001764 3300032133 Bacteria 7351
211 Ga0316585_10006830 3300032137 Bacteria 3273
212 Ga0316585_10070414 3300032137 Bacteria 1134
213 Ga0316580_10016744 3300032139 Bacteria 2250
214 Ga0316580_10049102 3300032139 Bacteria 1300
215 Ga0316580_10226994 3300032139 Unclassified 576
216 Ga0316593_10067970 3300032168 Bacteria 1229
217 Ga0316592_1021373 3300033524 Bacteria 1378
218 Ga0316596_1131718 3300033541 Bacteria 683
219 Ga0373945_0176831 3300035116 Unclassified 877
220 Ga0316574_0038974 3300035398 Bacteria 2919
221 Ga0316574_0069327 3300035398 Bacteria 2225
222 Ga0316582_0003462 3300036647 Bacteria 7745
223 Ga0316582_0003594 3300036647 Bacteria 7641
224 Ga0316584_0096722 3300036712 Bacteria 2210
225 Ga0395900_1543984 3300037418 Bacteria 576
226 Ga0395898_0366561 3300037466 Bacteria 1374
227 Ga0395901_0729146 3300038443 Bacteria 986
228 Ga0395901_1805350 3300038443 Bacteria 561
229 Ga0436360_0938100 3300039438 Bacteria 920
230 Ga0451853_0708262 3300041512 Unclassified 512
231 Ga0439460_0233132 3300042461 Bacteria 633
232 Ga0451577_0003161 3300042876 Bacteria 18544
233 Ga0451577_0743731 3300042876 Bacteria 887
234 Ga0451577_0768459 3300042876 Unclassified 871
235 Ga0451577_1432154 3300042876 Bacteria 612
236 Ga0451577_1514283 3300042876 Bacteria 593
237 Ga0453683_0004420 3300044673 Bacteria 9976
238 Ga0453684_0000555 3300044712 Bacteria 140770
239 Ga0453684_0230573 3300044712 Bacteria 2138
240 Ga0453684_2560707 3300044712 Unclassified 502
241 Ga0466959_0620013 3300045049 Bacteria 727
242 Ga0451576_1564000 3300045051 Bacteria 684
243 Ga0495641_0000005 3300046461 Bacteria 206626
244 Ga0495580_0632524 3300046472 Unclassified 705
245 Ga0495582_0052533 3300046473 Bacteria 2247
246 Ga0495584_0286422 3300046491 Unclassified 837
247 Ga0495608_0178106 3300046511 Bacteria 1346
248 Ga0495630_0022950 3300046517 Bacteria 4610
249 Ga0495648_0170241 3300046524 Bacteria 1117
250 Ga0495640_0074064 3300046533 Bacteria 2278
251 Ga0495640_0317149 3300046533 Bacteria 966
252 Ga0495586_0007639 3300046535 Bacteria 5767
253 Ga0495586_0165767 3300046535 Unclassified 1247
254 Ga0495645_0300584 3300046543 Bacteria 1049
255 Ga0495656_0369859 3300046615 Bacteria 746
256 Ga0495634_0054506 3300046642 Unclassified 2676
257 Ga0495634_0340180 3300046642 Unclassified 900
258 Ga0495659_0488380 3300046664 Unclassified 539
259 Ga0495599_0882041 3300046678 Bacteria 508
260 Ga0495647_0196408 3300046681 Unclassified 884
261 Ga0495658_0264316 3300046683 Bacteria 1083
262 Ga0495658_0579978 3300046683 Unclassified 718
263 Ga0495613_0076434 3300046689 Bacteria 2437
264 Ga0495613_0275059 3300046689 Unclassified 1170
265 Ga0495613_0890345 3300046689 Bacteria 576
266 Ga0495624_0479767 3300046690 Unclassified 744
267 Ga0495674_0111213 3300047319 Bacteria 2322
268 Ga0495674_1324646 3300047319 Unclassified 539
269 Ga0495676_0002855 3300047321 Bacteria 15572
