F398313

General Info

Members Datasets Scaffolds Average Seq Length
305 226 610 218

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0249694|Ga0496118_0249694_71_877
Length 268
Sequence MKAFFHGKVKRAVLQAEPRTGSDISVIGAAPDNGIRRPHIGEVTQIQEGRTMFGFRKKTAFPSADEALPGRGEAIETADTHFVNGAALKGPNPEGSETAYFGLGCFWGAERKFWQTPGVLVTAVGYAGGLTPNATYEEVCSGLTGHNEVVKVVFDPKTISYDQLLKVFFEAHDPTQGMRQGNDIGTQYRSGIYVTSEKQRQAAEAAKARYNEALAAKGFGAVTTEILEAPPFYYAEAYHQQYLAKNPAGYCGLGGTGVSCPIGVGVAA

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
224 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.66
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 0
Rhizoplane 5.25
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0249694 3300048921 Bacteria 1009
2 JGI25404J52841_10000997 3300003659 Bacteria 4650
3 Ga0070658_10072580 3300005327 Bacteria 2821
4 Ga0070660_100027418 3300005339 Bacteria 4250
5 Ga0070691_10010999 3300005341 Bacteria 4132
6 Ga0070668_100388266 3300005347 Bacteria 1189
7 Ga0070669_100303096 3300005353 Bacteria 1285
8 Ga0070671_100063199 3300005355 Bacteria 3082
9 Ga0070674_100571124 3300005356 Bacteria 952
10 Ga0070673_100142978 3300005364 Bacteria 2020
11 Ga0070659_100001109 3300005366 Bacteria 19641
12 Ga0070709_10000384 3300005434 Bacteria 27248
13 Ga0070709_10016979 3300005434 Bacteria 4167
14 Ga0070714_100001800 3300005435 Bacteria 15576
15 Ga0070714_100025573 3300005435 Bacteria 4873
16 Ga0070713_100009575 3300005436 Bacteria 6947
17 Ga0070713_100064982 3300005436 Bacteria 3063
18 Ga0070713_100093356 3300005436 Bacteria 2593
19 Ga0070710_10001155 3300005437 Bacteria 12504
20 Ga0070710_10016447 3300005437 Bacteria 3765
21 Ga0070710_10316069 3300005437 Bacteria 1024
22 Ga0070711_100000837 3300005439 Bacteria 16144
23 Ga0070711_100001218 3300005439 Bacteria 13887
24 Ga0070694_100095778 3300005444 Bacteria 2091
25 Ga0070708_100249941 3300005445 Bacteria 1666
26 Ga0070663_100004964 3300005455 Bacteria 7855
27 Ga0070681_10014722 3300005458 Bacteria 7778
28 Ga0070681_10022259 3300005458 Bacteria 6362
29 Ga0070685_10365968 3300005466 Bacteria 989
30 Ga0070706_100165412 3300005467 Bacteria 2065
31 Ga0070706_100439777 3300005467 Bacteria 1214
32 Ga0070707_100506261 3300005468 Bacteria 1169
33 Ga0070698_100282021 3300005471 Bacteria 1593
34 Ga0070697_100044567 3300005536 Bacteria 3593
35 Ga0070697_100086714 3300005536 Bacteria 2584
36 Ga0070665_100258248 3300005548 Bacteria 1743
37 Ga0070665_100337155 3300005548 Bacteria 1512
38 Ga0068855_100364416 3300005563 Bacteria 1590
39 Ga0068857_100842981 3300005577 Bacteria 877
40 Ga0068859_100054381 3300005617 Bacteria 4026
41 Ga0068859_100545195 3300005617 Bacteria 1254
42 Ga0068859_101477902 3300005617 Bacteria 750
43 Ga0068863_100164808 3300005841 Bacteria 2125
44 Ga0068860_100000173 3300005843 Bacteria 106145
45 Ga0068860_100480401 3300005843 Bacteria 1238
46 Ga0081455_10000529 3300005937 Bacteria 49513
47 Ga0081455_10081501 3300005937 Bacteria 2650
