F398162

General Info

Members Datasets Scaffolds Average Seq Length
305 181 610 127

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_11056803|Ga0207703_110568032
Length 117
Sequence VIYGLGTDVVEIHRIEKALERWGDRFAEKVLVESELARFKAHRLAKEAFVKALGTGIRSPANWHGVWVKNLPSGKPVLEYSKALASLLKKRGVTSSHLSLSDEKGVAFATVILECEK

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
124 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
125 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
126 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
132 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_11056803 3300026035 Bacteria 779
2 Ga0065707_10162379 3300005295 Bacteria 1552
3 Ga0070683_100493191 3300005329 Bacteria 1170
4 Ga0070683_102196376 3300005329 Bacteria 530
5 Ga0068869_100056926 3300005334 Bacteria 2853
6 Ga0068869_100276672 3300005334 Bacteria 1349
7 Ga0070680_100092103 3300005336 Bacteria 2510
8 Ga0070680_100241198 3300005336 Bacteria 1528
9 Ga0070680_100998048 3300005336 Bacteria 723
10 Ga0070689_100785080 3300005340 Bacteria 837
11 Ga0070691_10140607 3300005341 Bacteria 1230
12 Ga0070687_100154852 3300005343 Bacteria 1349
13 Ga0070687_100367793 3300005343 Bacteria 933
14 Ga0070692_10014602 3300005345 Bacteria 3695
15 Ga0070692_10924360 3300005345 Bacteria 605
16 Ga0070669_100257013 3300005353 Bacteria 1392
17 Ga0070675_100228825 3300005354 Bacteria 1621
18 Ga0070675_100497803 3300005354 Bacteria 1098
19 Ga0070674_100039601 3300005356 Bacteria 3184
20 Ga0070674_100725333 3300005356 Bacteria 852
21 Ga0070673_101161174 3300005364 Bacteria 723
22 Ga0070673_101813616 3300005364 Bacteria 578
23 Ga0070688_100116955 3300005365 Bacteria 1781
24 Ga0070714_100110391 3300005435 Bacteria 2434
25 Ga0070701_11162168 3300005438 Bacteria 546
26 Ga0070711_100670539 3300005439 Bacteria 871
27 Ga0070711_100757371 3300005439 Bacteria 821
28 Ga0070705_101176292 3300005440 Bacteria 631
29 Ga0070700_100005092 3300005441 Bacteria 6935
30 Ga0070694_100122660 3300005444 Bacteria 1866
31 Ga0070681_10352923 3300005458 Bacteria 1381
32 Ga0070681_10683108 3300005458 Bacteria 942
33 Ga0070685_10105651 3300005466 Bacteria 1726
34 Ga0070698_100225792 3300005471 Bacteria 1806
35 Ga0070699_102106257 3300005518 Bacteria 515
36 Ga0070679_101450026 3300005530 Bacteria 633
37 Ga0070684_100030581 3300005535 Bacteria 4576
38 Ga0070697_101502724 3300005536 Bacteria 602
39 Ga0070672_100178685 3300005543 Bacteria 1768
40 Ga0070672_101389594 3300005543 Bacteria 628
41 Ga0070672_101521149 3300005543 Bacteria 600
42 Ga0070686_100052785 3300005544 Bacteria 2594
43 Ga0070686_100908109 3300005544 Bacteria 717
44 Ga0070695_100066442 3300005545 Bacteria 2350
45 Ga0070696_100076007 3300005546 Bacteria 2370
46 Ga0070696_100080212 3300005546 Bacteria 2310
47 Ga0070696_100285843 3300005546 Bacteria 1259
48 Ga0070696_100550728 3300005546 Bacteria 924
49 Ga0070696_101480073 3300005546 Bacteria 581
50 Ga0070696_101774667 3300005546 Bacteria 533