270 Ga0495676_0277435 3300047321 Bacteria 1136
271 Ga0495684_0707012 3300047471 Unclassified 668
272 Ga0496100_0219685 3300048903 Unclassified 1394
273 Ga0496101_0585710 3300048904 Unclassified 882
274 Ga0496106_0311565 3300048909 Unclassified 1263
275 Ga0496106_0772431 3300048909 Unclassified 763
276 Ga0496108_0248329 3300048911 Bacteria 1548
277 Ga0496108_0646345 3300048911 Unclassified 920
278 Ga0496109_0334614 3300048912 Unclassified 1430
279 Ga0496114_0183223 3300048917 Bacteria 1829
280 Ga0496126_0033876 3300048929 Bacteria 4804
281 Ga0501034_0503610 3300049571 Bacteria 1124
282 Ga0501034_1642043 3300049571 Unclassified 515
283 Ga0501036_0855266 3300049572 Bacteria 748
284 Ga0501038_0659541 3300049574 Bacteria 787
285 Ga0501047_0644463 3300049581 Unclassified 879
286 Ga0501047_0850207 3300049581 Bacteria 726
287 Ga0501069_0229458 3300049585 Bacteria 1080
288 Ga0501071_0786336 3300049587 Bacteria 733
289 Ga0501075_0205838 3300049591 Bacteria 1501
290 Ga0501075_1166364 3300049591 Bacteria 585
291 Ga0501076_0339390 3300049592 Bacteria 1233
292 Ga0501076_0872157 3300049592 Bacteria 742
293 Ga0501077_0982418 3300049593 Bacteria 543
294 Ga0501080_0295283 3300049742 Unclassified 1471
295 Ga0501045_0640620 3300049824 Unclassified 786
296 Ga0501045_0912224 3300049824 Bacteria 645
297 nmdc:mga05p37_301050_c1 3300050507 Bacteria 1905
298 nmdc:mga09592_187665_c1 3300050508 Bacteria 1789
299 nmdc:mga08y16_23762_c1 3300050511 Bacteria 6471
300 nmdc:mga0n895_1014006_c1 3300050512 Unclassified 811
301 nmdc:mga0n895_541987_c1 3300050512 Bacteria 1170
302 Ga0501084_1012814 3300054114 Unclassified 698
303 Ga0530510_0352205 3300061734 Bacteria 1106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2558860112 2558911973 67
2 iso_pu_bacteria 2816332139 2816504170 67
3 3300031249 Ga0265339_10238526 Ga0265339_102385261 68
4 3300031251 Ga0265327_10184643 Ga0265327_101846432 68
5 3300035116 Ga0373945_0176831 Ga0373945_0176831_308_523 68
6 3300041512 Ga0451853_0708262 Ga0451853_0708262_100_315 68
7 3300046472 Ga0495580_0632524 Ga0495580_0632524_215_430 68
8 3300046473 Ga0495582_0052533 Ga0495582_0052533_523_738 68
9 3300046511 Ga0495608_0178106 Ga0495608_0178106_338_553 68
10 3300046517 Ga0495630_0022950 Ga0495630_0022950_1248_1463 68
11 3300046533 Ga0495640_0074064 Ga0495640_0074064_483_698 68
12 3300046533 Ga0495640_0317149 Ga0495640_0317149_153_368 68
13 3300046535 Ga0495586_0007639 Ga0495586_0007639_4558_4773 68
14 3300046535 Ga0495586_0165767 Ga0495586_0165767_394_609 68
15 3300046642 Ga0495634_0054506 Ga0495634_0054506_174_389 68
16 3300046642 Ga0495634_0340180 Ga0495634_0340180_606_821 68
17 3300046681 Ga0495647_0196408 Ga0495647_0196408_71_286 68
18 3300046683 Ga0495658_0264316 Ga0495658_0264316_261_476 68
19 3300046683 Ga0495658_0579978 Ga0495658_0579978_250_480 68
