F398333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 197 | 303 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_1642043|Ga0501034_1642043_17_295 |
| Length | 92 |
| Sequence | MFYFLPMEVGAMRVSEKGQVTIPGEIRRSAGLLPGTEVEFVQEGGEVRLRRKERGRRPTRREGEVSSALERLRGSATIRMSTDEIMALTRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 121 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 125 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 126 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 133 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 134 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 135 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 140 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 141 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 0.98 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 2.62 |
| Rhizosphere | 95.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1005574 | 3300003214 | Bacteria | 2400 |
| 2 | rootH2_10253690 | 3300003320 | Bacteria | 1444 |
| 3 | Ga0065704_10391061 | 3300005289 | Unclassified | 762 |
| 4 | Ga0065712_10776449 | 3300005290 | Bacteria | 501 |
| 5 | Ga0065707_10162100 | 3300005295 | Bacteria | 1554 |
| 6 | Ga0070676_10566241 | 3300005328 | Archaea | 815 |
| 7 | Ga0070676_11541830 | 3300005328 | Bacteria | 512 |
| 8 | Ga0070683_100004698 | 3300005329 | Bacteria | 11288 |
| 9 | Ga0070690_100223275 | 3300005330 | Bacteria | 1321 |
| 10 | Ga0070670_101943260 | 3300005331 | Unclassified | 542 |
| 11 | Ga0068869_100160167 | 3300005334 | Unclassified | 1751 |
| 12 | Ga0068869_100901993 | 3300005334 | Bacteria | 765 |
| 13 | Ga0070666_10909595 | 3300005335 | Unclassified | 651 |
| 14 | Ga0070680_100111100 | 3300005336 | Bacteria | 2281 |
| 15 | Ga0068868_100114287 | 3300005338 | Bacteria | 2196 |
| 16 | Ga0068868_100417759 | 3300005338 | Unclassified | 1161 |
| 17 | Ga0068868_100891832 | 3300005338 | Unclassified | 808 |
| 18 | Ga0068868_102327119 | 3300005338 | Unclassified | 511 |
| 19 | Ga0070689_100201843 | 3300005340 | Bacteria | 1624 |
| 20 | Ga0070661_101196886 | 3300005344 | Bacteria | 635 |
| 21 | Ga0070661_101451558 | 3300005344 | Unclassified | 578 |
| 22 | Ga0070669_100699402 | 3300005353 | Unclassified | 856 |
| 23 | Ga0070675_100762255 | 3300005354 | Unclassified | 883 |
| 24 | Ga0070675_101137101 | 3300005354 | Unclassified | 718 |
| 25 | Ga0070688_100874826 | 3300005365 | Unclassified | 707 |
| 26 | Ga0070703_10056767 | 3300005406 | Bacteria | 1269 |
| 27 | Ga0070703_10462631 | 3300005406 | Unclassified | 564 |
| 28 | Ga0070701_10123488 | 3300005438 | Bacteria | 1462 |
| 29 | Ga0070705_100320499 | 3300005440 | Bacteria | 1119 |
| 30 | Ga0070700_100048933 | 3300005441 | Bacteria | 2622 |
| 31 | Ga0070694_100177413 | 3300005444 | Bacteria | 1574 |
| 32 | Ga0070694_100310447 | 3300005444 | Bacteria | 1211 |
| 33 | Ga0070694_101261757 | 3300005444 | Unclassified | 620 |
| 34 | Ga0070708_100009524 | 3300005445 | Bacteria | 7831 |
| 35 | Ga0070708_100624465 | 3300005445 | Bacteria | 1016 |
| 36 | Ga0070708_101031953 | 3300005445 | Viruses | 771 |
| 37 | Ga0070681_10799895 | 3300005458 | Unclassified | 860 |
| 38 | Ga0068867_100164676 | 3300005459 | Bacteria | 1751 |
| 39 | Ga0070706_102067013 | 3300005467 | Bacteria | 515 |
| 40 | Ga0070707_100498735 | 3300005468 | Unclassified | 1179 |
| 41 | Ga0070707_101254565 | 3300005468 | Bacteria | 707 |
| 42 | Ga0070707_101565659 | 3300005468 | Bacteria | 626 |
| 43 | Ga0070698_100400279 | 3300005471 | Unclassified | 1306 |
| 44 | Ga0070698_100469503 | 3300005471 | Unclassified | 1195 |
| 45 | Ga0070699_102221062 | 3300005518 | Bacteria | 501 |
| 46 | Ga0070684_100163315 | 3300005535 | Bacteria | 2021 |
| 47 | Ga0070697_100041111 | 3300005536 | Bacteria | 3741 |
| 48 | Ga0070697_101349351 | 3300005536 | Bacteria | 636 |
| 49 | Ga0070686_100287977 | 3300005544 | Bacteria | 1214 |
| 50 | Ga0070686_101716705 | 3300005544 | Unclassified | 533 |
| 51 | Ga0070695_100254430 | 3300005545 | Unclassified | 1280 |
| 52 | Ga0070695_100744139 | 3300005545 | Archaea | 781 |
| 53 | Ga0070695_100995810 | 3300005545 | Unclassified | 681 |
| 54 | Ga0070696_100234811 | 3300005546 | Bacteria | 1381 |
| 55 | Ga0070696_100258336 | 3300005546 | Bacteria | 1320 |
| 56 | Ga0070704_100266806 | 3300005549 | Bacteria | 1412 |
| 57 | Ga0070704_100285066 | 3300005549 | Bacteria | 1370 |
| 58 | Ga0070704_101381943 | 3300005549 | Bacteria | 646 |
| 59 | Ga0070664_100128350 | 3300005564 | Bacteria | 2226 |
| 60 | Ga0070664_100149014 | 3300005564 | Bacteria | 2065 |
| 61 | Ga0068857_100227168 | 3300005577 | Bacteria | 1706 |
| 62 | Ga0068857_101034184 | 3300005577 | Unclassified | 791 |
| 63 | Ga0068857_101047602 | 3300005577 | Unclassified | 786 |
| 64 | Ga0068852_100179740 | 3300005616 | Unclassified | 1989 |
| 65 | Ga0068859_100126190 | 3300005617 | Bacteria | 2628 |
| 66 | Ga0068859_100544104 | 3300005617 | Bacteria | 1256 |
| 67 | Ga0068859_102878664 | 3300005617 | Unclassified | 527 |
| 68 | Ga0068864_100420258 | 3300005618 | Bacteria | 1274 |
| 69 | Ga0068864_100477943 | 3300005618 | Bacteria | 1196 |