48 Ga0081455_10273711 3300005937 Bacteria 1223
49 Ga0081455_10283166 3300005937 Bacteria 1197
50 Ga0081540_1002942 3300005983 Bacteria 13695
51 Ga0081540_1009058 3300005983 Bacteria 6879
52 Ga0081540_1090420 3300005983 Bacteria 1348
53 Ga0081539_10000064 3300005985 Bacteria 247020
54 Ga0070717_10004879 3300006028 Bacteria 9759
55 Ga0075365_10075726 3300006038 Bacteria 2272
56 Ga0075363_100080105 3300006048 Bacteria 1785
57 Ga0075363_100308742 3300006048 Bacteria 919
58 Ga0075364_10082015 3300006051 Bacteria 2133
59 Ga0070715_10000156 3300006163 Bacteria 15788
60 Ga0070715_10036185 3300006163 Bacteria 2035
61 Ga0070716_100000603 3300006173 Bacteria 15160
62 Ga0070716_100039456 3300006173 Bacteria 2621
63 Ga0070716_100126406 3300006173 Bacteria 1609
64 Ga0070712_100002307 3300006175 Bacteria 11753
65 Ga0070712_100224581 3300006175 Bacteria 1488
66 Ga0075362_10091969 3300006177 Bacteria 1409
67 Ga0075367_10007286 3300006178 Bacteria 5656
68 Ga0075367_10009454 3300006178 Bacteria 5096
69 Ga0075369_10033716 3300006186 Bacteria 2171
70 Ga0075366_10044842 3300006195 Bacteria 2621
71 Ga0075370_10022767 3300006353 Bacteria 3444
72 Ga0075370_10040735 3300006353 Bacteria 2621
73 Ga0075430_100021043 3300006846 Bacteria 5546
74 Ga0075434_101229777 3300006871 Bacteria 761
75 Ga0097620_100054380 3300006931 Bacteria 4026
76 Ga0097620_100545209 3300006931 Bacteria 1254
77 Ga0099794_10019860 3300007265 Bacteria 3034
78 Ga0099795_10005206 3300007788 Bacteria 3436
79 Ga0105240_10002243 3300009093 Bacteria 31398
80 Ga0105240_10004251 3300009093 Bacteria 21894
81 Ga0105240_10038516 3300009093 Bacteria 6132
82 Ga0105240_10068193 3300009093 Bacteria 4406
83 Ga0105247_10042131 3300009101 Bacteria 2795
84 Ga0105237_10029170 3300009545 Bacteria 5612
85 Ga0105237_10378434 3300009545 Bacteria 1420
86 Ga0105237_10960213 3300009545 Bacteria 862
87 Ga0099796_10034387 3300010159 Bacteria 1674
88 Ga0105239_10236633 3300010375 Bacteria 2050
89 Ga0163162_10034791 3300013306 Bacteria 5015
90 Ga0157375_10640470 3300013308 Bacteria 1220
91 Ga0163163_10012319 3300014325 Bacteria 7789
92 Ga0163163_10165902 3300014325 Bacteria 2254
93 Ga0157379_10405016 3300014968 Bacteria 1254
94 Ga0157376_10070922 3300014969 Bacteria 2959
95 Ga0157376_10383630 3300014969 Bacteria 1354
96 Ga0197907_11469461 3300020069 Bacteria 1488
97 Ga0206354_10734319 3300020081 Bacteria 1771
98 Ga0213876_10000497 3300021384 Bacteria 30729
99 Ga0207692_10001760 3300025898 Bacteria 8224
100 Ga0207692_10010629 3300025898 Bacteria 3887
101 Ga0207710_10327920 3300025900 Bacteria 777
102 Ga0207685_10007254 3300025905 Bacteria 3077
103 Ga0207685_10159541 3300025905 Bacteria 1028
104 Ga0207699_10000422 3300025906 Bacteria 21687
105 Ga0207699_10003977 3300025906 Bacteria 7070
106 Ga0207699_10009297 3300025906 Bacteria 4888
107 Ga0207705_10056903 3300025909 Bacteria 2821
108 Ga0207684_10031846 3300025910 Bacteria 4486
109 Ga0207695_10000595 3300025913 Bacteria 72573