20 3300046689 Ga0495613_0076434 Ga0495613_0076434_1006_1221 68
21 3300046689 Ga0495613_0275059 Ga0495613_0275059_101_316 68
22 3300046689 Ga0495613_0890345 Ga0495613_0890345_232_447 68
23 3300046690 Ga0495624_0479767 Ga0495624_0479767_220_435 68
24 3300047319 Ga0495674_0111213 Ga0495674_0111213_1596_1811 68
25 3300047319 Ga0495674_1324646 Ga0495674_1324646_308_523 68
26 3300047321 Ga0495676_0277435 Ga0495676_0277435_509_724 68
27 3300047471 Ga0495684_0707012 Ga0495684_0707012_277_492 68
28 3300005290 Ga0065712_10776449 Ga0065712_107764491 69
29 3300005445 Ga0070708_100009524 Ga0070708_1000095247 69
30 3300005445 Ga0070708_100624465 Ga0070708_1006244652 69
31 3300005468 Ga0070707_100498735 Ga0070707_1004987353 69
32 3300005518 Ga0070699_102221062 Ga0070699_1022210621 69
33 3300005536 Ga0070697_100041111 Ga0070697_1000411111 69
34 3300006852 Ga0075433_11468156 Ga0075433_114681562 69
35 3300007265 Ga0099794_10008321 Ga0099794_100083212 69
36 3300009147 Ga0114129_11055969 Ga0114129_110559692 69
37 3300014326 Ga0157380_13256951 Ga0157380_132569512 69
38 3300025922 Ga0207646_10398601 Ga0207646_103986011 69
39 3300027671 Ga0209588_1068868 Ga0209588_10688682 69
40 3300031691 Ga0316579_10542494 Ga0316579_105424942 69
41 3300031852 Ga0307410_11891660 Ga0307410_118916601 69
42 3300037418 Ga0395900_1543984 Ga0395900_1543984_263_487 69
43 3300038443 Ga0395901_0729146 Ga0395901_0729146_643_867 69
44 3300042461 Ga0439460_0233132 Ga0439460_0233132_88_312 69
45 3300005289 Ga0065704_10391061 Ga0065704_103910612 70
46 3300005295 Ga0065707_10162100 Ga0065707_101621001 70
47 3300005328 Ga0070676_10566241 Ga0070676_105662412 70
48 3300005328 Ga0070676_11541830 Ga0070676_115418302 70
49 3300005329 Ga0070683_100004698 Ga0070683_10000469820 70
50 3300005330 Ga0070690_100223275 Ga0070690_1002232752 70
51 3300005334 Ga0068869_100901993 Ga0068869_1009019932 70
52 3300005336 Ga0070680_100111100 Ga0070680_1001111003 70
53 3300005338 Ga0068868_100114287 Ga0068868_1001142873 70
54 3300005338 Ga0068868_100891832 Ga0068868_1008918322 70
55 3300005338 Ga0068868_102327119 Ga0068868_1023271192 70
56 3300005340 Ga0070689_100201843 Ga0070689_1002018432 70
57 3300005344 Ga0070661_101196886 Ga0070661_1011968862 70
58 3300005353 Ga0070669_100699402 Ga0070669_1006994021 70
59 3300005354 Ga0070675_101137101 Ga0070675_1011371012 70
60 3300005365 Ga0070688_100874826 Ga0070688_1008748261 70
61 3300005406 Ga0070703_10056767 Ga0070703_100567672 70
62 3300005406 Ga0070703_10462631 Ga0070703_104626311 70
63 3300005438 Ga0070701_10123488 Ga0070701_101234881 70
64 3300005440 Ga0070705_100320499 Ga0070705_1003204993 70
65 3300005441 Ga0070700_100048933 Ga0070700_1000489333 70
66 3300005444 Ga0070694_100177413 Ga0070694_1001774132 70
67 3300005444 Ga0070694_101261757 Ga0070694_1012617572 70
68 3300005445 Ga0070708_101031953 Ga0070708_1010319531 70