| 70 | Ga0068864_102018664 | 3300005618 | Unclassified | 583 |
| 71 | Ga0068861_100230253 | 3300005719 | Bacteria | 1571 |
| 72 | Ga0068861_100706542 | 3300005719 | Unclassified | 937 |
| 73 | Ga0068861_102000681 | 3300005719 | Unclassified | 578 |
| 74 | Ga0068870_10118906 | 3300005840 | Unclassified | 1519 |
| 75 | Ga0068863_100432452 | 3300005841 | Bacteria | 1290 |
| 76 | Ga0068863_100967832 | 3300005841 | Unclassified | 853 |
| 77 | Ga0068858_100298322 | 3300005842 | Bacteria | 1537 |
| 78 | Ga0068860_100110161 | 3300005843 | Bacteria | 2631 |
| 79 | Ga0068860_100666415 | 3300005843 | Bacteria | 1049 |
| 80 | Ga0068860_101335836 | 3300005843 | Bacteria | 738 |
| 81 | Ga0068860_101915268 | 3300005843 | Bacteria | 614 |
| 82 | Ga0068862_100071331 | 3300005844 | Bacteria | 2999 |
| 83 | Ga0068862_100169291 | 3300005844 | Bacteria | 1955 |
| 84 | Ga0068862_101749279 | 3300005844 | Bacteria | 630 |
| 85 | Ga0075432_10524385 | 3300006058 | Unclassified | 531 |
| 86 | Ga0070716_100888094 | 3300006173 | Bacteria | 697 |
| 87 | Ga0097621_100465247 | 3300006237 | Unclassified | 1141 |
| 88 | Ga0097621_101730970 | 3300006237 | Unclassified | 595 |
| 89 | Ga0068871_100456570 | 3300006358 | Bacteria | 1146 |
| 90 | Ga0075433_11468156 | 3300006852 | Unclassified | 589 |
| 91 | Ga0075434_100522857 | 3300006871 | Bacteria | 1207 |
| 92 | Ga0075429_100413679 | 3300006880 | Bacteria | 1181 |
| 93 | Ga0068865_100188749 | 3300006881 | Bacteria | 1592 |
| 94 | Ga0097620_100126178 | 3300006931 | Bacteria | 2628 |
| 95 | Ga0097620_100544091 | 3300006931 | Bacteria | 1256 |
| 96 | Ga0097620_102878508 | 3300006931 | Unclassified | 527 |
| 97 | Ga0099794_10008321 | 3300007265 | Bacteria | 4302 |
| 98 | Ga0111539_10017323 | 3300009094 | Bacteria | 8916 |
| 99 | Ga0111539_10794965 | 3300009094 | Bacteria | 1101 |
| 100 | Ga0105245_12549600 | 3300009098 | Archaea | 565 |
| 101 | Ga0105247_10447386 | 3300009101 | Unclassified | 931 |
| 102 | Ga0114129_10383247 | 3300009147 | Bacteria | 1856 |
| 103 | Ga0114129_11055969 | 3300009147 | Bacteria | 1019 |
| 104 | Ga0105241_12419608 | 3300009174 | Unclassified | 525 |
| 105 | Ga0105242_10706099 | 3300009176 | Bacteria | 987 |
| 106 | Ga0105242_13086660 | 3300009176 | Bacteria | 516 |
| 107 | Ga0105248_10116884 | 3300009177 | Unclassified | 3008 |
| 108 | Ga0105248_10195120 | 3300009177 | Bacteria | 2281 |
| 109 | Ga0105237_12044513 | 3300009545 | Unclassified | 582 |
| 110 | Ga0105238_11452499 | 3300009551 | Unclassified | 714 |
| 111 | Ga0105249_10057983 | 3300009553 | Bacteria | 3549 |
| 112 | Ga0105239_12076691 | 3300010375 | Unclassified | 660 |
| 113 | Ga0157374_10141730 | 3300013296 | Bacteria | 2334 |
| 114 | Ga0157374_10252238 | 3300013296 | Unclassified | 1737 |
| 115 | Ga0157378_10553287 | 3300013297 | Bacteria | 1156 |
| 116 | Ga0163162_10364098 | 3300013306 | Bacteria | 1579 |
| 117 | Ga0157372_10447832 | 3300013307 | Plasmid | 1505 |
| 118 | Ga0157375_11506672 | 3300013308 | Unclassified | 794 |
| 119 | Ga0157375_11630819 | 3300013308 | Unclassified | 763 |
| 120 | Ga0163163_12723588 | 3300014325 | Unclassified | 551 |
| 121 | Ga0157380_10002828 | 3300014326 | Bacteria | 11801 |
| 122 | Ga0157380_10593109 | 3300014326 | Unclassified | 1095 |
| 123 | Ga0157380_13256951 | 3300014326 | Bacteria | 519 |
| 124 | Ga0157379_10766919 | 3300014968 | Bacteria | 909 |
| 125 | Ga0157379_11156828 | 3300014968 | Bacteria | 743 |
| 126 | Ga0163161_10422099 | 3300017792 | Bacteria | 1073 |
| 127 | Ga0207688_10278664 | 3300025901 | Bacteria | 1018 |
| 128 | Ga0207688_10287985 | 3300025901 | Bacteria | 1002 |
| 129 | Ga0207680_10450146 | 3300025903 | Unclassified | 914 |
| 130 | Ga0207645_10666288 | 3300025907 | Bacteria | 707 |
| 131 | Ga0207643_10123378 | 3300025908 | Unclassified | 1536 |
| 132 | Ga0207707_10968350 | 3300025912 | Unclassified | 700 |
| 133 | Ga0207649_11267252 | 3300025920 | Unclassified | 583 |
| 134 | Ga0207646_10398601 | 3300025922 | Unclassified | 1243 |
| 135 | Ga0207681_11718878 | 3300025923 | Unclassified | 524 |
| 136 | Ga0207681_11776471 | 3300025923 | Unclassified | 515 |
| 137 | Ga0207650_11240242 | 3300025925 | Unclassified | 635 |
| 138 | Ga0207659_10454047 | 3300025926 | Unclassified | 1080 |
| 139 | Ga0207690_11871333 | 3300025932 | Unclassified | 501 |
| 140 | Ga0207670_10201859 | 3300025936 | Bacteria | 1511 |
| 141 | Ga0207665_10068513 | 3300025939 | Bacteria | 2418 |
| 142 | Ga0207711_11858253 | 3300025941 | Unclassified | 545 |
| 143 | Ga0207689_10007895 | 3300025942 | Bacteria | 9294 |
| 144 | Ga0207689_10515063 | 3300025942 | Bacteria | 1003 |
| 145 | Ga0207689_10606094 | 3300025942 | Unclassified | 921 |
| 146 | Ga0207661_10001960 | 3300025944 | Bacteria | 14161 |
| 147 | Ga0207679_10390695 | 3300025945 | Unclassified | 1222 |
| 148 | Ga0207679_10424210 | 3300025945 | Bacteria | 1174 |
| 149 | Ga0207712_10275140 | 3300025961 | Bacteria | 1372 |
| 150 | Ga0207677_10000019 | 3300026023 | Bacteria | 138434 |
| 151 | Ga0207677_10323552 | 3300026023 | Unclassified | 1282 |
| 152 | Ga0207677_11038220 | 3300026023 | Bacteria | 745 |
| 153 | Ga0207703_10425318 | 3300026035 | Bacteria | 1236 |