110 Ga0207695_10005682 3300025913 Bacteria 16457
111 Ga0207671_10684127 3300025914 Bacteria 816
112 Ga0207693_10000073 3300025915 Bacteria 89380
113 Ga0207693_10001701 3300025915 Bacteria 19388
114 Ga0207663_10001286 3300025916 Bacteria 11625
115 Ga0207663_10003968 3300025916 Bacteria 7321
116 Ga0207663_10171851 3300025916 Bacteria 1540
117 Ga0207657_10047454 3300025919 Bacteria 3755
118 Ga0207649_10414279 3300025920 Bacteria 1011
119 Ga0207652_10067925 3300025921 Bacteria 3092
120 Ga0207646_10011798 3300025922 Bacteria 8439
121 Ga0207681_10771295 3300025923 Bacteria 802
122 Ga0207700_10282492 3300025928 Bacteria 1428
123 Ga0207700_10850441 3300025928 Bacteria 816
124 Ga0207664_10003744 3300025929 Bacteria 10212
125 Ga0207664_10036736 3300025929 Bacteria 3786
126 Ga0207644_10568690 3300025931 Bacteria 939
127 Ga0207690_10000355 3300025932 Bacteria 30386
128 Ga0207665_10000909 3300025939 Bacteria 19960
129 Ga0207665_10001342 3300025939 Bacteria 16588
130 Ga0207665_10205233 3300025939 Bacteria 1437
131 Ga0207667_10083983 3300025949 Bacteria 3297
132 Ga0207667_10181495 3300025949 Bacteria 2161
133 Ga0207651_10160095 3300025960 Bacteria 1764
134 Ga0207668_10491134 3300025972 Bacteria 1054
135 Ga0207658_10008155 3300025986 Bacteria 7134
136 Ga0207703_10072874 3300026035 Bacteria 2840
137 Ga0207678_10043944 3300026067 Bacteria 3866
138 Ga0207678_10426517 3300026067 Bacteria 1150
139 Ga0207678_10512325 3300026067 Bacteria 1046
140 Ga0207641_10263201 3300026088 Bacteria 1616
141 Ga0207676_10112602 3300026095 Bacteria 2280
142 Ga0207674_11145149 3300026116 Bacteria 747
143 Ga0209179_1028659 3300027512 Bacteria 1130
144 Ga0268266_10004734 3300028379 Bacteria 12936
145 Ga0268266_10148457 3300028379 Bacteria 2110
146 Ga0268266_10233563 3300028379 Bacteria 1695
147 Ga0268265_10097054 3300028380 Bacteria 2370
148 Ga0268264_10000045 3300028381 Bacteria 364764
149 Ga0265326_10003534 3300028558 Bacteria 5110
150 Ga0265334_10016782 3300028573 Bacteria 3027
151 Ga0265318_10007123 3300028577 Bacteria 5085
152 Ga0307517_10002571 3300028786 Bacteria 28898
153 Ga0307517_10146922 3300028786 Bacteria 1632
154 Ga0265338_10024086 3300028800 Bacteria 6231
155 Ga0265330_10096476 3300031235 Bacteria 1267
156 Ga0265328_10183572 3300031239 Bacteria 792
157 Ga0265325_10079397 3300031241 Bacteria 1633
158 Ga0265340_10021523 3300031247 Bacteria 3307
159 Ga0265340_10036006 3300031247 Bacteria 2455
160 Ga0265316_10009583 3300031344 Bacteria 8901
161 Ga0307513_10002879 3300031456 Bacteria 23573
162 Ga0307509_10315326 3300031507 Bacteria 1304
163 Ga0307408_100111244 3300031548 Bacteria 2104
164 Ga0265313_10003742 3300031595 Bacteria 12102
165 Ga0265314_10023323 3300031711 Bacteria 4720
166 Ga0265314_10103284 3300031711 Bacteria 1827
167 Ga0265314_10210205 3300031711 Bacteria 1143
168 Ga0265314_10347648 3300031711 Bacteria 817
169 Ga0265342_10095737 3300031712 Bacteria 1697
170 Ga0316215_1008630 3300033544 Bacteria 1002