69 3300005458 Ga0070681_10799895 Ga0070681_107998951 70
70 3300005459 Ga0068867_100164676 Ga0068867_1001646763 70
71 3300005468 Ga0070707_101565659 Ga0070707_1015656591 70
72 3300005471 Ga0070698_100400279 Ga0070698_1004002792 70
73 3300005471 Ga0070698_100469503 Ga0070698_1004695031 70
74 3300005535 Ga0070684_100163315 Ga0070684_1001633154 70
75 3300005536 Ga0070697_101349351 Ga0070697_1013493512 70
76 3300005544 Ga0070686_100287977 Ga0070686_1002879772 70
77 3300005544 Ga0070686_101716705 Ga0070686_1017167052 70
78 3300005545 Ga0070695_100254430 Ga0070695_1002544301 70
79 3300005545 Ga0070695_100744139 Ga0070695_1007441391 70
80 3300005546 Ga0070696_100234811 Ga0070696_1002348112 70
81 3300005546 Ga0070696_100258336 Ga0070696_1002583362 70
82 3300005549 Ga0070704_100266806 Ga0070704_1002668061 70
83 3300005549 Ga0070704_100285066 Ga0070704_1002850662 70
84 3300005549 Ga0070704_101381943 Ga0070704_1013819432 70
85 3300005564 Ga0070664_100149014 Ga0070664_1001490143 70
86 3300005577 Ga0068857_100227168 Ga0068857_1002271682 70
87 3300005577 Ga0068857_101034184 Ga0068857_1010341841 70
88 3300005617 Ga0068859_100126190 Ga0068859_1001261903 70
89 3300005617 Ga0068859_100544104 Ga0068859_1005441042 70
90 3300005617 Ga0068859_102878664 Ga0068859_1028786642 70
91 3300005618 Ga0068864_100420258 Ga0068864_1004202583 70
92 3300005618 Ga0068864_100477943 Ga0068864_1004779431 70
93 3300005719 Ga0068861_100230253 Ga0068861_1002302533 70
94 3300005719 Ga0068861_100706542 Ga0068861_1007065422 70
95 3300005719 Ga0068861_102000681 Ga0068861_1020006812 70
96 3300005840 Ga0068870_10118906 Ga0068870_101189063 70
97 3300005841 Ga0068863_100967832 Ga0068863_1009678322 70
98 3300005842 Ga0068858_100298322 Ga0068858_1002983222 70
99 3300005843 Ga0068860_100110161 Ga0068860_1001101613 70
100 3300005843 Ga0068860_100666415 Ga0068860_1006664153 70
101 3300005843 Ga0068860_101335836 Ga0068860_1013358361 70
102 3300005843 Ga0068860_101915268 Ga0068860_1019152682 70
103 3300005844 Ga0068862_100071331 Ga0068862_1000713314 70
104 3300005844 Ga0068862_100169291 Ga0068862_1001692912 70
105 3300005844 Ga0068862_101749279 Ga0068862_1017492792 70
106 3300006237 Ga0097621_100465247 Ga0097621_1004652472 70
107 3300006358 Ga0068871_100456570 Ga0068871_1004565701 70
108 3300006871 Ga0075434_100522857 Ga0075434_1005228573 70
109 3300006880 Ga0075429_100413679 Ga0075429_1004136792 70
110 3300006881 Ga0068865_100188749 Ga0068865_1001887493 70
111 3300006931 Ga0097620_100126178 Ga0097620_1001261783 70
112 3300006931 Ga0097620_100544091 Ga0097620_1005440912 70
113 3300006931 Ga0097620_102878508 Ga0097620_1028785082 70
114 3300009098 Ga0105245_12549600 Ga0105245_125496001 70
115 3300009101 Ga0105247_10447386 Ga0105247_104473861 70
116 3300009147 Ga0114129_10383247 Ga0114129_103832473 70
117 3300009176 Ga0105242_10706099 Ga0105242_107060992 70