| 154 | Ga0207641_10055206 | 3300026088 | Bacteria | 3373 |
| 155 | Ga0207641_11288488 | 3300026088 | Unclassified | 731 |
| 156 | Ga0207641_11660087 | 3300026088 | Bacteria | 641 |
| 157 | Ga0207648_10188800 | 3300026089 | Bacteria | 1826 |
| 158 | Ga0207676_10351551 | 3300026095 | Bacteria | 1363 |
| 159 | Ga0207676_11067858 | 3300026095 | Unclassified | 797 |
| 160 | Ga0207676_11758150 | 3300026095 | Unclassified | 618 |
| 161 | Ga0207676_12119232 | 3300026095 | Bacteria | 561 |
| 162 | Ga0207674_10136500 | 3300026116 | Bacteria | 2414 |
| 163 | Ga0207675_100138434 | 3300026118 | Bacteria | 2311 |
| 164 | Ga0207675_100854812 | 3300026118 | Unclassified | 925 |
| 165 | Ga0207675_101419593 | 3300026118 | Unclassified | 715 |
| 166 | Ga0207698_10507407 | 3300026142 | Unclassified | 1175 |
| 167 | Ga0209588_1068868 | 3300027671 | Bacteria | 1143 |
| 168 | Ga0209998_10019368 | 3300027717 | Bacteria | 1450 |
| 169 | Ga0207428_10334911 | 3300027907 | Bacteria | 1115 |
| 170 | Ga0268265_10037280 | 3300028380 | Bacteria | 3567 |
| 171 | Ga0268265_11125969 | 3300028380 | Bacteria | 780 |
| 172 | Ga0268264_10112769 | 3300028381 | Bacteria | 2384 |
| 173 | Ga0268264_10631093 | 3300028381 | Unclassified | 1059 |
| 174 | Ga0268264_10776776 | 3300028381 | Unclassified | 956 |
| 175 | Ga0268264_11207907 | 3300028381 | Unclassified | 766 |
| 176 | Ga0265323_10025597 | 3300028653 | Bacteria | 2231 |
| 177 | Ga0265330_10004332 | 3300031235 | Bacteria | 7216 |
| 178 | Ga0265328_10156589 | 3300031239 | Unclassified | 858 |
| 179 | Ga0265325_10176680 | 3300031241 | Unclassified | 996 |
| 180 | Ga0265325_10387365 | 3300031241 | Bacteria | 614 |
| 181 | Ga0265329_10000577 | 3300031242 | Bacteria | 18976 |
| 182 | Ga0265339_10012769 | 3300031249 | Bacteria | 5107 |
| 183 | Ga0265339_10097714 | 3300031249 | Bacteria | 1532 |
| 184 | Ga0265339_10238526 | 3300031249 | Unclassified | 884 |
| 185 | Ga0265327_10115373 | 3300031251 | Bacteria | 1278 |
| 186 | Ga0265327_10184643 | 3300031251 | Unclassified | 952 |
| 187 | Ga0265316_10000313 | 3300031344 | Bacteria | 53907 |
| 188 | Ga0265316_10367141 | 3300031344 | Unclassified | 1040 |
| 189 | Ga0265316_10754729 | 3300031344 | Bacteria | 684 |
| 190 | Ga0307513_10853651 | 3300031456 | Bacteria | 617 |
| 191 | Ga0316575_10048945 | 3300031665 | Unclassified | 1682 |
| 192 | Ga0316575_10052007 | 3300031665 | Bacteria | 1631 |
| 193 | Ga0316579_10024896 | 3300031691 | Bacteria | 2697 |
| 194 | Ga0316579_10036739 | 3300031691 | Bacteria | 2260 |
| 195 | Ga0316579_10508231 | 3300031691 | Bacteria | 583 |
| 196 | Ga0316579_10542494 | 3300031691 | Bacteria | 563 |
| 197 | Ga0265314_10017819 | 3300031711 | Bacteria | 5563 |
| 198 | Ga0265342_10000325 | 3300031712 | Bacteria | 53808 |
| 199 | Ga0265342_10007175 | 3300031712 | Bacteria | 8200 |
| 200 | Ga0316576_10015840 | 3300031727 | Bacteria | 5072 |
| 201 | Ga0316578_10025067 | 3300031728 | Bacteria | 3349 |
| 202 | Ga0316578_10154142 | 3300031728 | Bacteria | 1384 |
| 203 | Ga0316577_10010794 | 3300031733 | Bacteria | 4938 |
| 204 | Ga0307410_11891660 | 3300031852 | Unclassified | 531 |
| 205 | Ga0307409_101259340 | 3300031995 | Unclassified | 764 |
| 206 | Ga0307409_101673847 | 3300031995 | Bacteria | 665 |
| 207 | Ga0307416_100679761 | 3300032002 | Bacteria | 1117 |
| 208 | Ga0307411_10170866 | 3300032005 | Bacteria | 1639 |
| 209 | Ga0307415_100641257 | 3300032126 | Bacteria | 951 |
| 210 | Ga0316583_10001764 | 3300032133 | Bacteria | 7351 |
| 211 | Ga0316585_10006830 | 3300032137 | Bacteria | 3273 |
| 212 | Ga0316585_10070414 | 3300032137 | Bacteria | 1134 |
| 213 | Ga0316580_10016744 | 3300032139 | Bacteria | 2250 |
| 214 | Ga0316580_10049102 | 3300032139 | Bacteria | 1300 |
| 215 | Ga0316580_10226994 | 3300032139 | Unclassified | 576 |
| 216 | Ga0316593_10067970 | 3300032168 | Bacteria | 1229 |
| 217 | Ga0316592_1021373 | 3300033524 | Bacteria | 1378 |
| 218 | Ga0316596_1131718 | 3300033541 | Bacteria | 683 |
| 219 | Ga0373945_0176831 | 3300035116 | Unclassified | 877 |
| 220 | Ga0316574_0038974 | 3300035398 | Bacteria | 2919 |
| 221 | Ga0316574_0069327 | 3300035398 | Bacteria | 2225 |
| 222 | Ga0316582_0003462 | 3300036647 | Bacteria | 7745 |
| 223 | Ga0316582_0003594 | 3300036647 | Bacteria | 7641 |
| 224 | Ga0316584_0096722 | 3300036712 | Bacteria | 2210 |
| 225 | Ga0395900_1543984 | 3300037418 | Bacteria | 576 |
| 226 | Ga0395898_0366561 | 3300037466 | Bacteria | 1374 |
| 227 | Ga0395901_0729146 | 3300038443 | Bacteria | 986 |
| 228 | Ga0395901_1805350 | 3300038443 | Bacteria | 561 |
| 229 | Ga0436360_0938100 | 3300039438 | Bacteria | 920 |
| 230 | Ga0451853_0708262 | 3300041512 | Unclassified | 512 |
| 231 | Ga0439460_0233132 | 3300042461 | Bacteria | 633 |
| 232 | Ga0451577_0003161 | 3300042876 | Bacteria | 18544 |
| 233 | Ga0451577_0743731 | 3300042876 | Bacteria | 887 |
| 234 | Ga0451577_0768459 | 3300042876 | Unclassified | 871 |
| 235 | Ga0451577_1432154 | 3300042876 | Bacteria | 612 |
| 236 | Ga0451577_1514283 | 3300042876 | Bacteria | 593 |
| 237 | Ga0453683_0004420 | 3300044673 | Bacteria | 9976 |
| 238 | Ga0453684_0000555 | 3300044712 | Bacteria | 140770 |