51 Ga0070693_100097442 3300005547 Bacteria 1785
52 Ga0070693_100746017 3300005547 Bacteria 721
53 Ga0070704_100087303 3300005549 Bacteria 2314
54 Ga0070704_101481711 3300005549 Bacteria 624
55 Ga0068855_101090984 3300005563 Bacteria 835
56 Ga0068856_100190567 3300005614 Bacteria 2064
57 Ga0068856_100854683 3300005614 Bacteria 929
58 Ga0070702_100347272 3300005615 Bacteria 1044
59 Ga0068859_100533454 3300005617 Bacteria 1268
60 Ga0068864_100017560 3300005618 Bacteria 5964
61 Ga0068861_100012149 3300005719 Bacteria 6001
62 Ga0068863_102272517 3300005841 Bacteria 552
63 Ga0068858_100009976 3300005842 Bacteria 9020
64 Ga0068858_100861500 3300005842 Bacteria 885
65 Ga0068858_102127325 3300005842 Bacteria 555
66 Ga0068860_100956551 3300005843 Bacteria 874
67 Ga0068860_101711437 3300005843 Bacteria 651
68 Ga0068860_102456641 3300005843 Bacteria 541
69 Ga0068862_100121086 3300005844 Bacteria 2306
70 Ga0068862_100320550 3300005844 Bacteria 1430
71 Ga0068862_100410418 3300005844 Bacteria 1269
72 Ga0068862_101936726 3300005844 Bacteria 600
73 Ga0081538_10157173 3300005981 Bacteria 1017
74 Ga0070715_10046596 3300006163 Bacteria 1844
75 Ga0068871_100004681 3300006358 Bacteria 9565
76 Ga0068871_101720002 3300006358 Bacteria 595
77 Ga0075428_100275227 3300006844 Bacteria 1811
78 Ga0075428_101076081 3300006844 Bacteria 850
79 Ga0075430_100064337 3300006846 Bacteria 3081
80 Ga0075431_100009421 3300006847 Bacteria 9802
81 Ga0075431_100344002 3300006847 Bacteria 1500
82 Ga0075431_100489203 3300006847 Bacteria 1222
83 Ga0075433_10007931 3300006852 Bacteria 8450
84 Ga0075433_10182247 3300006852 Bacteria 1869
85 Ga0075434_100000004 3300006871 Bacteria 112839
86 Ga0075434_100002226 3300006871 Bacteria 16934
87 Ga0075429_101573823 3300006880 Bacteria 571
88 Ga0068865_101144826 3300006881 Bacteria 687
89 Ga0068865_101177190 3300006881 Bacteria 678
90 Ga0075436_100180779 3300006914 Bacteria 1491
91 Ga0075436_101234243 3300006914 Bacteria 565
92 Ga0097620_100533479 3300006931 Bacteria 1268
93 Ga0075435_100000806 3300007076 Bacteria 19514
94 Ga0075435_100024375 3300007076 Bacteria 4695
95 Ga0075435_101592069 3300007076 Bacteria 573
96 Ga0099794_10107965 3300007265 Bacteria 1393
97 Ga0099795_10160140 3300007788 Bacteria 928
98 Ga0111539_10067651 3300009094 Bacteria 4218
99 Ga0111539_10199812 3300009094 Bacteria 2331
100 Ga0111539_10226564 3300009094 Bacteria 2177
101 Ga0111539_10319958 3300009094 Bacteria 1805
102 Ga0111539_10504671 3300009094 Bacteria 1409
103 Ga0111539_10983687 3300009094 Bacteria 981
104 Ga0114129_10405421 3300009147 Bacteria 1796
105 Ga0105243_10005293 3300009148 Bacteria 10086
106 Ga0105243_11889601 3300009148 Bacteria 630
107 Ga0105242_10188167 3300009176 Bacteria 1826
108 Ga0105248_11149455 3300009177 Bacteria 878
109 Ga0105249_10005738 3300009553 Bacteria 10735
110 Ga0157378_13315698 3300013297 Unclassified 500
111 Ga0157372_10226192 3300013307 Bacteria 2169
112 Ga0157380_10019432 3300014326 Bacteria 5063