118 3300009176 Ga0105242_13086660 Ga0105242_130866601 70
119 3300009177 Ga0105248_10195120 Ga0105248_101951202 70
120 3300009545 Ga0105237_12044513 Ga0105237_120445132 70
121 3300009553 Ga0105249_10057983 Ga0105249_100579832 70
122 3300010375 Ga0105239_12076691 Ga0105239_120766912 70
123 3300013297 Ga0157378_10553287 Ga0157378_105532872 70
124 3300013306 Ga0163162_10364098 Ga0163162_103640982 70
125 3300013307 Ga0157372_10447832 Ga0157372_104478324 70
126 3300013308 Ga0157375_11630819 Ga0157375_116308192 70
127 3300014968 Ga0157379_10766919 Ga0157379_107669191 70
128 3300014968 Ga0157379_11156828 Ga0157379_111568282 70
129 3300025907 Ga0207645_10666288 Ga0207645_106662882 70
130 3300025908 Ga0207643_10123378 Ga0207643_101233782 70
131 3300025912 Ga0207707_10968350 Ga0207707_109683502 70
132 3300025923 Ga0207681_11718878 Ga0207681_117188781 70
133 3300025923 Ga0207681_11776471 Ga0207681_117764712 70
134 3300025932 Ga0207690_11871333 Ga0207690_118713331 70
135 3300025936 Ga0207670_10201859 Ga0207670_102018593 70
136 3300025939 Ga0207665_10068513 Ga0207665_100685134 70
137 3300025941 Ga0207711_11858253 Ga0207711_118582532 70
138 3300025942 Ga0207689_10007895 Ga0207689_100078955 70
139 3300025942 Ga0207689_10515063 Ga0207689_105150632 70
140 3300025944 Ga0207661_10001960 Ga0207661_100019607 70
141 3300025945 Ga0207679_10424210 Ga0207679_104242102 70
142 3300025961 Ga0207712_10275140 Ga0207712_102751402 70
143 3300026023 Ga0207677_10000019 Ga0207677_1000001935 70
144 3300026023 Ga0207677_11038220 Ga0207677_110382202 70
145 3300026035 Ga0207703_10425318 Ga0207703_104253182 70
146 3300026088 Ga0207641_11288488 Ga0207641_112884881 70
147 3300026088 Ga0207641_11660087 Ga0207641_116600872 70
148 3300026089 Ga0207648_10188800 Ga0207648_101888002 70
149 3300026095 Ga0207676_11067858 Ga0207676_110678582 70
150 3300026095 Ga0207676_11758150 Ga0207676_117581502 70
151 3300026095 Ga0207676_12119232 Ga0207676_121192322 70
152 3300026116 Ga0207674_10136500 Ga0207674_101365004 70
153 3300026118 Ga0207675_100138434 Ga0207675_1001384343 70
154 3300026118 Ga0207675_100854812 Ga0207675_1008548122 70
155 3300026118 Ga0207675_101419593 Ga0207675_1014195931 70
156 3300027717 Ga0209998_10019368 Ga0209998_100193682 70
157 3300028380 Ga0268265_10037280 Ga0268265_100372802 70
158 3300028380 Ga0268265_11125969 Ga0268265_111259691 70
159 3300028381 Ga0268264_10112769 Ga0268264_101127693 70
160 3300028381 Ga0268264_10631093 Ga0268264_106310932 70
161 3300028381 Ga0268264_10776776 Ga0268264_107767762 70
162 3300028381 Ga0268264_11207907 Ga0268264_112079072 70
163 3300032002 Ga0307416_100679761 Ga0307416_1006797612 70
164 3300032126 Ga0307415_100641257 Ga0307415_1006412572 70
165 3300038443 Ga0395901_1805350 Ga0395901_1805350_40_264 70
166 3300046491 Ga0495584_0286422 Ga0495584_0286422_146_379 70