| 239 | Ga0453684_0230573 | 3300044712 | Bacteria | 2138 |
| 240 | Ga0453684_2560707 | 3300044712 | Unclassified | 502 |
| 241 | Ga0466959_0620013 | 3300045049 | Bacteria | 727 |
| 242 | Ga0451576_1564000 | 3300045051 | Bacteria | 684 |
| 243 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 244 | Ga0495580_0632524 | 3300046472 | Unclassified | 705 |
| 245 | Ga0495582_0052533 | 3300046473 | Bacteria | 2247 |
| 246 | Ga0495584_0286422 | 3300046491 | Unclassified | 837 |
| 247 | Ga0495608_0178106 | 3300046511 | Bacteria | 1346 |
| 248 | Ga0495630_0022950 | 3300046517 | Bacteria | 4610 |
| 249 | Ga0495648_0170241 | 3300046524 | Bacteria | 1117 |
| 250 | Ga0495640_0074064 | 3300046533 | Bacteria | 2278 |
| 251 | Ga0495640_0317149 | 3300046533 | Bacteria | 966 |
| 252 | Ga0495586_0007639 | 3300046535 | Bacteria | 5767 |
| 253 | Ga0495586_0165767 | 3300046535 | Unclassified | 1247 |
| 254 | Ga0495645_0300584 | 3300046543 | Bacteria | 1049 |
| 255 | Ga0495656_0369859 | 3300046615 | Bacteria | 746 |
| 256 | Ga0495634_0054506 | 3300046642 | Unclassified | 2676 |
| 257 | Ga0495634_0340180 | 3300046642 | Unclassified | 900 |
| 258 | Ga0495659_0488380 | 3300046664 | Unclassified | 539 |
| 259 | Ga0495599_0882041 | 3300046678 | Bacteria | 508 |
| 260 | Ga0495647_0196408 | 3300046681 | Unclassified | 884 |
| 261 | Ga0495658_0264316 | 3300046683 | Bacteria | 1083 |
| 262 | Ga0495658_0579978 | 3300046683 | Unclassified | 718 |
| 263 | Ga0495613_0076434 | 3300046689 | Bacteria | 2437 |
| 264 | Ga0495613_0275059 | 3300046689 | Unclassified | 1170 |
| 265 | Ga0495613_0890345 | 3300046689 | Bacteria | 576 |
| 266 | Ga0495624_0479767 | 3300046690 | Unclassified | 744 |
| 267 | Ga0495674_0111213 | 3300047319 | Bacteria | 2322 |
| 268 | Ga0495674_1324646 | 3300047319 | Unclassified | 539 |
| 269 | Ga0495676_0002855 | 3300047321 | Bacteria | 15572 |
| 270 | Ga0495676_0277435 | 3300047321 | Bacteria | 1136 |
| 271 | Ga0495684_0707012 | 3300047471 | Unclassified | 668 |
| 272 | Ga0496100_0219685 | 3300048903 | Unclassified | 1394 |
| 273 | Ga0496101_0585710 | 3300048904 | Unclassified | 882 |
| 274 | Ga0496106_0311565 | 3300048909 | Unclassified | 1263 |
| 275 | Ga0496106_0772431 | 3300048909 | Unclassified | 763 |
| 276 | Ga0496108_0248329 | 3300048911 | Bacteria | 1548 |
| 277 | Ga0496108_0646345 | 3300048911 | Unclassified | 920 |
| 278 | Ga0496109_0334614 | 3300048912 | Unclassified | 1430 |
| 279 | Ga0496114_0183223 | 3300048917 | Bacteria | 1829 |
| 280 | Ga0496126_0033876 | 3300048929 | Bacteria | 4804 |
| 281 | Ga0501034_0503610 | 3300049571 | Bacteria | 1124 |
| 282 | Ga0501034_1642043 | 3300049571 | Unclassified | 515 |
| 283 | Ga0501036_0855266 | 3300049572 | Bacteria | 748 |
| 284 | Ga0501038_0659541 | 3300049574 | Bacteria | 787 |
| 285 | Ga0501047_0644463 | 3300049581 | Unclassified | 879 |
| 286 | Ga0501047_0850207 | 3300049581 | Bacteria | 726 |
| 287 | Ga0501069_0229458 | 3300049585 | Bacteria | 1080 |
| 288 | Ga0501071_0786336 | 3300049587 | Bacteria | 733 |
| 289 | Ga0501075_0205838 | 3300049591 | Bacteria | 1501 |
| 290 | Ga0501075_1166364 | 3300049591 | Bacteria | 585 |
| 291 | Ga0501076_0339390 | 3300049592 | Bacteria | 1233 |
| 292 | Ga0501076_0872157 | 3300049592 | Bacteria | 742 |
| 293 | Ga0501077_0982418 | 3300049593 | Bacteria | 543 |
| 294 | Ga0501080_0295283 | 3300049742 | Unclassified | 1471 |
| 295 | Ga0501045_0640620 | 3300049824 | Unclassified | 786 |
| 296 | Ga0501045_0912224 | 3300049824 | Bacteria | 645 |
| 297 | nmdc:mga05p37_301050_c1 | 3300050507 | Bacteria | 1905 |
| 298 | nmdc:mga09592_187665_c1 | 3300050508 | Bacteria | 1789 |
| 299 | nmdc:mga08y16_23762_c1 | 3300050511 | Bacteria | 6471 |
| 300 | nmdc:mga0n895_1014006_c1 | 3300050512 | Unclassified | 811 |
| 301 | nmdc:mga0n895_541987_c1 | 3300050512 | Bacteria | 1170 |
| 302 | Ga0501084_1012814 | 3300054114 | Unclassified | 698 |
| 303 | Ga0530510_0352205 | 3300061734 | Bacteria | 1106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2558860112 | 2558911973 | 67 |
| 2 | iso_pu_bacteria | 2816332139 | 2816504170 | 67 |
| 3 | 3300031249 | Ga0265339_10238526 | Ga0265339_102385261 | 68 |
| 4 | 3300031251 | Ga0265327_10184643 | Ga0265327_101846432 | 68 |
| 5 | 3300035116 | Ga0373945_0176831 | Ga0373945_0176831_308_523 | 68 |
| 6 | 3300041512 | Ga0451853_0708262 | Ga0451853_0708262_100_315 | 68 |
| 7 | 3300046472 | Ga0495580_0632524 | Ga0495580_0632524_215_430 | 68 |
| 8 | 3300046473 | Ga0495582_0052533 | Ga0495582_0052533_523_738 | 68 |
| 9 | 3300046511 | Ga0495608_0178106 | Ga0495608_0178106_338_553 | 68 |
| 10 | 3300046517 | Ga0495630_0022950 | Ga0495630_0022950_1248_1463 | 68 |
| 11 | 3300046533 | Ga0495640_0074064 | Ga0495640_0074064_483_698 | 68 |
| 12 | 3300046533 | Ga0495640_0317149 | Ga0495640_0317149_153_368 | 68 |
| 13 | 3300046535 | Ga0495586_0007639 | Ga0495586_0007639_4558_4773 | 68 |
| 14 | 3300046535 | Ga0495586_0165767 | Ga0495586_0165767_394_609 | 68 |
| 15 | 3300046642 | Ga0495634_0054506 | Ga0495634_0054506_174_389 | 68 |
| 16 | 3300046642 | Ga0495634_0340180 | Ga0495634_0340180_606_821 | 68 |
| 17 | 3300046681 | Ga0495647_0196408 | Ga0495647_0196408_71_286 | 68 |