171 Ga0373934_0017793 3300035086 Bacteria 2715
172 Ga0373951_0018636 3300035091 Bacteria 1578
173 Ga0373923_0038136 3300035111 Bacteria 1968
174 Ga0373936_0011383 3300035113 Bacteria 3366
175 Ga0373953_0009494 3300035117 Bacteria 3351
176 Ga0373954_0057526 3300035118 Bacteria 1831
177 Ga0373956_0007991 3300035119 Bacteria 4276
178 Ga0373957_0002248 3300035120 Bacteria 5470
179 Ga0373955_0255278 3300035172 Bacteria 1051
180 Ga0373924_0056217 3300035410 Bacteria 1639
181 Ga0373931_0267257 3300035691 Bacteria 1046
182 Ga0373933_0000187 3300035724 Bacteria 41028
183 Ga0373933_0006632 3300035724 Bacteria 6306
184 Ga0395901_0180018 3300038443 Bacteria 2217
185 Ga0400488_37014 3300038741 Bacteria 4230
186 Ga0400483_245341 3300039062 Bacteria 2795
187 Ga0436365_0107859 3300039437 Bacteria 44837
188 Ga0436360_0458332 3300039438 Bacteria 783
189 Ga0436361_0731164 3300039447 Bacteria 1228
190 Ga0436362_0077546 3300039453 Bacteria 5999
191 Ga0466963_0125535 3300044694 Bacteria 1769
192 Ga0466957_0100165 3300044842 Bacteria 1826
193 Ga0466959_0536657 3300045049 Bacteria 789
194 Ga0466958_0150840 3300045836 Bacteria 1466
195 Ga0495603_0098120 3300046455 Bacteria 1711
196 Ga0495629_0041895 3300046459 Bacteria 3219
197 Ga0495651_0020827 3300046462 Bacteria 5090
198 Ga0495653_0013128 3300046463 Bacteria 6753
199 Ga0495653_0500046 3300046463 Bacteria 758
200 Ga0495664_0033871 3300046477 Bacteria 3003
201 Ga0495610_0130567 3300046512 Bacteria 1091
202 Ga0495618_0231570 3300046514 Bacteria 1163
203 Ga0495628_0017288 3300046516 Bacteria 6005
204 Ga0495652_0021660 3300046529 Bacteria 5712
205 Ga0495640_0189100 3300046533 Bacteria 1309
206 Ga0495586_0050015 3300046535 Bacteria 2261
207 Ga0495587_0013287 3300046536 Bacteria 5176
208 Ga0495597_0073336 3300046542 Bacteria 1472
209 Ga0495645_0008628 3300046543 Bacteria 7117
210 Ga0495656_0089285 3300046615 Bacteria 1406
211 Ga0495634_0055508 3300046642 Bacteria 2648
212 Ga0495657_0037615 3300046675 Bacteria 3334
213 Ga0495623_0016572 3300046679 Bacteria 4760
214 Ga0495646_0008240 3300046680 Bacteria 6626
215 Ga0495669_0073628 3300046684 Bacteria 1560
216 Ga0495604_0031145 3300047317 Bacteria 4232
217 Ga0495604_0154393 3300047317 Bacteria 1628
218 Ga0495674_0038425 3300047319 Bacteria 4296
219 Ga0495680_0018114 3300047322 Bacteria 5989
220 Ga0495675_0008408 3300047444 Bacteria 6391
221 Ga0495684_0015998 3300047471 Bacteria 5775
222 Ga0495593_0102614 3300047673 Bacteria 1466
223 Ga0495602_0123073 3300048088 Bacteria 2083
224 Ga0496101_0024635 3300048904 Bacteria 4167
225 Ga0496101_0591286 3300048904 Bacteria 877
226 Ga0496102_0051886 3300048905 Bacteria 3736
227 Ga0496104_0004229 3300048907 Bacteria 12469
228 Ga0496105_0579504 3300048908 Bacteria 873
229 Ga0496106_0263987 3300048909 Bacteria 1378
230 Ga0496106_0311438 3300048909 Bacteria 1263
231 Ga0496107_0114298 3300048910 Bacteria 1986
232 Ga0496108_0233559 3300048911 Bacteria 1599
233 Ga0496109_0264705 3300048912 Bacteria 1620