113 Ga0157380_11446018 3300014326 Bacteria 739
114 Ga0157377_10459035 3300014745 Bacteria 881
115 Ga0157379_11304972 3300014968 Bacteria 701
116 Ga0157376_10306561 3300014969 Bacteria 1505
117 Ga0207642_10086513 3300025899 Bacteria 1536
118 Ga0207688_10051243 3300025901 Bacteria 2312
119 Ga0207680_10521979 3300025903 Bacteria 847
120 Ga0207685_10086148 3300025905 Bacteria 1312
121 Ga0207643_10140579 3300025908 Bacteria 1442
122 Ga0207707_10472944 3300025912 Bacteria 1071
123 Ga0207660_10083733 3300025917 Bacteria 2349
124 Ga0207660_10324654 3300025917 Bacteria 1230
125 Ga0207660_10429432 3300025917 Bacteria 1067
126 Ga0207662_10179912 3300025918 Bacteria 1360
127 Ga0207662_10247320 3300025918 Bacteria 1169
128 Ga0207662_10645252 3300025918 Bacteria 739
129 Ga0207652_11321321 3300025921 Bacteria 624
130 Ga0207650_10722777 3300025925 Bacteria 842
131 Ga0207659_10028933 3300025926 Bacteria 3770
132 Ga0207687_10191710 3300025927 Bacteria 1591
133 Ga0207664_10410498 3300025929 Bacteria 1205
134 Ga0207706_10487028 3300025933 Bacteria 1065
135 Ga0207670_10582557 3300025936 Bacteria 917
136 Ga0207704_10003767 3300025938 Bacteria 6904
137 Ga0207704_10213370 3300025938 Bacteria 1422
138 Ga0207691_10104311 3300025940 Bacteria 2527
139 Ga0207691_10692310 3300025940 Bacteria 860
140 Ga0207711_11125575 3300025941 Bacteria 726
141 Ga0207689_10033284 3300025942 Bacteria 4283
142 Ga0207689_10325754 3300025942 Bacteria 1275
143 Ga0207661_10022463 3300025944 Bacteria 4753
144 Ga0207667_10907079 3300025949 Bacteria 873
145 Ga0207712_10003362 3300025961 Bacteria 10122
146 Ga0207668_10020270 3300025972 Bacteria 4221
147 Ga0207703_10021862 3300026035 Bacteria 5009
148 Ga0207703_10406568 3300026035 Bacteria 1264
149 Ga0207708_10003562 3300026075 Bacteria 11479
150 Ga0207702_10253420 3300026078 Bacteria 1654
151 Ga0207702_11153391 3300026078 Bacteria 769
152 Ga0207648_10000792 3300026089 Bacteria 35602
153 Ga0207676_10250130 3300026095 Bacteria 1595
154 Ga0207675_100011216 3300026118 Bacteria 8392
155 Ga0209981_1013558 3300027378 Bacteria 1134
156 Ga0209974_10115843 3300027876 Bacteria 946
157 Ga0207428_10030468 3300027907 Bacteria 4459
158 Ga0207428_10054369 3300027907 Bacteria 3189
159 Ga0268265_10002153 3300028380 Bacteria 15253
160 Ga0268265_10300839 3300028380 Bacteria 1444
161 Ga0268264_11109136 3300028381 Bacteria 800
162 Ga0307408_100735391 3300031548 Bacteria 890
163 Ga0307405_10786924 3300031731 Bacteria 796
164 Ga0307407_10642152 3300031903 Bacteria 794
165 Ga0307416_100185225 3300032002 Bacteria 1956
166 Ga0307416_100272466 3300032002 Bacteria 1663
167 Ga0307416_100376934 3300032002 Bacteria 1447
168 Ga0307416_101613078 3300032002 Bacteria 754
169 Ga0307416_102324214 3300032002 Bacteria 636
170 Ga0307411_10078780 3300032005 Bacteria 2260
171 Ga0307411_10504978 3300032005 Bacteria 1023
172 Ga0373934_0087970 3300035086 Bacteria 1251
173 Ga0373923_0102767 3300035111 Bacteria 1262
174 Ga0373923_0195290 3300035111 Bacteria 934
175 Ga0373955_0367219 3300035172 Bacteria 873
176 Ga0373961_0012796 3300035241 Bacteria 2106
177 Ga0373924_0270624 3300035410 Bacteria 753
178 Ga0373931_0011345 3300035691 Bacteria 4305
179 Ga0373931_0199823 3300035691 Bacteria 1194
180 Ga0373931_0216653 3300035691 Bacteria 1151
181 Ga0373931_0481257 3300035691 Bacteria 798
182 Ga0373935_0002419 3300035692 Bacteria 10687
183 Ga0373927_0245702 3300035695 Bacteria 1176
184 Ga0373933_0504539 3300035724 Bacteria 793
185 Ga0373947_0279777 3300035725 Bacteria 1109
186 Ga0373937_0132579 3300036401 Bacteria 2328
187 Ga0373937_0263864 3300036401 Bacteria 1624
188 Ga0373937_1228684 3300036401 Bacteria 698
189 Ga0373925_0032804 3300037068 Bacteria 3824
190 Ga0242420_078737 3300038996 Bacteria 679
191 Ga0439439_0177075 3300041406 Bacteria 613
192 Ga0439441_008709 3300042001 Bacteria 1664
193 Ga0439441_137926 3300042001 Bacteria 568
194 Ga0439443_003575 3300042003 Bacteria 1971
195 Ga0450888_028358 3300042126 Bacteria 741
196 Ga0450902_067944 3300042137 Bacteria 620
197 Ga0439458_0206601 3300042157 Bacteria 538
198 Ga0439435_0006034 3300042436 Bacteria 2703
199 Ga0439444_0005615 3300042437 Bacteria 1870
200 Ga0439460_0000698 3300042461 Bacteria 7457
201 Ga0450918_105624 3300042531 Bacteria 554
202 Ga0450893_0062331 3300042532 Bacteria 713
203 Ga0466964_0016152 3300044706 Bacteria 2847
204 Ga0451576_0873030 3300045051 Bacteria 944
205 Ga0466967_0026733 3300045976 Bacteria 4787
206 Ga0495652_0117714 3300046529 Bacteria 2125
207 Ga0495598_0209814 3300046537 Bacteria 707
208 Ga0495621_0135357 3300046539 Bacteria 961
209 Ga0495621_0221294 3300046539 Bacteria 766
210 Ga0495635_0509348 3300046663 Bacteria 792
211 Ga0495657_0458481 3300046675 Bacteria 746
212 Ga0495623_0170478 3300046679 Bacteria 1272
213 Ga0495669_0413245 3300046684 Bacteria 654
214 Ga0495675_0154329 3300047444 Bacteria 1417
215 Ga0501292_011316 3300049515 Bacteria 1349
216 Ga0501292_098764 3300049515 Bacteria 576
217 Ga0501298_063699 3300049521 Bacteria 785
218 Ga0501031_0504291 3300049568 Bacteria 780
219 Ga0501032_0834388 3300049569 Bacteria 581
220 Ga0501033_0304975 3300049570 Bacteria 1120
221 Ga0501036_0216232 3300049572 Bacteria 1610
222 Ga0501038_0131892 3300049574 Bacteria 2051
223 Ga0501038_1363394 3300049574 Bacteria 510
224 Ga0501039_0018478 3300049575 Bacteria 5352
225 Ga0501039_0569682 3300049575 Bacteria 888
226 Ga0501039_1404077 3300049575 Bacteria 537
227 Ga0501040_0008397 3300049576 Bacteria 6712
228 Ga0501040_0052963 3300049576 Bacteria 2778
229 Ga0501040_0058788 3300049576 Bacteria 2641
230 Ga0501040_0147937 3300049576 Bacteria 1656
231 Ga0501040_0418689 3300049576 Bacteria 963
232 Ga0501040_0452706 3300049576 Bacteria 924
233 Ga0501040_0903675 3300049576 Bacteria 640
234 Ga0501041_0006388 3300049577 Bacteria 6897
235 Ga0501041_0016271 3300049577 Bacteria 4422
236 Ga0501041_0055946 3300049577 Bacteria 2409
237 Ga0501041_0775430 3300049577 Bacteria 614
238 Ga0501042_0048238 3300049578 Bacteria 3037
239 Ga0501042_0230496 3300049578 Bacteria 1336
240 Ga0501042_0863888 3300049578 Bacteria 659
241 Ga0501046_0050181 3300049580 Bacteria 3297
242 Ga0501048_0018109 3300049582 Bacteria 5182
243 Ga0501048_0485027 3300049582 Bacteria 886
244 Ga0501048_0652243 3300049582 Bacteria 756
245 Ga0501048_1085501 3300049582 Bacteria 576
246 Ga0501068_0176624 3300049584 Bacteria 1350
247 Ga0501068_0592586 3300049584 Bacteria 722
248 Ga0501068_0608816 3300049584 Bacteria 712
249 Ga0501068_0638952 3300049584 Bacteria 694
250 Ga0501069_0640007 3300049585 Bacteria 639
251 Ga0501071_0001985 3300049587 Bacteria 12236
252 Ga0501072_0001942 3300049588 Bacteria 15415
253 Ga0501072_0003633 3300049588 Bacteria 11606
254 Ga0501073_0077616 3300049589 Bacteria 2311
255 Ga0501073_0848633 3300049589 Bacteria 629
256 Ga0501074_0421862 3300049590 Bacteria 946
257 Ga0501074_0457106 3300049590 Bacteria 905
258 Ga0501075_0010210 3300049591 Bacteria 6594
259 Ga0501075_0155727 3300049591 Bacteria 1742
260 Ga0501075_0732083 3300049591 Bacteria 753
261 Ga0501076_0000390 3300049592 Bacteria 27421
262 Ga0501076_0080849 3300049592 Bacteria 2609
263 Ga0501076_0549757 3300049592 Bacteria 952
264 Ga0501077_0026854 3300049593 Bacteria 3655
265 Ga0501077_0460602 3300049593 Bacteria 814
266 Ga0501079_0000671 3300049741 Bacteria 22952
267 Ga0501079_0045389 3300049741 Bacteria 3391
268 Ga0501080_0001393 3300049742 Bacteria 20224
269 Ga0501080_0047890 3300049742 Bacteria 3980
270 Ga0501080_0211128 3300049742 Bacteria 1779
271 Ga0501080_1171901 3300049742 Bacteria 661
272 Ga0501081_0003605 3300049743 Bacteria 9900
273 Ga0501081_0039970 3300049743 Bacteria 3211
274 Ga0501081_0279879 3300049743 Bacteria 1221
275 Ga0501081_0629338 3300049743 Bacteria 804
276 Ga0501283_055143 3300049779 Bacteria 710
277 Ga0501045_0006961 3300049824 Bacteria 7839
278 Ga0501045_0142675 3300049824 Bacteria 1781
279 nmdc:mga09592_453214_c1 3300050508 Bacteria 1107
280 nmdc:mga0qj67_24839_c1 3300050509 Bacteria 4624
281 nmdc:mga0qj67_2695_c1 3300050509 Bacteria 12739
282 nmdc:mga0qj67_425549_c1 3300050509 Bacteria 1070
283 nmdc:mga0qj67_884168_c1 3300050509 Bacteria 705
284 nmdc:mga06r32_458482_c1 3300050510 Bacteria 1254
285 nmdc:mga06r32_48672_c1 3300050510 Bacteria 4053
286 nmdc:mga08y16_19320_c1 3300050511 Bacteria 7182
287 nmdc:mga08y16_651186_c1 3300050511 Bacteria 1058
288 nmdc:mga08y16_90843_c1 3300050511 Bacteria 3183
289 nmdc:mga0n895_14255_c1 3300050512 Bacteria 7213
290 nmdc:mga0n895_68049_c1 3300050512 Bacteria 3528
291 nmdc:mga0rr50_12859_c1 3300050513 Bacteria 5426
292 nmdc:mga08x19_7175_c1 3300050514 Bacteria 6621
293 nmdc:mga08x19_9954_c1 3300050514 Bacteria 5699
294 nmdc:mga0a205_30309_c1 3300050515 Bacteria 5178
295 nmdc:mga0a205_839954_c1 3300050515 Bacteria 766
296 Ga0501084_0051017 3300054114 Bacteria 3462
297 Ga0501084_0281692 3300054114 Bacteria 1404
298 Ga0501084_0397429 3300054114 Bacteria 1165
299 Ga0501084_0505432 3300054114 Bacteria 1021
300 Ga0501084_1445292 3300054114 Bacteria 576
301 Ga0501084_1555284 3300054114 Bacteria 553
302 Ga0501082_0033793 3300060353 Bacteria 4411
303 Ga0501082_0270405 3300060353 Bacteria 1479
304 Ga0530510_0006841 3300061734 Bacteria 7946
305 Ga0530510_0564361 3300061734 Bacteria 865
306 Ga0207703_11056803
307 Ga0065707_10162379
308 Ga0070683_100493191
309 Ga0070683_102196376
310 Ga0068869_100056926
311 Ga0068869_100276672
312 Ga0070680_100092103
313 Ga0070680_100241198
314 Ga0070680_100998048
315 Ga0070689_100785080
316 Ga0070691_10140607
317 Ga0070687_100154852
318 Ga0070687_100367793
319 Ga0070692_10014602
320 Ga0070692_10924360
321 Ga0070669_100257013
322 Ga0070675_100228825
323 Ga0070675_100497803
324 Ga0070674_100039601
325 Ga0070674_100725333
326 Ga0070673_101161174
327 Ga0070673_101813616
328 Ga0070688_100116955
329 Ga0070714_100110391
330 Ga0070701_11162168
331 Ga0070711_100670539
332 Ga0070711_100757371
333 Ga0070705_101176292
334 Ga0070700_100005092
335 Ga0070694_100122660
336 Ga0070681_10352923
337 Ga0070681_10683108
338 Ga0070685_10105651
339 Ga0070698_100225792
340 Ga0070699_102106257
341 Ga0070679_101450026
342 Ga0070684_100030581
343 Ga0070697_101502724
344 Ga0070672_100178685
345 Ga0070672_101389594
346 Ga0070672_101521149
347 Ga0070686_100052785
348 Ga0070686_100908109
349 Ga0070695_100066442
350 Ga0070696_100076007
351 Ga0070696_100080212
352 Ga0070696_100285843
353 Ga0070696_100550728
354 Ga0070696_101480073
355 Ga0070696_101774667
356 Ga0070693_100097442
357 Ga0070693_100746017
358 Ga0070704_100087303
359 Ga0070704_101481711
360 Ga0068855_101090984
361 Ga0068856_100190567
362 Ga0068856_100854683
363 Ga0070702_100347272
364 Ga0068859_100533454
365 Ga0068864_100017560
366 Ga0068861_100012149
367 Ga0068863_102272517
368 Ga0068858_100009976
369 Ga0068858_100861500
370 Ga0068858_102127325
371 Ga0068860_100956551
372 Ga0068860_101711437
373 Ga0068860_102456641
374 Ga0068862_100121086
375 Ga0068862_100320550
376 Ga0068862_100410418
377 Ga0068862_101936726
378 Ga0081538_10157173
379 Ga0070715_10046596
380 Ga0068871_100004681
381 Ga0068871_101720002
382 Ga0075428_100275227
383 Ga0075428_101076081
384 Ga0075430_100064337
385 Ga0075431_100009421
386 Ga0075431_100344002
387 Ga0075431_100489203
388 Ga0075433_10007931
389 Ga0075433_10182247
390 Ga0075434_100000004
391 Ga0075434_100002226
392 Ga0075429_101573823
393 Ga0068865_101144826
394 Ga0068865_101177190
395 Ga0075436_100180779
396 Ga0075436_101234243
397 Ga0097620_100533479
398 Ga0075435_100000806
399 Ga0075435_100024375
400 Ga0075435_101592069
401 Ga0099794_10107965
402 Ga0099795_10160140
403 Ga0111539_10067651
404 Ga0111539_10199812
405 Ga0111539_10226564
406 Ga0111539_10319958
407 Ga0111539_10504671
408 Ga0111539_10983687
409 Ga0114129_10405421
410 Ga0105243_10005293
411 Ga0105243_11889601
412 Ga0105242_10188167
413 Ga0105248_11149455
414 Ga0105249_10005738
415 Ga0157378_13315698
416 Ga0157372_10226192
417 Ga0157380_10019432
418 Ga0157380_11446018
419 Ga0157377_10459035
420 Ga0157379_11304972
421 Ga0157376_10306561
422 Ga0207642_10086513
423 Ga0207688_10051243
424 Ga0207680_10521979
425 Ga0207685_10086148
426 Ga0207643_10140579
427 Ga0207707_10472944
428 Ga0207660_10083733
429 Ga0207660_10324654
430 Ga0207660_10429432
431 Ga0207662_10179912
432 Ga0207662_10247320
433 Ga0207662_10645252
434 Ga0207652_11321321
435 Ga0207650_10722777
436 Ga0207659_10028933
437 Ga0207687_10191710
438 Ga0207664_10410498
439 Ga0207706_10487028
440 Ga0207670_10582557
441 Ga0207704_10003767
442 Ga0207704_10213370
443 Ga0207691_10104311
444 Ga0207691_10692310
445 Ga0207711_11125575
446 Ga0207689_10033284
447 Ga0207689_10325754
448 Ga0207661_10022463
449 Ga0207667_10907079
450 Ga0207712_10003362
451 Ga0207668_10020270
452 Ga0207703_10021862
453 Ga0207703_10406568
454 Ga0207708_10003562
455 Ga0207702_10253420
456 Ga0207702_11153391
457 Ga0207648_10000792
458 Ga0207676_10250130
459 Ga0207675_100011216
460 Ga0209981_1013558
461 Ga0209974_10115843
462 Ga0207428_10030468
463 Ga0207428_10054369
464 Ga0268265_10002153
465 Ga0268265_10300839
466 Ga0268264_11109136
467 Ga0307408_100735391
468 Ga0307405_10786924
469 Ga0307407_10642152
470 Ga0307416_100185225
471 Ga0307416_100272466
472 Ga0307416_100376934
473 Ga0307416_101613078
474 Ga0307416_102324214
475 Ga0307411_10078780
476 Ga0307411_10504978
477 Ga0373934_0087970
478 Ga0373923_0102767
479 Ga0373923_0195290
480 Ga0373955_0367219
481 Ga0373961_0012796
482 Ga0373924_0270624
483 Ga0373931_0011345
484 Ga0373931_0199823
485 Ga0373931_0216653
486 Ga0373931_0481257
487 Ga0373935_0002419
488 Ga0373927_0245702
489 Ga0373933_0504539
490 Ga0373947_0279777
491 Ga0373937_0132579
492 Ga0373937_0263864
493 Ga0373937_1228684
494 Ga0373925_0032804
495 Ga0242420_078737
496 Ga0439439_0177075
497 Ga0439441_008709
498 Ga0439441_137926
499 Ga0439443_003575
500 Ga0450888_028358
501 Ga0450902_067944
502 Ga0439458_0206601
503 Ga0439435_0006034
504 Ga0439444_0005615
505 Ga0439460_0000698
506 Ga0450918_105624
507 Ga0450893_0062331
508 Ga0466964_0016152
509 Ga0451576_0873030
510 Ga0466967_0026733
511 Ga0495652_0117714
512 Ga0495598_0209814
513 Ga0495621_0135357
514 Ga0495621_0221294
515 Ga0495635_0509348
516 Ga0495657_0458481
517 Ga0495623_0170478
518 Ga0495669_0413245
519 Ga0495675_0154329
520 Ga0501292_011316
521 Ga0501292_098764
522 Ga0501298_063699
523 Ga0501031_0504291
524 Ga0501032_0834388
525 Ga0501033_0304975
526 Ga0501036_0216232
527 Ga0501038_0131892
528 Ga0501038_1363394
529 Ga0501039_0018478
530 Ga0501039_0569682
531 Ga0501039_1404077
532 Ga0501040_0008397
533 Ga0501040_0052963
534 Ga0501040_0058788
535 Ga0501040_0147937
536 Ga0501040_0418689
537 Ga0501040_0452706
538 Ga0501040_0903675
539 Ga0501041_0006388
540 Ga0501041_0016271
541 Ga0501041_0055946
542 Ga0501041_0775430
543 Ga0501042_0048238
544 Ga0501042_0230496
545 Ga0501042_0863888
546 Ga0501046_0050181
547 Ga0501048_0018109
548 Ga0501048_0485027
549 Ga0501048_0652243
550 Ga0501048_1085501
551 Ga0501068_0176624
552 Ga0501068_0592586
553 Ga0501068_0608816
554 Ga0501068_0638952
555 Ga0501069_0640007
556 Ga0501071_0001985
557 Ga0501072_0001942
558 Ga0501072_0003633
559 Ga0501073_0077616
560 Ga0501073_0848633
561 Ga0501074_0421862
562 Ga0501074_0457106
563 Ga0501075_0010210
564 Ga0501075_0155727
565 Ga0501075_0732083
566 Ga0501076_0000390
567 Ga0501076_0080849
568 Ga0501076_0549757
569 Ga0501077_0026854
570 Ga0501077_0460602
571 Ga0501079_0000671
572 Ga0501079_0045389
573 Ga0501080_0001393
574 Ga0501080_0047890
575 Ga0501080_0211128
576 Ga0501080_1171901
577 Ga0501081_0003605
578 Ga0501081_0039970
579 Ga0501081_0279879
580 Ga0501081_0629338
581 Ga0501283_055143
582 Ga0501045_0006961
583 Ga0501045_0142675
584 nmdc:mga09592_453214_c1
585 nmdc:mga0qj67_24839_c1
586 nmdc:mga0qj67_2695_c1
587 nmdc:mga0qj67_425549_c1
588 nmdc:mga0qj67_884168_c1
589 nmdc:mga06r32_458482_c1
590 nmdc:mga06r32_48672_c1
591 nmdc:mga08y16_19320_c1
592 nmdc:mga08y16_651186_c1
593 nmdc:mga08y16_90843_c1
594 nmdc:mga0n895_14255_c1
595 nmdc:mga0n895_68049_c1
596 nmdc:mga0rr50_12859_c1
597 nmdc:mga08x19_7175_c1
598 nmdc:mga08x19_9954_c1
599 nmdc:mga0a205_30309_c1
600 nmdc:mga0a205_839954_c1
601 Ga0501084_0051017
602 Ga0501084_0281692
603 Ga0501084_0397429
604 Ga0501084_0505432
605 Ga0501084_1445292
606 Ga0501084_1555284
607 Ga0501082_0033793
608 Ga0501082_0270405
609 Ga0530510_0006841
610 Ga0530510_0564361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

111

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9748 1 124
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.961 1 124
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9597 1 124
5xu7-assembly1.cif.gz_A crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9575 1 124
5xuh-assembly1.cif.gz_B crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9564 1 124
ID Description Score Start End Superfamily
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9701 1 124 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9564 1 124 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9551 1 124 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9407 1 124 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9264 1 126 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A6F8VE28-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9907 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A3S0K3Y0-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9907 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7Y4ZYK8-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9886 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A809RK48-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9863 1 126 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-B6BUJ1-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9855 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map