| 18 | 3300046683 | Ga0495658_0264316 | Ga0495658_0264316_261_476 | 68 |
| 19 | 3300046683 | Ga0495658_0579978 | Ga0495658_0579978_250_480 | 68 |
| 20 | 3300046689 | Ga0495613_0076434 | Ga0495613_0076434_1006_1221 | 68 |
| 21 | 3300046689 | Ga0495613_0275059 | Ga0495613_0275059_101_316 | 68 |
| 22 | 3300046689 | Ga0495613_0890345 | Ga0495613_0890345_232_447 | 68 |
| 23 | 3300046690 | Ga0495624_0479767 | Ga0495624_0479767_220_435 | 68 |
| 24 | 3300047319 | Ga0495674_0111213 | Ga0495674_0111213_1596_1811 | 68 |
| 25 | 3300047319 | Ga0495674_1324646 | Ga0495674_1324646_308_523 | 68 |
| 26 | 3300047321 | Ga0495676_0277435 | Ga0495676_0277435_509_724 | 68 |
| 27 | 3300047471 | Ga0495684_0707012 | Ga0495684_0707012_277_492 | 68 |
| 28 | 3300005290 | Ga0065712_10776449 | Ga0065712_107764491 | 69 |
| 29 | 3300005445 | Ga0070708_100009524 | Ga0070708_1000095247 | 69 |
| 30 | 3300005445 | Ga0070708_100624465 | Ga0070708_1006244652 | 69 |
| 31 | 3300005468 | Ga0070707_100498735 | Ga0070707_1004987353 | 69 |
| 32 | 3300005518 | Ga0070699_102221062 | Ga0070699_1022210621 | 69 |
| 33 | 3300005536 | Ga0070697_100041111 | Ga0070697_1000411111 | 69 |
| 34 | 3300006852 | Ga0075433_11468156 | Ga0075433_114681562 | 69 |
| 35 | 3300007265 | Ga0099794_10008321 | Ga0099794_100083212 | 69 |
| 36 | 3300009147 | Ga0114129_11055969 | Ga0114129_110559692 | 69 |
| 37 | 3300014326 | Ga0157380_13256951 | Ga0157380_132569512 | 69 |
| 38 | 3300025922 | Ga0207646_10398601 | Ga0207646_103986011 | 69 |
| 39 | 3300027671 | Ga0209588_1068868 | Ga0209588_10688682 | 69 |
| 40 | 3300031691 | Ga0316579_10542494 | Ga0316579_105424942 | 69 |
| 41 | 3300031852 | Ga0307410_11891660 | Ga0307410_118916601 | 69 |
| 42 | 3300037418 | Ga0395900_1543984 | Ga0395900_1543984_263_487 | 69 |
| 43 | 3300038443 | Ga0395901_0729146 | Ga0395901_0729146_643_867 | 69 |
| 44 | 3300042461 | Ga0439460_0233132 | Ga0439460_0233132_88_312 | 69 |
| 45 | 3300005289 | Ga0065704_10391061 | Ga0065704_103910612 | 70 |
| 46 | 3300005295 | Ga0065707_10162100 | Ga0065707_101621001 | 70 |
| 47 | 3300005328 | Ga0070676_10566241 | Ga0070676_105662412 | 70 |
| 48 | 3300005328 | Ga0070676_11541830 | Ga0070676_115418302 | 70 |
| 49 | 3300005329 | Ga0070683_100004698 | Ga0070683_10000469820 | 70 |
| 50 | 3300005330 | Ga0070690_100223275 | Ga0070690_1002232752 | 70 |
| 51 | 3300005334 | Ga0068869_100901993 | Ga0068869_1009019932 | 70 |
| 52 | 3300005336 | Ga0070680_100111100 | Ga0070680_1001111003 | 70 |
| 53 | 3300005338 | Ga0068868_100114287 | Ga0068868_1001142873 | 70 |
| 54 | 3300005338 | Ga0068868_100891832 | Ga0068868_1008918322 | 70 |
| 55 | 3300005338 | Ga0068868_102327119 | Ga0068868_1023271192 | 70 |
| 56 | 3300005340 | Ga0070689_100201843 | Ga0070689_1002018432 | 70 |
| 57 | 3300005344 | Ga0070661_101196886 | Ga0070661_1011968862 | 70 |
| 58 | 3300005353 | Ga0070669_100699402 | Ga0070669_1006994021 | 70 |
| 59 | 3300005354 | Ga0070675_101137101 | Ga0070675_1011371012 | 70 |
| 60 | 3300005365 | Ga0070688_100874826 | Ga0070688_1008748261 | 70 |
| 61 | 3300005406 | Ga0070703_10056767 | Ga0070703_100567672 | 70 |
| 62 | 3300005406 | Ga0070703_10462631 | Ga0070703_104626311 | 70 |
| 63 | 3300005438 | Ga0070701_10123488 | Ga0070701_101234881 | 70 |
| 64 | 3300005440 | Ga0070705_100320499 | Ga0070705_1003204993 | 70 |
| 65 | 3300005441 | Ga0070700_100048933 | Ga0070700_1000489333 | 70 |
| 66 | 3300005444 | Ga0070694_100177413 | Ga0070694_1001774132 | 70 |
| 67 | 3300005444 | Ga0070694_101261757 | Ga0070694_1012617572 | 70 |
| 68 | 3300005445 | Ga0070708_101031953 | Ga0070708_1010319531 | 70 |
| 69 | 3300005458 | Ga0070681_10799895 | Ga0070681_107998951 | 70 |
| 70 | 3300005459 | Ga0068867_100164676 | Ga0068867_1001646763 | 70 |
| 71 | 3300005468 | Ga0070707_101565659 | Ga0070707_1015656591 | 70 |
| 72 | 3300005471 | Ga0070698_100400279 | Ga0070698_1004002792 | 70 |
| 73 | 3300005471 | Ga0070698_100469503 | Ga0070698_1004695031 | 70 |
| 74 | 3300005535 | Ga0070684_100163315 | Ga0070684_1001633154 | 70 |
| 75 | 3300005536 | Ga0070697_101349351 | Ga0070697_1013493512 | 70 |
| 76 | 3300005544 | Ga0070686_100287977 | Ga0070686_1002879772 | 70 |
| 77 | 3300005544 | Ga0070686_101716705 | Ga0070686_1017167052 | 70 |
| 78 | 3300005545 | Ga0070695_100254430 | Ga0070695_1002544301 | 70 |
| 79 | 3300005545 | Ga0070695_100744139 | Ga0070695_1007441391 | 70 |
| 80 | 3300005546 | Ga0070696_100234811 | Ga0070696_1002348112 | 70 |
| 81 | 3300005546 | Ga0070696_100258336 | Ga0070696_1002583362 | 70 |
| 82 | 3300005549 | Ga0070704_100266806 | Ga0070704_1002668061 | 70 |
| 83 | 3300005549 | Ga0070704_100285066 | Ga0070704_1002850662 | 70 |
| 84 | 3300005549 | Ga0070704_101381943 | Ga0070704_1013819432 | 70 |
| 85 | 3300005564 | Ga0070664_100149014 | Ga0070664_1001490143 | 70 |
| 86 | 3300005577 | Ga0068857_100227168 | Ga0068857_1002271682 | 70 |
| 87 | 3300005577 | Ga0068857_101034184 | Ga0068857_1010341841 | 70 |
| 88 | 3300005617 | Ga0068859_100126190 | Ga0068859_1001261903 | 70 |
| 89 | 3300005617 | Ga0068859_100544104 | Ga0068859_1005441042 | 70 |
| 90 | 3300005617 | Ga0068859_102878664 | Ga0068859_1028786642 | 70 |