167 3300049585 Ga0501069_0229458 Ga0501069_0229458_564_785 70
168 3300049742 Ga0501080_0295283 Ga0501080_0295283_1123_1350 70
169 3300050507 nmdc:mga05p37_301050_c1 nmdc:mga05p37_301050_c1_1093_1320 70
170 3300050508 nmdc:mga09592_187665_c1 nmdc:mga09592_187665_c1_168_395 70
171 3300050512 nmdc:mga0n895_1014006_c1 nmdc:mga0n895_1014006_c1_413_643 70
172 3300050512 nmdc:mga0n895_541987_c1 nmdc:mga0n895_541987_c1_479_709 70
173 3300003320 rootH2_10253690 rootH2_102536902 71
174 3300005334 Ga0068869_100160167 Ga0068869_1001601673 71
175 3300005467 Ga0070706_102067013 Ga0070706_1020670131 71
176 3300006173 Ga0070716_100888094 Ga0070716_1008880942 71
177 3300009094 Ga0111539_10794965 Ga0111539_107949652 71
178 3300025942 Ga0207689_10606094 Ga0207689_106060942 71
179 3300031241 Ga0265325_10387365 Ga0265325_103873652 71
180 3300031344 Ga0265316_10754729 Ga0265316_107547292 71
181 3300031456 Ga0307513_10853651 Ga0307513_108536512 71
182 3300031712 Ga0265342_10007175 Ga0265342_100071752 71
183 3300031995 Ga0307409_101673847 Ga0307409_1016738472 71
184 3300042876 Ga0451577_0003161 Ga0451577_0003161_11267_11497 71
185 3300042876 Ga0451577_0743731 Ga0451577_0743731_38_268 71
186 3300042876 Ga0451577_1514283 Ga0451577_1514283_238_468 71
187 3300044673 Ga0453683_0004420 Ga0453683_0004420_4766_4999 71
188 3300044712 Ga0453684_0000555 Ga0453684_0000555_20804_21034 71
189 3300044712 Ga0453684_0230573 Ga0453684_0230573_301_534 71
190 3300044712 Ga0453684_2560707 Ga0453684_2560707_52_282 71
191 3300045049 Ga0466959_0620013 Ga0466959_0620013_352_579 71
192 3300045051 Ga0451576_1564000 Ga0451576_1564000_265_495 71
193 3300046524 Ga0495648_0170241 Ga0495648_0170241_211_444 71
194 3300048909 Ga0496106_0772431 Ga0496106_0772431_174_407 71
195 3300049571 Ga0501034_0503610 Ga0501034_0503610_776_1018 71
196 3300049572 Ga0501036_0855266 Ga0501036_0855266_363_605 71
197 3300049587 Ga0501071_0786336 Ga0501071_0786336_74_310 71
198 3300049591 Ga0501075_1166364 Ga0501075_1166364_73_309 71
199 3300049593 Ga0501077_0982418 Ga0501077_0982418_121_354 71
200 3300049824 Ga0501045_0912224 Ga0501045_0912224_82_318 71
201 3300005444 Ga0070694_100310447 Ga0070694_1003104471 72
202 3300006058 Ga0075432_10524385 Ga0075432_105243851 72
203 3300009094 Ga0111539_10017323 Ga0111539_100173235 72
204 3300009174 Ga0105241_12419608 Ga0105241_124196082 72
205 3300013296 Ga0157374_10141730 Ga0157374_101417304 72
206 3300014326 Ga0157380_10593109 Ga0157380_105931091 72
207 3300025901 Ga0207688_10278664 Ga0207688_102786642 72
208 3300027907 Ga0207428_10334911 Ga0207428_103349111 72
209 3300028653 Ga0265323_10025597 Ga0265323_100255973 72
210 3300031235 Ga0265330_10004332 Ga0265330_100043326 72
211 3300031239 Ga0265328_10156589 Ga0265328_101565892 72
212 3300031242 Ga0265329_10000577 Ga0265329_100005779 72
213 3300031249 Ga0265339_10012769 Ga0265339_100127693 72