234 Ga0496110_0167716 3300048913 Bacteria 1991
235 Ga0496112_0032122 3300048915 Bacteria 5096
236 Ga0496113_0063534 3300048916 Bacteria 2790
237 Ga0496114_0896324 3300048917 Bacteria 768
238 Ga0496115_0090492 3300048918 Bacteria 2500
239 Ga0496121_0007601 3300048924 Bacteria 13042
240 Ga0496121_0084314 3300048924 Bacteria 2506
241 Ga0496122_0075912 3300048925 Bacteria 2368
242 Ga0496123_0034702 3300048926 Bacteria 3607
243 Ga0496124_0240727 3300048927 Bacteria 1346
244 Ga0496125_0000515 3300048928 Bacteria 67237
245 Ga0496125_0031970 3300048928 Bacteria 4680
246 Ga0496125_0065477 3300048928 Bacteria 2879
247 Ga0496126_0124381 3300048929 Bacteria 2234
248 Ga0496126_0145929 3300048929 Bacteria 2032
249 Ga0496126_0225672 3300048929 Bacteria 1571
250 Ga0501031_0026718 3300049568 Bacteria 3763
251 Ga0501032_0123690 3300049569 Bacteria 1709
252 Ga0501033_0073829 3300049570 Bacteria 2504
253 Ga0501034_0113124 3300049571 Bacteria 2704
254 Ga0501034_0264184 3300049571 Bacteria 1663
255 Ga0501034_0888282 3300049571 Bacteria 780
256 Ga0501036_0135500 3300049572 Bacteria 2079
257 Ga0501037_0171648 3300049573 Bacteria 1541
258 Ga0501038_0099113 3300049574 Bacteria 2429
259 Ga0501038_0387898 3300049574 Bacteria 1082
260 Ga0501047_0100311 3300049581 Bacteria 2774
261 Ga0501047_0248432 3300049581 Bacteria 1628
262 Ga0501047_0324426 3300049581 Bacteria 1379
263 Ga0501067_0017845 3300049583 Bacteria 3929
264 Ga0501069_0063597 3300049585 Bacteria 2061
265 Ga0501070_0179416 3300049586 Bacteria 1743
266 Ga0501070_0305285 3300049586 Bacteria 1296
267 Ga0501073_0149383 3300049589 Bacteria 1619
268 Ga0501257_001342 3300049686 Bacteria 5077
269 Ga0501080_0123838 3300049742 Bacteria 2395
270 Ga0501083_0001932 3300049744 Bacteria 14258
271 Ga0501035_0303589 3300049822 Bacteria 1344
272 Ga0501035_0342785 3300049822 Bacteria 1252
273 Ga0501044_0000509 3300049823 Bacteria 47320
274 Ga0501044_0075023 3300049823 Bacteria 3434
275 nmdc:mga03683_80898_c1 3300050489 Bacteria 1402
276 nmdc:mga03n38_100352_c1 3300050490 Bacteria 1395
277 nmdc:mga03n38_10097_c1 3300050490 Bacteria 3460
278 nmdc:mga03n38_7616_c1 3300050490 Bacteria 3842
279 nmdc:mga00v17_70760_c1 3300050491 Bacteria 2161
280 nmdc:mga0yw44_137626_c1 3300050492 Bacteria 1585
281 nmdc:mga0k408_87001_c1 3300050493 Bacteria 1835
282 nmdc:mga06z11_15695_c1 3300050494 Bacteria 3388
283 nmdc:mga06z11_7473_c1 3300050494 Bacteria 4498
284 nmdc:mga07m45_20657_c1 3300050496 Bacteria 3578
285 nmdc:mga07m45_8894_c2 3300050496 Bacteria 2677
286 nmdc:mga05p37_11044_c1 3300050507 Bacteria 10729
287 nmdc:mga05p37_50046_c1 3300050507 Bacteria 5139
288 nmdc:mga0qj67_3492_c1 3300050509 Bacteria 11327
289 Ga0495601_0056605 3300053077 Bacteria 2483
290 Ga0495595_0038541 3300053084 Bacteria 2177
291 Ga0495619_0108167 3300053085 Bacteria 1897
292 Ga0500578_0501227 3300053086 Bacteria 683
293 Ga0500566_0049192 3300053094 Bacteria 2415
294 Ga0500554_017054 3300053102 Bacteria 1933
295 Ga0500595_000149 3300053119 Bacteria 45942
296 Ga0500561_0041149 3300053137 Bacteria 1221
297 Ga0500577_0000113 3300053142 Bacteria 19832
298 Ga0500590_086870 3300053148 Bacteria 1525
299 Ga0500616_0013897 3300053153 Bacteria 4648
300 Ga0500638_002269 3300053162 Bacteria 6590
301 Ga0500636_0093551 3300053177 Bacteria 1719
302 Ga0500637_0008447 3300053178 Bacteria 5194
303 Ga0500661_000500 3300055283 Bacteria 7285
304 Ga0501082_0008221 3300060353 Bacteria 8998
305 2770198491 2767802442 Bacteria 5747986
306 Ga0496118_0249694
307 JGI25404J52841_10000997
308 Ga0070658_10072580
309 Ga0070660_100027418
310 Ga0070691_10010999
311 Ga0070668_100388266
312 Ga0070669_100303096
313 Ga0070671_100063199
314 Ga0070674_100571124
315 Ga0070673_100142978
316 Ga0070659_100001109
317 Ga0070709_10000384
318 Ga0070709_10016979
319 Ga0070714_100001800
320 Ga0070714_100025573
321 Ga0070713_100009575
322 Ga0070713_100064982
323 Ga0070713_100093356
324 Ga0070710_10001155
325 Ga0070710_10016447
326 Ga0070710_10316069
327 Ga0070711_100000837
328 Ga0070711_100001218
329 Ga0070694_100095778
330 Ga0070708_100249941
331 Ga0070663_100004964
332 Ga0070681_10014722
333 Ga0070681_10022259
334 Ga0070685_10365968
335 Ga0070706_100165412
336 Ga0070706_100439777
337 Ga0070707_100506261
338 Ga0070698_100282021
339 Ga0070697_100044567
340 Ga0070697_100086714
341 Ga0070665_100258248
342 Ga0070665_100337155
343 Ga0068855_100364416
344 Ga0068857_100842981
345 Ga0068859_100054381
346 Ga0068859_100545195
347 Ga0068859_101477902
348 Ga0068863_100164808
349 Ga0068860_100000173
350 Ga0068860_100480401
351 Ga0081455_10000529
352 Ga0081455_10081501
353 Ga0081455_10273711
354 Ga0081455_10283166
355 Ga0081540_1002942
356 Ga0081540_1009058
357 Ga0081540_1090420
358 Ga0081539_10000064
359 Ga0070717_10004879
360 Ga0075365_10075726
361 Ga0075363_100080105
362 Ga0075363_100308742
363 Ga0075364_10082015
364 Ga0070715_10000156
365 Ga0070715_10036185
366 Ga0070716_100000603
367 Ga0070716_100039456
368 Ga0070716_100126406
369 Ga0070712_100002307
370 Ga0070712_100224581
371 Ga0075362_10091969
372 Ga0075367_10007286
373 Ga0075367_10009454
374 Ga0075369_10033716
375 Ga0075366_10044842
376 Ga0075370_10022767
377 Ga0075370_10040735
378 Ga0075430_100021043
379 Ga0075434_101229777
380 Ga0097620_100054380
381 Ga0097620_100545209
382 Ga0099794_10019860
383 Ga0099795_10005206
384 Ga0105240_10002243
385 Ga0105240_10004251
386 Ga0105240_10038516
387 Ga0105240_10068193
388 Ga0105247_10042131
389 Ga0105237_10029170
390 Ga0105237_10378434
391 Ga0105237_10960213
392 Ga0099796_10034387
393 Ga0105239_10236633
394 Ga0163162_10034791
395 Ga0157375_10640470
396 Ga0163163_10012319
397 Ga0163163_10165902
398 Ga0157379_10405016
399 Ga0157376_10070922
400 Ga0157376_10383630
401 Ga0197907_11469461
402 Ga0206354_10734319
403 Ga0213876_10000497
404 Ga0207692_10001760
405 Ga0207692_10010629
406 Ga0207710_10327920
407 Ga0207685_10007254
408 Ga0207685_10159541
409 Ga0207699_10000422