| 91 | 3300005618 | Ga0068864_100420258 | Ga0068864_1004202583 | 70 |
| 92 | 3300005618 | Ga0068864_100477943 | Ga0068864_1004779431 | 70 |
| 93 | 3300005719 | Ga0068861_100230253 | Ga0068861_1002302533 | 70 |
| 94 | 3300005719 | Ga0068861_100706542 | Ga0068861_1007065422 | 70 |
| 95 | 3300005719 | Ga0068861_102000681 | Ga0068861_1020006812 | 70 |
| 96 | 3300005840 | Ga0068870_10118906 | Ga0068870_101189063 | 70 |
| 97 | 3300005841 | Ga0068863_100967832 | Ga0068863_1009678322 | 70 |
| 98 | 3300005842 | Ga0068858_100298322 | Ga0068858_1002983222 | 70 |
| 99 | 3300005843 | Ga0068860_100110161 | Ga0068860_1001101613 | 70 |
| 100 | 3300005843 | Ga0068860_100666415 | Ga0068860_1006664153 | 70 |
| 101 | 3300005843 | Ga0068860_101335836 | Ga0068860_1013358361 | 70 |
| 102 | 3300005843 | Ga0068860_101915268 | Ga0068860_1019152682 | 70 |
| 103 | 3300005844 | Ga0068862_100071331 | Ga0068862_1000713314 | 70 |
| 104 | 3300005844 | Ga0068862_100169291 | Ga0068862_1001692912 | 70 |
| 105 | 3300005844 | Ga0068862_101749279 | Ga0068862_1017492792 | 70 |
| 106 | 3300006237 | Ga0097621_100465247 | Ga0097621_1004652472 | 70 |
| 107 | 3300006358 | Ga0068871_100456570 | Ga0068871_1004565701 | 70 |
| 108 | 3300006871 | Ga0075434_100522857 | Ga0075434_1005228573 | 70 |
| 109 | 3300006880 | Ga0075429_100413679 | Ga0075429_1004136792 | 70 |
| 110 | 3300006881 | Ga0068865_100188749 | Ga0068865_1001887493 | 70 |
| 111 | 3300006931 | Ga0097620_100126178 | Ga0097620_1001261783 | 70 |
| 112 | 3300006931 | Ga0097620_100544091 | Ga0097620_1005440912 | 70 |
| 113 | 3300006931 | Ga0097620_102878508 | Ga0097620_1028785082 | 70 |
| 114 | 3300009098 | Ga0105245_12549600 | Ga0105245_125496001 | 70 |
| 115 | 3300009101 | Ga0105247_10447386 | Ga0105247_104473861 | 70 |
| 116 | 3300009147 | Ga0114129_10383247 | Ga0114129_103832473 | 70 |
| 117 | 3300009176 | Ga0105242_10706099 | Ga0105242_107060992 | 70 |
| 118 | 3300009176 | Ga0105242_13086660 | Ga0105242_130866601 | 70 |
| 119 | 3300009177 | Ga0105248_10195120 | Ga0105248_101951202 | 70 |
| 120 | 3300009545 | Ga0105237_12044513 | Ga0105237_120445132 | 70 |
| 121 | 3300009553 | Ga0105249_10057983 | Ga0105249_100579832 | 70 |
| 122 | 3300010375 | Ga0105239_12076691 | Ga0105239_120766912 | 70 |
| 123 | 3300013297 | Ga0157378_10553287 | Ga0157378_105532872 | 70 |
| 124 | 3300013306 | Ga0163162_10364098 | Ga0163162_103640982 | 70 |
| 125 | 3300013307 | Ga0157372_10447832 | Ga0157372_104478324 | 70 |
| 126 | 3300013308 | Ga0157375_11630819 | Ga0157375_116308192 | 70 |
| 127 | 3300014968 | Ga0157379_10766919 | Ga0157379_107669191 | 70 |
| 128 | 3300014968 | Ga0157379_11156828 | Ga0157379_111568282 | 70 |
| 129 | 3300025907 | Ga0207645_10666288 | Ga0207645_106662882 | 70 |
| 130 | 3300025908 | Ga0207643_10123378 | Ga0207643_101233782 | 70 |
| 131 | 3300025912 | Ga0207707_10968350 | Ga0207707_109683502 | 70 |
| 132 | 3300025923 | Ga0207681_11718878 | Ga0207681_117188781 | 70 |
| 133 | 3300025923 | Ga0207681_11776471 | Ga0207681_117764712 | 70 |
| 134 | 3300025932 | Ga0207690_11871333 | Ga0207690_118713331 | 70 |
| 135 | 3300025936 | Ga0207670_10201859 | Ga0207670_102018593 | 70 |
| 136 | 3300025939 | Ga0207665_10068513 | Ga0207665_100685134 | 70 |
| 137 | 3300025941 | Ga0207711_11858253 | Ga0207711_118582532 | 70 |
| 138 | 3300025942 | Ga0207689_10007895 | Ga0207689_100078955 | 70 |
| 139 | 3300025942 | Ga0207689_10515063 | Ga0207689_105150632 | 70 |
| 140 | 3300025944 | Ga0207661_10001960 | Ga0207661_100019607 | 70 |
| 141 | 3300025945 | Ga0207679_10424210 | Ga0207679_104242102 | 70 |
| 142 | 3300025961 | Ga0207712_10275140 | Ga0207712_102751402 | 70 |
| 143 | 3300026023 | Ga0207677_10000019 | Ga0207677_1000001935 | 70 |
| 144 | 3300026023 | Ga0207677_11038220 | Ga0207677_110382202 | 70 |
| 145 | 3300026035 | Ga0207703_10425318 | Ga0207703_104253182 | 70 |
| 146 | 3300026088 | Ga0207641_11288488 | Ga0207641_112884881 | 70 |
| 147 | 3300026088 | Ga0207641_11660087 | Ga0207641_116600872 | 70 |
| 148 | 3300026089 | Ga0207648_10188800 | Ga0207648_101888002 | 70 |
| 149 | 3300026095 | Ga0207676_11067858 | Ga0207676_110678582 | 70 |
| 150 | 3300026095 | Ga0207676_11758150 | Ga0207676_117581502 | 70 |
| 151 | 3300026095 | Ga0207676_12119232 | Ga0207676_121192322 | 70 |
| 152 | 3300026116 | Ga0207674_10136500 | Ga0207674_101365004 | 70 |
| 153 | 3300026118 | Ga0207675_100138434 | Ga0207675_1001384343 | 70 |
| 154 | 3300026118 | Ga0207675_100854812 | Ga0207675_1008548122 | 70 |
| 155 | 3300026118 | Ga0207675_101419593 | Ga0207675_1014195931 | 70 |
| 156 | 3300027717 | Ga0209998_10019368 | Ga0209998_100193682 | 70 |
| 157 | 3300028380 | Ga0268265_10037280 | Ga0268265_100372802 | 70 |
| 158 | 3300028380 | Ga0268265_11125969 | Ga0268265_111259691 | 70 |
| 159 | 3300028381 | Ga0268264_10112769 | Ga0268264_101127693 | 70 |
| 160 | 3300028381 | Ga0268264_10631093 | Ga0268264_106310932 | 70 |
| 161 | 3300028381 | Ga0268264_10776776 | Ga0268264_107767762 | 70 |
| 162 | 3300028381 | Ga0268264_11207907 | Ga0268264_112079072 | 70 |
| 163 | 3300032002 | Ga0307416_100679761 | Ga0307416_1006797612 | 70 |