214 3300031249 Ga0265339_10097714 Ga0265339_100977142 72
215 3300031344 Ga0265316_10000313 Ga0265316_1000031322 72
216 3300031344 Ga0265316_10367141 Ga0265316_103671411 72
217 3300031665 Ga0316575_10052007 Ga0316575_100520072 72
218 3300031691 Ga0316579_10024896 Ga0316579_100248962 72
219 3300031691 Ga0316579_10036739 Ga0316579_100367391 72
220 3300031711 Ga0265314_10017819 Ga0265314_100178195 72
221 3300031712 Ga0265342_10000325 Ga0265342_1000032512 72
222 3300031727 Ga0316576_10015840 Ga0316576_100158404 72
223 3300031728 Ga0316578_10025067 Ga0316578_100250675 72
224 3300031728 Ga0316578_10154142 Ga0316578_101541422 72
225 3300031733 Ga0316577_10010794 Ga0316577_100107942 72
226 3300032133 Ga0316583_10001764 Ga0316583_100017643 72
227 3300032137 Ga0316585_10006830 Ga0316585_100068304 72
228 3300032137 Ga0316585_10070414 Ga0316585_100704142 72
229 3300032139 Ga0316580_10016744 Ga0316580_100167443 72
230 3300032139 Ga0316580_10049102 Ga0316580_100491022 72
231 3300032168 Ga0316593_10067970 Ga0316593_100679701 72
232 3300033524 Ga0316592_1021373 Ga0316592_10213732 72
233 3300033541 Ga0316596_1131718 Ga0316596_11317182 72
234 3300035398 Ga0316574_0038974 Ga0316574_0038974_863_1087 72
235 3300035398 Ga0316574_0069327 Ga0316574_0069327_1988_2212 72
236 3300036647 Ga0316582_0003594 Ga0316582_0003594_5619_5843 72
237 3300036712 Ga0316584_0096722 Ga0316584_0096722_1770_1994 72
238 3300039438 Ga0436360_0938100 Ga0436360_0938100_87_323 72
239 3300042876 Ga0451577_1432154 Ga0451577_1432154_194_430 72
240 3300049574 Ga0501038_0659541 Ga0501038_0659541_391_657 72
241 3300049591 Ga0501075_0205838 Ga0501075_0205838_856_1095 72
242 3300049592 Ga0501076_0339390 Ga0501076_0339390_170_436 72
243 3300049592 Ga0501076_0872157 Ga0501076_0872157_454_693 72
244 3300049824 Ga0501045_0640620 Ga0501045_0640620_163_408 72
245 3300050511 nmdc:mga08y16_23762_c1 nmdc:mga08y16_23762_c1_4060_4308 72
246 3300054114 Ga0501084_1012814 Ga0501084_1012814_97_342 72
247 3300061734 Ga0530510_0352205 Ga0530510_0352205_362_601 72
248 3300009177 Ga0105248_10116884 Ga0105248_101168843 73
249 3300014326 Ga0157380_10002828 Ga0157380_1000282812 73
250 3300017792 Ga0163161_10422099 Ga0163161_104220992 73
251 3300031665 Ga0316575_10048945 Ga0316575_100489451 73
252 3300031691 Ga0316579_10508231 Ga0316579_105082311 73
253 3300031995 Ga0307409_101259340 Ga0307409_1012593402 73
254 3300032005 Ga0307411_10170866 Ga0307411_101708662 73
255 3300032139 Ga0316580_10226994 Ga0316580_102269942 73
256 3300036647 Ga0316582_0003462 Ga0316582_0003462_3897_4124 73
257 3300046461 Ga0495641_0000005 Ga0495641_0000005_186137_186391 73
258 3300046543 Ga0495645_0300584 Ga0495645_0300584_240_500 73
259 3300046678 Ga0495599_0882041 Ga0495599_0882041_227_487 73
260 3300047321 Ga0495676_0002855 Ga0495676_0002855_11089_11328 73
261 3300049581 Ga0501047_0644463 Ga0501047_0644463_175_429 73
262 3300005577 Ga0068857_101047602 Ga0068857_1010476021 74
263 3300013308 Ga0157375_11506672 Ga0157375_115066722 74
264 3300014325 Ga0163163_12723588 Ga0163163_127235882 74
265 3300025901 Ga0207688_10287985 Ga0207688_102879852 74
266 3300031241 Ga0265325_10176680 Ga0265325_101766802 74
267 3300046615 Ga0495656_0369859 Ga0495656_0369859_369_599 74
268 3300046664 Ga0495659_0488380 Ga0495659_0488380_165_395 74
269 3300048903 Ga0496100_0219685 Ga0496100_0219685_902_1132 74
270 3300048904 Ga0496101_0585710 Ga0496101_0585710_413_643 74
271 3300048909 Ga0496106_0311565 Ga0496106_0311565_129_359 74
272 3300048911 Ga0496108_0646345 Ga0496108_0646345_158_388 74
273 3300048912 Ga0496109_0334614 Ga0496109_0334614_461_691 74
274 3300048917 Ga0496114_0183223 Ga0496114_0183223_55_285 74
275 3300049571 Ga0501034_1642043 Ga0501034_1642043_17_295 74
276 3300049581 Ga0501047_0850207 Ga0501047_0850207_254_532 74
277 3300031251 Ga0265327_10115373 Ga0265327_101153734 75
278 3300042876 Ga0451577_0768459 Ga0451577_0768459_390_629 75
279 3300048929 Ga0496126_0033876 Ga0496126_0033876_4106_4339 75
280 3300003214 JGI25165J46597_1005574 JGI25165J46597_10055741 76
281 3300005331 Ga0070670_101943260 Ga0070670_1019432601 76
282 3300005335 Ga0070666_10909595 Ga0070666_109095951 76
283 3300005338 Ga0068868_100417759 Ga0068868_1004177591 76
284 3300005344 Ga0070661_101451558 Ga0070661_1014515581 76
285 3300005354 Ga0070675_100762255 Ga0070675_1007622551 76
286 3300005468 Ga0070707_101254565 Ga0070707_1012545652 76
287 3300005545 Ga0070695_100995810 Ga0070695_1009958102 76
288 3300005564 Ga0070664_100128350 Ga0070664_1001283502 76
289 3300005616 Ga0068852_100179740 Ga0068852_1001797403 76
290 3300005618 Ga0068864_102018664 Ga0068864_1020186642 76
291 3300005841 Ga0068863_100432452 Ga0068863_1004324522 76
292 3300006237 Ga0097621_101730970 Ga0097621_1017309702 76
293 3300009551 Ga0105238_11452499 Ga0105238_114524991 76
294 3300013296 Ga0157374_10252238 Ga0157374_102522383 76
295 3300025903 Ga0207680_10450146 Ga0207680_104501462 76
296 3300025920 Ga0207649_11267252 Ga0207649_112672522 76
297 3300025925 Ga0207650_11240242 Ga0207650_112402422 76
298 3300025926 Ga0207659_10454047 Ga0207659_104540473 76
299 3300025945 Ga0207679_10390695 Ga0207679_103906951 76
300 3300026023 Ga0207677_10323552 Ga0207677_103235522 76
301 3300026088 Ga0207641_10055206 Ga0207641_100552062 76
302 3300026095 Ga0207676_10351551 Ga0207676_103515512 76
303 3300026142 Ga0207698_10507407 Ga0207698_105074072 76
304 3300037466 Ga0395898_0366561 Ga0395898_0366561_328_558 76
305 3300048911 Ga0496108_0248329 Ga0496108_0248329_1239_1481 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

12

57

0.89

Feature Viewer

pLDDT pTM Quality
81.97 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map