410 Ga0207699_10003977
411 Ga0207699_10009297
412 Ga0207705_10056903
413 Ga0207684_10031846
414 Ga0207695_10000595
415 Ga0207695_10005682
416 Ga0207671_10684127
417 Ga0207693_10000073
418 Ga0207693_10001701
419 Ga0207663_10001286
420 Ga0207663_10003968
421 Ga0207663_10171851
422 Ga0207657_10047454
423 Ga0207649_10414279
424 Ga0207652_10067925
425 Ga0207646_10011798
426 Ga0207681_10771295
427 Ga0207700_10282492
428 Ga0207700_10850441
429 Ga0207664_10003744
430 Ga0207664_10036736
431 Ga0207644_10568690
432 Ga0207690_10000355
433 Ga0207665_10000909
434 Ga0207665_10001342
435 Ga0207665_10205233
436 Ga0207667_10083983
437 Ga0207667_10181495
438 Ga0207651_10160095
439 Ga0207668_10491134
440 Ga0207658_10008155
441 Ga0207703_10072874
442 Ga0207678_10043944
443 Ga0207678_10426517
444 Ga0207678_10512325
445 Ga0207641_10263201
446 Ga0207676_10112602
447 Ga0207674_11145149
448 Ga0209179_1028659
449 Ga0268266_10004734
450 Ga0268266_10148457
451 Ga0268266_10233563
452 Ga0268265_10097054
453 Ga0268264_10000045
454 Ga0265326_10003534
455 Ga0265334_10016782
456 Ga0265318_10007123
457 Ga0307517_10002571
458 Ga0307517_10146922
459 Ga0265338_10024086
460 Ga0265330_10096476
461 Ga0265328_10183572
462 Ga0265325_10079397
463 Ga0265340_10021523
464 Ga0265340_10036006
465 Ga0265316_10009583
466 Ga0307513_10002879
467 Ga0307509_10315326
468 Ga0307408_100111244
469 Ga0265313_10003742
470 Ga0265314_10023323
471 Ga0265314_10103284
472 Ga0265314_10210205
473 Ga0265314_10347648
474 Ga0265342_10095737
475 Ga0316215_1008630
476 Ga0373934_0017793
477 Ga0373951_0018636
478 Ga0373923_0038136
479 Ga0373936_0011383
480 Ga0373953_0009494
481 Ga0373954_0057526
482 Ga0373956_0007991
483 Ga0373957_0002248
484 Ga0373955_0255278
485 Ga0373924_0056217
486 Ga0373931_0267257
487 Ga0373933_0000187
488 Ga0373933_0006632
489 Ga0395901_0180018
490 Ga0400488_37014
491 Ga0400483_245341
492 Ga0436365_0107859
493 Ga0436360_0458332
494 Ga0436361_0731164
495 Ga0436362_0077546
496 Ga0466963_0125535
497 Ga0466957_0100165
498 Ga0466959_0536657
499 Ga0466958_0150840
500 Ga0495603_0098120
501 Ga0495629_0041895
502 Ga0495651_0020827
503 Ga0495653_0013128
504 Ga0495653_0500046
505 Ga0495664_0033871
506 Ga0495610_0130567
507 Ga0495618_0231570
508 Ga0495628_0017288
509 Ga0495652_0021660
510 Ga0495640_0189100
511 Ga0495586_0050015
512 Ga0495587_0013287
513 Ga0495597_0073336
514 Ga0495645_0008628
515 Ga0495656_0089285
516 Ga0495634_0055508
517 Ga0495657_0037615
518 Ga0495623_0016572
519 Ga0495646_0008240
520 Ga0495669_0073628
521 Ga0495604_0031145
522 Ga0495604_0154393
523 Ga0495674_0038425
524 Ga0495680_0018114
525 Ga0495675_0008408
526 Ga0495684_0015998
527 Ga0495593_0102614
528 Ga0495602_0123073
529 Ga0496101_0024635
530 Ga0496101_0591286
531 Ga0496102_0051886
532 Ga0496104_0004229
533 Ga0496105_0579504
534 Ga0496106_0263987
535 Ga0496106_0311438
536 Ga0496107_0114298
537 Ga0496108_0233559
538 Ga0496109_0264705
539 Ga0496110_0167716
540 Ga0496112_0032122
541 Ga0496113_0063534
542 Ga0496114_0896324
543 Ga0496115_0090492
544 Ga0496121_0007601
545 Ga0496121_0084314
546 Ga0496122_0075912
547 Ga0496123_0034702
548 Ga0496124_0240727
549 Ga0496125_0000515
550 Ga0496125_0031970
551 Ga0496125_0065477
552 Ga0496126_0124381
553 Ga0496126_0145929
554 Ga0496126_0225672
555 Ga0501031_0026718
556 Ga0501032_0123690
557 Ga0501033_0073829
558 Ga0501034_0113124
559 Ga0501034_0264184
560 Ga0501034_0888282
561 Ga0501036_0135500
562 Ga0501037_0171648
563 Ga0501038_0099113
564 Ga0501038_0387898
565 Ga0501047_0100311
566 Ga0501047_0248432
567 Ga0501047_0324426
568 Ga0501067_0017845
569 Ga0501069_0063597
570 Ga0501070_0179416
571 Ga0501070_0305285
572 Ga0501073_0149383
573 Ga0501257_001342
574 Ga0501080_0123838
575 Ga0501083_0001932
576 Ga0501035_0303589
577 Ga0501035_0342785
578 Ga0501044_0000509
579 Ga0501044_0075023
580 nmdc:mga03683_80898_c1
581 nmdc:mga03n38_100352_c1
582 nmdc:mga03n38_10097_c1
583 nmdc:mga03n38_7616_c1
584 nmdc:mga00v17_70760_c1
585 nmdc:mga0yw44_137626_c1
586 nmdc:mga0k408_87001_c1
587 nmdc:mga06z11_15695_c1
588 nmdc:mga06z11_7473_c1
589 nmdc:mga07m45_20657_c1
590 nmdc:mga07m45_8894_c2
591 nmdc:mga05p37_11044_c1
592 nmdc:mga05p37_50046_c1
593 nmdc:mga0qj67_3492_c1
594 Ga0495601_0056605
595 Ga0495595_0038541
596 Ga0495619_0108167
597 Ga0500578_0501227
598 Ga0500566_0049192
599 Ga0500554_017054
600 Ga0500595_000149
601 Ga0500561_0041149
602 Ga0500577_0000113
603 Ga0500590_086870
604 Ga0500616_0013897
605 Ga0500638_002269
606 Ga0500636_0093551
607 Ga0500637_0008447
608 Ga0500661_000500
609 Ga0501082_0008221
610 2770198491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

98

252

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9476 9 199
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9449 10 194
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9428 9 199
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.935 10 194
1ff3-assembly1.cif.gz_A structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9326 8 219
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9326 46 195 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.926 44 197 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9249 6 197 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9182 37 196 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9144 46 195 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A318WPW0-F1-model_v4 deleted 0.9619 33 191
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.961 34 185 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A7D9H5P6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9597 19 194 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A3Q1F7T1-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9596 8 195 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A3B1JU28-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9569 26 195 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map