| 164 | 3300032126 | Ga0307415_100641257 | Ga0307415_1006412572 | 70 |
| 165 | 3300038443 | Ga0395901_1805350 | Ga0395901_1805350_40_264 | 70 |
| 166 | 3300046491 | Ga0495584_0286422 | Ga0495584_0286422_146_379 | 70 |
| 167 | 3300049585 | Ga0501069_0229458 | Ga0501069_0229458_564_785 | 70 |
| 168 | 3300049742 | Ga0501080_0295283 | Ga0501080_0295283_1123_1350 | 70 |
| 169 | 3300050507 | nmdc:mga05p37_301050_c1 | nmdc:mga05p37_301050_c1_1093_1320 | 70 |
| 170 | 3300050508 | nmdc:mga09592_187665_c1 | nmdc:mga09592_187665_c1_168_395 | 70 |
| 171 | 3300050512 | nmdc:mga0n895_1014006_c1 | nmdc:mga0n895_1014006_c1_413_643 | 70 |
| 172 | 3300050512 | nmdc:mga0n895_541987_c1 | nmdc:mga0n895_541987_c1_479_709 | 70 |
| 173 | 3300003320 | rootH2_10253690 | rootH2_102536902 | 71 |
| 174 | 3300005334 | Ga0068869_100160167 | Ga0068869_1001601673 | 71 |
| 175 | 3300005467 | Ga0070706_102067013 | Ga0070706_1020670131 | 71 |
| 176 | 3300006173 | Ga0070716_100888094 | Ga0070716_1008880942 | 71 |
| 177 | 3300009094 | Ga0111539_10794965 | Ga0111539_107949652 | 71 |
| 178 | 3300025942 | Ga0207689_10606094 | Ga0207689_106060942 | 71 |
| 179 | 3300031241 | Ga0265325_10387365 | Ga0265325_103873652 | 71 |
| 180 | 3300031344 | Ga0265316_10754729 | Ga0265316_107547292 | 71 |
| 181 | 3300031456 | Ga0307513_10853651 | Ga0307513_108536512 | 71 |
| 182 | 3300031712 | Ga0265342_10007175 | Ga0265342_100071752 | 71 |
| 183 | 3300031995 | Ga0307409_101673847 | Ga0307409_1016738472 | 71 |
| 184 | 3300042876 | Ga0451577_0003161 | Ga0451577_0003161_11267_11497 | 71 |
| 185 | 3300042876 | Ga0451577_0743731 | Ga0451577_0743731_38_268 | 71 |
| 186 | 3300042876 | Ga0451577_1514283 | Ga0451577_1514283_238_468 | 71 |
| 187 | 3300044673 | Ga0453683_0004420 | Ga0453683_0004420_4766_4999 | 71 |
| 188 | 3300044712 | Ga0453684_0000555 | Ga0453684_0000555_20804_21034 | 71 |
| 189 | 3300044712 | Ga0453684_0230573 | Ga0453684_0230573_301_534 | 71 |
| 190 | 3300044712 | Ga0453684_2560707 | Ga0453684_2560707_52_282 | 71 |
| 191 | 3300045049 | Ga0466959_0620013 | Ga0466959_0620013_352_579 | 71 |
| 192 | 3300045051 | Ga0451576_1564000 | Ga0451576_1564000_265_495 | 71 |
| 193 | 3300046524 | Ga0495648_0170241 | Ga0495648_0170241_211_444 | 71 |
| 194 | 3300048909 | Ga0496106_0772431 | Ga0496106_0772431_174_407 | 71 |
| 195 | 3300049571 | Ga0501034_0503610 | Ga0501034_0503610_776_1018 | 71 |
| 196 | 3300049572 | Ga0501036_0855266 | Ga0501036_0855266_363_605 | 71 |
| 197 | 3300049587 | Ga0501071_0786336 | Ga0501071_0786336_74_310 | 71 |
| 198 | 3300049591 | Ga0501075_1166364 | Ga0501075_1166364_73_309 | 71 |
| 199 | 3300049593 | Ga0501077_0982418 | Ga0501077_0982418_121_354 | 71 |
| 200 | 3300049824 | Ga0501045_0912224 | Ga0501045_0912224_82_318 | 71 |
| 201 | 3300005444 | Ga0070694_100310447 | Ga0070694_1003104471 | 72 |
| 202 | 3300006058 | Ga0075432_10524385 | Ga0075432_105243851 | 72 |
| 203 | 3300009094 | Ga0111539_10017323 | Ga0111539_100173235 | 72 |
| 204 | 3300009174 | Ga0105241_12419608 | Ga0105241_124196082 | 72 |
| 205 | 3300013296 | Ga0157374_10141730 | Ga0157374_101417304 | 72 |
| 206 | 3300014326 | Ga0157380_10593109 | Ga0157380_105931091 | 72 |
| 207 | 3300025901 | Ga0207688_10278664 | Ga0207688_102786642 | 72 |
| 208 | 3300027907 | Ga0207428_10334911 | Ga0207428_103349111 | 72 |
| 209 | 3300028653 | Ga0265323_10025597 | Ga0265323_100255973 | 72 |
| 210 | 3300031235 | Ga0265330_10004332 | Ga0265330_100043326 | 72 |
| 211 | 3300031239 | Ga0265328_10156589 | Ga0265328_101565892 | 72 |
| 212 | 3300031242 | Ga0265329_10000577 | Ga0265329_100005779 | 72 |
| 213 | 3300031249 | Ga0265339_10012769 | Ga0265339_100127693 | 72 |
| 214 | 3300031249 | Ga0265339_10097714 | Ga0265339_100977142 | 72 |
| 215 | 3300031344 | Ga0265316_10000313 | Ga0265316_1000031322 | 72 |
| 216 | 3300031344 | Ga0265316_10367141 | Ga0265316_103671411 | 72 |
| 217 | 3300031665 | Ga0316575_10052007 | Ga0316575_100520072 | 72 |
| 218 | 3300031691 | Ga0316579_10024896 | Ga0316579_100248962 | 72 |
| 219 | 3300031691 | Ga0316579_10036739 | Ga0316579_100367391 | 72 |
| 220 | 3300031711 | Ga0265314_10017819 | Ga0265314_100178195 | 72 |
| 221 | 3300031712 | Ga0265342_10000325 | Ga0265342_1000032512 | 72 |
| 222 | 3300031727 | Ga0316576_10015840 | Ga0316576_100158404 | 72 |
| 223 | 3300031728 | Ga0316578_10025067 | Ga0316578_100250675 | 72 |
| 224 | 3300031728 | Ga0316578_10154142 | Ga0316578_101541422 | 72 |
| 225 | 3300031733 | Ga0316577_10010794 | Ga0316577_100107942 | 72 |
| 226 | 3300032133 | Ga0316583_10001764 | Ga0316583_100017643 | 72 |
| 227 | 3300032137 | Ga0316585_10006830 | Ga0316585_100068304 | 72 |
| 228 | 3300032137 | Ga0316585_10070414 | Ga0316585_100704142 | 72 |
| 229 | 3300032139 | Ga0316580_10016744 | Ga0316580_100167443 | 72 |
| 230 | 3300032139 | Ga0316580_10049102 | Ga0316580_100491022 | 72 |
| 231 | 3300032168 | Ga0316593_10067970 | Ga0316593_100679701 | 72 |
| 232 | 3300033524 | Ga0316592_1021373 | Ga0316592_10213732 | 72 |
| 233 | 3300033541 | Ga0316596_1131718 | Ga0316596_11317182 | 72 |
| 234 | 3300035398 | Ga0316574_0038974 | Ga0316574_0038974_863_1087 | 72 |
| 235 | 3300035398 | Ga0316574_0069327 | Ga0316574_0069327_1988_2212 | 72 |
| 236 | 3300036647 | Ga0316582_0003594 | Ga0316582_0003594_5619_5843 | 72 |
| 237 | 3300036712 | Ga0316584_0096722 | Ga0316584_0096722_1770_1994 | 72 |
| 238 | 3300039438 | Ga0436360_0938100 | Ga0436360_0938100_87_323 | 72 |
| 239 | 3300042876 | Ga0451577_1432154 | Ga0451577_1432154_194_430 | 72 |
| 240 | 3300049574 | Ga0501038_0659541 | Ga0501038_0659541_391_657 | 72 |
| 241 | 3300049591 | Ga0501075_0205838 | Ga0501075_0205838_856_1095 | 72 |
| 242 | 3300049592 | Ga0501076_0339390 | Ga0501076_0339390_170_436 | 72 |
| 243 | 3300049592 | Ga0501076_0872157 | Ga0501076_0872157_454_693 | 72 |
| 244 | 3300049824 | Ga0501045_0640620 | Ga0501045_0640620_163_408 | 72 |
| 245 | 3300050511 | nmdc:mga08y16_23762_c1 | nmdc:mga08y16_23762_c1_4060_4308 | 72 |
| 246 | 3300054114 | Ga0501084_1012814 | Ga0501084_1012814_97_342 | 72 |
| 247 | 3300061734 | Ga0530510_0352205 | Ga0530510_0352205_362_601 | 72 |
| 248 | 3300009177 | Ga0105248_10116884 | Ga0105248_101168843 | 73 |
| 249 | 3300014326 | Ga0157380_10002828 | Ga0157380_1000282812 | 73 |
| 250 | 3300017792 | Ga0163161_10422099 | Ga0163161_104220992 | 73 |
| 251 | 3300031665 | Ga0316575_10048945 | Ga0316575_100489451 | 73 |
| 252 | 3300031691 | Ga0316579_10508231 | Ga0316579_105082311 | 73 |
| 253 | 3300031995 | Ga0307409_101259340 | Ga0307409_1012593402 | 73 |
| 254 | 3300032005 | Ga0307411_10170866 | Ga0307411_101708662 | 73 |
| 255 | 3300032139 | Ga0316580_10226994 | Ga0316580_102269942 | 73 |
| 256 | 3300036647 | Ga0316582_0003462 | Ga0316582_0003462_3897_4124 | 73 |
| 257 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_186137_186391 | 73 |
| 258 | 3300046543 | Ga0495645_0300584 | Ga0495645_0300584_240_500 | 73 |
| 259 | 3300046678 | Ga0495599_0882041 | Ga0495599_0882041_227_487 | 73 |
| 260 | 3300047321 | Ga0495676_0002855 | Ga0495676_0002855_11089_11328 | 73 |
| 261 | 3300049581 | Ga0501047_0644463 | Ga0501047_0644463_175_429 | 73 |
| 262 | 3300005577 | Ga0068857_101047602 | Ga0068857_1010476021 | 74 |
| 263 | 3300013308 | Ga0157375_11506672 | Ga0157375_115066722 | 74 |
| 264 | 3300014325 | Ga0163163_12723588 | Ga0163163_127235882 | 74 |
| 265 | 3300025901 | Ga0207688_10287985 | Ga0207688_102879852 | 74 |
| 266 | 3300031241 | Ga0265325_10176680 | Ga0265325_101766802 | 74 |
| 267 | 3300046615 | Ga0495656_0369859 | Ga0495656_0369859_369_599 | 74 |
| 268 | 3300046664 | Ga0495659_0488380 | Ga0495659_0488380_165_395 | 74 |
| 269 | 3300048903 | Ga0496100_0219685 | Ga0496100_0219685_902_1132 | 74 |
| 270 | 3300048904 | Ga0496101_0585710 | Ga0496101_0585710_413_643 | 74 |
| 271 | 3300048909 | Ga0496106_0311565 | Ga0496106_0311565_129_359 | 74 |
| 272 | 3300048911 | Ga0496108_0646345 | Ga0496108_0646345_158_388 | 74 |
| 273 | 3300048912 | Ga0496109_0334614 | Ga0496109_0334614_461_691 | 74 |
| 274 | 3300048917 | Ga0496114_0183223 | Ga0496114_0183223_55_285 | 74 |
| 275 | 3300049571 | Ga0501034_1642043 | Ga0501034_1642043_17_295 | 74 |
| 276 | 3300049581 | Ga0501047_0850207 | Ga0501047_0850207_254_532 | 74 |
| 277 | 3300031251 | Ga0265327_10115373 | Ga0265327_101153734 | 75 |
| 278 | 3300042876 | Ga0451577_0768459 | Ga0451577_0768459_390_629 | 75 |
| 279 | 3300048929 | Ga0496126_0033876 | Ga0496126_0033876_4106_4339 | 75 |
| 280 | 3300003214 | JGI25165J46597_1005574 | JGI25165J46597_10055741 | 76 |
| 281 | 3300005331 | Ga0070670_101943260 | Ga0070670_1019432601 | 76 |
| 282 | 3300005335 | Ga0070666_10909595 | Ga0070666_109095951 | 76 |
| 283 | 3300005338 | Ga0068868_100417759 | Ga0068868_1004177591 | 76 |
| 284 | 3300005344 | Ga0070661_101451558 | Ga0070661_1014515581 | 76 |
| 285 | 3300005354 | Ga0070675_100762255 | Ga0070675_1007622551 | 76 |
| 286 | 3300005468 | Ga0070707_101254565 | Ga0070707_1012545652 | 76 |
| 287 | 3300005545 | Ga0070695_100995810 | Ga0070695_1009958102 | 76 |
| 288 | 3300005564 | Ga0070664_100128350 | Ga0070664_1001283502 | 76 |
| 289 | 3300005616 | Ga0068852_100179740 | Ga0068852_1001797403 | 76 |
| 290 | 3300005618 | Ga0068864_102018664 | Ga0068864_1020186642 | 76 |
| 291 | 3300005841 | Ga0068863_100432452 | Ga0068863_1004324522 | 76 |
| 292 | 3300006237 | Ga0097621_101730970 | Ga0097621_1017309702 | 76 |
| 293 | 3300009551 | Ga0105238_11452499 | Ga0105238_114524991 | 76 |
| 294 | 3300013296 | Ga0157374_10252238 | Ga0157374_102522383 | 76 |
| 295 | 3300025903 | Ga0207680_10450146 | Ga0207680_104501462 | 76 |
| 296 | 3300025920 | Ga0207649_11267252 | Ga0207649_112672522 | 76 |
| 297 | 3300025925 | Ga0207650_11240242 | Ga0207650_112402422 | 76 |
| 298 | 3300025926 | Ga0207659_10454047 | Ga0207659_104540473 | 76 |
| 299 | 3300025945 | Ga0207679_10390695 | Ga0207679_103906951 | 76 |
| 300 | 3300026023 | Ga0207677_10323552 | Ga0207677_103235522 | 76 |
| 301 | 3300026088 | Ga0207641_10055206 | Ga0207641_100552062 | 76 |
| 302 | 3300026095 | Ga0207676_10351551 | Ga0207676_103515512 | 76 |
| 303 | 3300026142 | Ga0207698_10507407 | Ga0207698_105074072 | 76 |
| 304 | 3300037466 | Ga0395898_0366561 | Ga0395898_0366561_328_558 | 76 |
| 305 | 3300048911 | Ga0496108_0248329 | Ga0496108_0248329_1239_1481 | 76 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar