F396885

General Info

Members Datasets Scaffolds Average Seq Length
303 208 294 553

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10025504|Ga0070681_100255044
Length 601
Sequence MSDGAPGSPPAAGRAAPRIAGAARLLRDFAPRLHRFRPRLLDDLAGYDGHRFAADLGAGLTVGIVALPLAMAFAIASGVKPEQGIFTAIIAGFLISLLGGSSVQIGGPAGAFIVIVYGIVQRYGVANLLIATVLAGVLLLALGWLKLGALVRYIPVSIVIGFTNGIAVLIAVSQVKDLLGLRIDKVPADFFAQAHAIATHLGSINLAALALGLACFAGLLFWARLAAFPAHSLHPDLPWHHRAVLAIPHGRRFVRVATRIPGPIVALVTLSLIATWLKLPVETIGTRFGGIPRALPAFVWPAFDWETVQLLFVPTVTIAMLGAVESLLCARVADGMASQRRHDPNQELMAQGVANIVAPFFGGIPATGTIARTVTNLRAGATSPVAGIVHALTLLAIVLVAAPLAVHVPLAVLAGVLLFVAWNMGEWEAFARMSAFSVEQRVKLFSTFLLTVLVDLTVAMEVGLAAACLVFVYRMSTLFRVEADPERPPTAPGVVAYRLYGALFFAATAKLEAVADALPPGTTTLVLDMRQLVSIDASGLDALENLHLALERAHVRLVLVGLNEQPLEAVRKWGLDAMLGAENVFADRDSAFAALAGSRAQ

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221656 Pelomonas sp. Root405 Isolate Unclassified
8 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
9 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
142 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
143 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
144 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
145 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.14
Nodule 0
Rhizoplane 3.3
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000772 3300002705 Bacteria 16645
2 JGI25156J39149_1001157 3300002705 Bacteria 11808
3 JGI25157J39369_1000095 3300002741 Bacteria 74770
4 JGI25153J46596_10002983 3300003215 Bacteria 9573
5 rootH1_10012249 3300003316 Bacteria 2313
6 rootH2_10042226 3300003320 Bacteria 3108
7 rootL2_10028489 3300003322 Bacteria 3163
8 JGI26128J50194_1000269 3300003347 Bacteria 2598
9 Ga0055540_1003166 3300003792 Bacteria 8122
10 Ga0055531_10000317 3300003794 Bacteria 47389
11 Ga0055531_10000689 3300003794 Bacteria 28730
12 Ga0065707_10085323 3300005295 Bacteria 6245
13 Ga0070658_10114379 3300005327 Bacteria 2237
14 Ga0070676_10053941 3300005328 Bacteria 2369
15 Ga0070670_100010647 3300005331 Bacteria 7857
16 Ga0070670_100018231 3300005331 Bacteria 6023
17 Ga0070670_100049189 3300005331 Bacteria 3625
18 Ga0070677_10005676 3300005333 Bacteria 4122
19 Ga0070660_100060521 3300005339 Bacteria 2939
20 Ga0070661_100011920 3300005344 Bacteria 6071
21 Ga0070669_100036240 3300005353 Bacteria 3574
22 Ga0070675_100024595 3300005354 Bacteria 4822
23 Ga0070675_100097613 3300005354 Bacteria 2470
24 Ga0070671_100038907 3300005355 Bacteria 3947
25 Ga0070674_100015515 3300005356 Bacteria 4756
26 Ga0070673_100002488 3300005364 Bacteria 11245
27 Ga0070673_100123037 3300005364 Bacteria 2167
28 Ga0070659_100001144 3300005366 Bacteria 19362
29 Ga0070667_100092376 3300005367 Bacteria 2604
30 Ga0070700_100077012 3300005441 Bacteria 2144
31 Ga0070708_100029828 3300005445 Bacteria 4708
32 Ga0070663_100010855 3300005455 Bacteria 5691
33 Ga0070678_100007079 3300005456 Bacteria 6631
34 Ga0070678_100048187 3300005456 Bacteria 3067
35 Ga0070662_100009364 3300005457 Bacteria 6403
36 Ga0070662_100022654 3300005457 Bacteria 4302
37 Ga0070662_100034822 3300005457 Bacteria 3553
38 Ga0070681_10025504 3300005458 Bacteria 5946
39 Ga0068867_100000173 3300005459 Bacteria 42222
40 Ga0068867_100000215 3300005459 Bacteria 38520
41 Ga0068867_100003075 3300005459 Bacteria 11756
42 Ga0068867_100015395 3300005459 Bacteria 5423
43 Ga0068867_100050769 3300005459 Bacteria 3058
44 Ga0070672_100036676 3300005543 Bacteria 3736
45 Ga0070672_100037799 3300005543 Bacteria 3684
46 Ga0068855_100039716 3300005563 Bacteria 5586
47 Ga0068855_100089253 3300005563 Bacteria 3559
48 Ga0070664_100035443 3300005564 Bacteria 4189
49 Ga0070664_100037163 3300005564 Bacteria 4092
50 Ga0068857_100000469 3300005577 Bacteria 28770
51 Ga0068854_100066942 3300005578 Bacteria 2615
52 Ga0068856_100001938 3300005614 Bacteria 21587
53 Ga0068852_100085711 3300005616 Bacteria 2806
54 Ga0068852_100109174 3300005616 Bacteria 2512
55 Ga0068864_100180326 3300005618 Bacteria 1930
56 Ga0068861_100001372 3300005719 Bacteria 15283
57 Ga0068858_100005381 3300005842 Bacteria 12548
58 Ga0068858_100010293 3300005842 Bacteria 8867
59 Ga0068860_100001625 3300005843 Bacteria 24111
60 Ga0068862_100079078 3300005844 Bacteria 2850
61 Ga0068862_100081186 3300005844 Bacteria 2812
62 Ga0075365_10006008 3300006038 Bacteria 6629
63 Ga0075365_10013130 3300006038 Bacteria 4940
64 Ga0075363_100013438 3300006048 Bacteria 3969
65 Ga0075362_10003562 3300006177 Bacteria 5467
66 Ga0075362_10005956 3300006177 Bacteria 4506
67 Ga0075367_10028188 3300006178 Bacteria 3201
68 Ga0075369_10001253 3300006186 Bacteria 8632
69 Ga0075366_10001289 3300006195 Bacteria 12493
70 Ga0075366_10001659 3300006195 Bacteria 11175
71 Ga0075366_10002337 3300006195 Bacteria 9703
72 Ga0075366_10009622 3300006195 Bacteria 5402
73 Ga0075366_10016279 3300006195 Bacteria 4272
74 Ga0075366_10019939 3300006195 Bacteria 3886
75 Ga0075366_10051298 3300006195 Bacteria 2451
76 Ga0075370_10000149 3300006353 Bacteria 23819
77 Ga0075370_10004405 3300006353 Bacteria 6835
78 Ga0075370_10014437 3300006353 Bacteria 4214
79 Ga0075429_100000370 3300006880 Bacteria 33134
80 Ga0075436_100022508 3300006914 Bacteria 4328
81 Ga0105240_10002442 3300009093 Bacteria 29876
82 Ga0105240_10016534 3300009093 Bacteria 9986
83 Ga0114129_10033373 3300009147 Bacteria 7274
84 Ga0105243_10004078 3300009148 Bacteria 11636
85 Ga0105243_10016078 3300009148 Bacteria 5661
86 Ga0105243_10051644 3300009148 Bacteria 3252
87 Ga0105242_10008320 3300009176 Bacteria 7971
88 Ga0105248_10002855 3300009177 Bacteria 19175
89 Ga0105237_10001836 3300009545 Bacteria 27312
90 Ga0105237_10011185 3300009545 Bacteria 9510
91 Ga0105238_10040770 3300009551 Bacteria 4704
92 Ga0105238_10101988 3300009551 Bacteria 2852
93 Ga0105239_10001156 3300010375 Bacteria 36262
94 Ga0105239_10111921 3300010375 Bacteria 3027
95 Ga0105246_10056645 3300011119 Bacteria 2710
96 Ga0157369_10043816 3300013105 Bacteria 4875
97 Ga0157378_10006233 3300013297 Bacteria 10444
98 Ga0163162_10000655 3300013306 Bacteria 32037
99 Ga0163162_10013510 3300013306 Bacteria 7972
100 Ga0163162_10203866 3300013306 Bacteria 2107
101 Ga0157375_10014204 3300013308 Bacteria 7098
102 Ga0157380_10021378 3300014326 Bacteria 4853
103 Ga0157377_10000039 3300014745 Bacteria 112711
104 Ga0157379_10030241 3300014968 Bacteria 4819
105 Ga0157379_10041630 3300014968 Bacteria 4101
106 Ga0163161_10085969 3300017792 Bacteria 2321
107 Ga0213872_10000012 3300021361 Bacteria 191291
108 Ga0213872_10000396 3300021361 Bacteria 36208
109 Ga0209258_100664 3300025242 Bacteria 24590
110 Ga0209646_1000124 3300025246 Bacteria 138207
111 Ga0209026_1000085 3300025250 Bacteria 185778
112 Ga0209677_101683 3300025253 Bacteria 9240
113 Ga0209759_1000068 3300025256 Bacteria 183479
114 Ga0209673_1016568 3300025273 Bacteria 2749
115 Ga0209758_1000096 3300025297 Bacteria 231496
116 Ga0209050_1001442 3300025298 Bacteria 25546
117 Ga0209050_1007741 3300025298 Bacteria 5928
118 Ga0209051_1000623 3300025303 Bacteria 40736
119 Ga0209051_1001697 3300025303 Bacteria 17666
120 Ga0209051_1017618 3300025303 Bacteria 3187
121 Ga0209257_1000021 3300025304 Bacteria 771986
122 Ga0209257_1000096 3300025304 Bacteria 259390
123 Ga0209257_1019201 3300025304 Bacteria 2586
124 Ga0207697_10022202 3300025315 Bacteria 2600
125 Ga0207682_10001087 3300025893 Bacteria 12557
126 Ga0207682_10010792 3300025893 Bacteria 3578
127 Ga0207695_10036340 3300025913 Bacteria 5327
128 Ga0207671_10005755 3300025914 Bacteria 11293
129 Ga0207671_10030403 3300025914 Bacteria 4028
130 Ga0207657_10069730 3300025919 Bacteria 2982
131 Ga0207681_10031269 3300025923 Bacteria 3476
132 Ga0207681_10048946 3300025923 Bacteria 2855
133 Ga0207650_10000607 3300025925 Bacteria 28697
134 Ga0207650_10016290 3300025925 Bacteria 5193
135 Ga0207659_10001209 3300025926 Bacteria 15421
136 Ga0207644_10014040 3300025931 Bacteria 5354
137 Ga0207644_10092359 3300025931 Bacteria 2258
138 Ga0207690_10003338 3300025932 Bacteria 9596
139 Ga0207706_10112439 3300025933 Bacteria 2396
140 Ga0207686_10002776 3300025934 Bacteria 9485
141 Ga0207709_10002451 3300025935 Bacteria 11650
142 Ga0207669_10004742 3300025937 Bacteria 6021
143 Ga0207704_10021744 3300025938 Bacteria 3423
144 Ga0207691_10001758 3300025940 Bacteria 21323
145 Ga0207691_10116412 3300025940 Bacteria 2372
146 Ga0207711_10011504 3300025941 Bacteria 7355
147 Ga0207689_10017421 3300025942 Bacteria 6078
148 Ga0207679_10003068 3300025945 Bacteria 10343
149 Ga0207667_10024645 3300025949 Bacteria 6601
150 Ga0207651_10001705 3300025960 Bacteria 10141
151 Ga0207640_10061804 3300025981 Bacteria 2482
152 Ga0207640_10081093 3300025981 Bacteria 2217
153 Ga0207658_10007759 3300025986 Bacteria 7314
154 Ga0207658_10133591 3300025986 Bacteria 1997
155 Ga0207703_10007009 3300026035 Bacteria 8968
156 Ga0207703_10008991 3300026035 Bacteria 7867
157 Ga0207678_10012730 3300026067 Bacteria 7387
158 Ga0207678_10066725 3300026067 Bacteria 3089
159 Ga0207702_10000235 3300026078 Bacteria 64091
160 Ga0207702_10098998 3300026078 Bacteria 2570
161 Ga0207641_10111619 3300026088 Bacteria 2425
162 Ga0207641_10114024 3300026088 Bacteria 2401
163 Ga0207648_10000579 3300026089 Bacteria 41056
164 Ga0207648_10002224 3300026089 Bacteria 21032
165 Ga0207648_10008629 3300026089 Bacteria 9849
166 Ga0207648_10031445 3300026089 Bacteria 4693
167 Ga0207676_10113119 3300026095 Bacteria 2275
168 Ga0207674_10005437 3300026116 Bacteria 15126
169 Ga0207674_10137315 3300026116 Bacteria 2406
170 Ga0207675_100001767 3300026118 Bacteria 21608
171 Ga0207675_100129660 3300026118 Bacteria 2391
172 Ga0207683_10010683 3300026121 Bacteria 7826
173 Ga0207683_10014082 3300026121 Bacteria 6815
174 Ga0207683_10054358 3300026121 Bacteria 3512
175 Ga0207683_10115581 3300026121 Bacteria 2405
176 Ga0209968_1000782 3300027526 Bacteria 4903
177 Ga0209966_1000001 3300027695 Bacteria 139125
178 Ga0268266_10153766 3300028379 Bacteria 2076
179 Ga0268264_10006569 3300028381 Bacteria 9790
180 Ga0307515_10000030 3300028794 Bacteria 364482
181 Ga0307515_10047036 3300028794 Bacteria 6575
182 Ga0307511_10000248 3300030521 Bacteria 55337
183 Ga0265331_10010604 3300031250 Bacteria 5088
184 Ga0307513_10022546 3300031456 Bacteria 7395
185 Ga0307408_100058905 3300031548 Bacteria 2794
186 Ga0265314_10001279 3300031711 Bacteria 28615
187 Ga0307516_10000678 3300031730 Bacteria 46164
188 Ga0307516_10018878 3300031730 Bacteria 7157
189 Ga0307516_10034293 3300031730 Bacteria 5102
190 Ga0307516_10056116 3300031730 Bacteria 3842
191 Ga0307516_10142130 3300031730 Bacteria 2168
192 Ga0307416_100098537 3300032002 Bacteria 2536
193 Ga0373925_0013001 3300037068 Bacteria 6027
194 Ga0395899_0000723 3300037312 Bacteria 33030
195 Ga0395899_0002930 3300037312 Bacteria 13693
196 Ga0395898_0003443 3300037466 Bacteria 17693
197 Ga0395905_0000043 3300037471 Bacteria 247469
198 Ga0395905_0004910 3300037471 Bacteria 13772
199 Ga0395905_0005270 3300037471 Bacteria 13222
200 Ga0395905_0025821 3300037471 Bacteria 5537
201 Ga0395905_0044726 3300037471 Bacteria 4154
202 Ga0395901_0001967 3300038443 Bacteria 21139
203 Ga0395901_0023478 3300038443 Bacteria 6323
204 Ga0395901_0066417 3300038443 Bacteria 3757
205 Ga0436365_1305172 3300039437 Bacteria 4855
206 Ga0436361_0231720 3300039447 Bacteria 61956
207 Ga0436361_0351372 3300039447 Bacteria 183069
208 Ga0436361_0406743 3300039447 Bacteria 1948
209 Ga0436361_0908337 3300039447 Bacteria 39649
210 Ga0451795_0115068 3300041456 Bacteria 2876
211 Ga0450888_000023 3300042126 Bacteria 10988
212 Ga0450890_001554 3300042127 Bacteria 3296
213 Ga0450891_000928 3300042129 Bacteria 3056
214 Ga0450918_000669 3300042531 Bacteria 7305
215 Ga0450893_0002199 3300042532 Bacteria 3036
216 Ga0451577_0082841 3300042876 Bacteria 2861
217 Ga0466969_0000017 3300044656 Bacteria 103792
218 Ga0466969_0008460 3300044656 Bacteria 5459
219 Ga0466969_0023951 3300044656 Bacteria 3142
220 Ga0466969_0045789 3300044656 Bacteria 2170
221 Ga0466972_0000037 3300044658 Bacteria 137184
222 Ga0466972_0005453 3300044658 Bacteria 6375
223 Ga0466965_0012886 3300044683 Bacteria 3937
224 Ga0466966_0005449 3300044684 Bacteria 8368
225 Ga0466966_0017527 3300044684 Bacteria 4731
226 Ga0466966_0028971 3300044684 Bacteria 3604
227 Ga0466961_0018498 3300044693 Bacteria 4482
228 Ga0466964_0003346 3300044706 Bacteria 5842
229 Ga0466964_0009412 3300044706 Bacteria 3678
230 Ga0453684_0052822 3300044712 Bacteria 5310
231 Ga0466971_0010738 3300044719 Bacteria 4006
232 Ga0466957_0098238 3300044842 Bacteria 1842
233 Ga0466959_0000287 3300045049 Bacteria 30550
234 Ga0451576_0081171 3300045051 Bacteria 3373
235 Ga0451576_0116344 3300045051 Bacteria 2784
236 Ga0451576_0145579 3300045051 Bacteria 2470
237 Ga0466967_0005385 3300045976 Bacteria 8858
238 Ga0495590_0008551 3300046457 Bacteria 3907
239 Ga0495638_0048013 3300046460 Bacteria 2674
240 Ga0495650_0001967 3300046471 Bacteria 18141
241 Ga0495632_0009191 3300046519 Bacteria 5974
242 Ga0495597_0018294 3300046542 Bacteria 3289
243 Ga0495625_0026151 3300046660 Bacteria 4413
244 Ga0495687_002581 3300047443 Bacteria 14284
245 Ga0495687_004808 3300047443 Bacteria 8900
246 Ga0496102_0011887 3300048905 Bacteria 7516
247 Ga0496105_0101235 3300048908 Bacteria 2379
248 Ga0496107_0109818 3300048910 Bacteria 2026
249 Ga0496108_0065396 3300048911 Bacteria 3065
250 Ga0496109_0051665 3300048912 Bacteria 3744
251 Ga0496110_0056554 3300048913 Bacteria 3452
252 Ga0496111_0009448 3300048914 Bacteria 6510
253 Ga0496112_0090915 3300048915 Bacteria 3021
254 Ga0496113_0048044 3300048916 Bacteria 3174
255 Ga0501031_0014091 3300049568 Bacteria 5202
256 Ga0501034_0031433 3300049571 Bacteria 5391
257 Ga0501034_0136873 3300049571 Bacteria 2430
258 Ga0501043_0000009 3300049579 Bacteria 214823
259 Ga0501046_0000022 3300049580 Bacteria 215451
260 Ga0501047_0000021 3300049581 Bacteria 254841
261 Ga0501048_0001661 3300049582 Bacteria 16948
262 Ga0501222_000510 3300049662 Bacteria 5776
263 Ga0501221_001061 3300049704 Bacteria 4521
264 Ga0501225_0014194 3300049705 Bacteria 2226
265 Ga0501045_0009763 3300049824 Bacteria 6711
266 nmdc:mga03683_2112_c1 3300050489 Bacteria 6116
267 nmdc:mga00v17_11265_c1 3300050491 Bacteria 4913
268 nmdc:mga0yw44_55744_c1 3300050492 Bacteria 2406
269 nmdc:mga0k408_10394_c1 3300050493 Bacteria 5034
270 nmdc:mga0k408_19608_c1 3300050493 Bacteria 3782
271 nmdc:mga0k408_5664_c1 3300050493 Bacteria 6639
272 nmdc:mga06z11_23057_c1 3300050494 Bacteria 2918
273 nmdc:mga07m45_11143_c1 3300050496 Bacteria 4717
274 nmdc:mga07m45_13822_c1 3300050496 Bacteria 4289
275 nmdc:mga07m45_1712_c1 3300050496 Bacteria 10106
276 nmdc:mga07m45_9028_c1 3300050496 Bacteria 5150
277 nmdc:mga05p37_91905_c1 3300050507 Bacteria 3739
278 nmdc:mga09592_1991_c1 3300050508 Bacteria 16488
279 nmdc:mga0n895_113719_c1 3300050512 Bacteria 2724
280 nmdc:mga0sz30_14572_c1 3300050516 Bacteria 3097
281 Ga0500583_0002675 3300053092 Bacteria 5421
282 Ga0500651_0002096 3300053093 Bacteria 10370
283 Ga0500562_004096 3300053108 Bacteria 3674
284 Ga0500593_000715 3300053117 Bacteria 12608
285 Ga0500628_003232 3300053129 Bacteria 2682
286 Ga0500642_0019678 3300053130 Bacteria 2638
287 Ga0500652_002227 3300053131 Bacteria 5829
288 Ga0500655_002128 3300053133 Bacteria 3666
289 Ga0500658_0005470 3300053134 Bacteria 4725
290 Ga0500604_0010157 3300053151 Bacteria 2515
291 Ga0500616_0036986 3300053153 Bacteria 2645
292 Ga0500619_000479 3300053154 Bacteria 6999
293 Ga0500622_0000262 3300053156 Bacteria 53796
294 Ga0466962_0005485 3300061719 Bacteria 6097

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0101235 Ga0496105_0101235_16_1392 401
2 3300006914 Ga0075436_100022508 Ga0075436_1000225084 469
3 3300048910 Ga0496107_0109818 Ga0496107_0109818_35_1723 469
4 3300048911 Ga0496108_0065396 Ga0496108_0065396_492_2180 469
5 3300048912 Ga0496109_0051665 Ga0496109_0051665_1686_3374 469
6 3300048913 Ga0496110_0056554 Ga0496110_0056554_776_2464 469
7 3300048914 Ga0496111_0009448 Ga0496111_0009448_620_2308 469
8 3300031456 Ga0307513_10022546 Ga0307513_100225463 471
9 3300006038 Ga0075365_10006008 Ga0075365_100060084 490
10 3300050492 nmdc:mga0yw44_55744_c1 nmdc:mga0yw44_55744_c1_236_1894 490
11 3300025986 Ga0207658_10007759 Ga0207658_100077592 499
12 3300005456 Ga0070678_100048187 Ga0070678_1000481873 500
13 3300005543 Ga0070672_100036676 Ga0070672_1000366764 500
14 3300025981 Ga0207640_10081093 Ga0207640_100810932 500
15 3300026067 Ga0207678_10066725 Ga0207678_100667252 500
16 3300026121 Ga0207683_10054358 Ga0207683_100543582 500
17 3300028379 Ga0268266_10153766 Ga0268266_101537661 500
18 3300006195 Ga0075366_10009622 Ga0075366_100096224 501
19 3300039447 Ga0436361_0406743 Ga0436361_0406743_339_1925 501
20 3300049704 Ga0501221_001061 Ga0501221_001061_2813_4486 501
21 3300037471 Ga0395905_0004910 Ga0395905_0004910_1835_3388 502
22 3300049571 Ga0501034_0031433 Ga0501034_0031433_1373_3082 502
23 3300026088 Ga0207641_10111619 Ga0207641_101116192 503
24 3300017792 Ga0163161_10085969 Ga0163161_100859692 504
25 3300005331 Ga0070670_100018231 Ga0070670_1000182313 509
26 3300005364 Ga0070673_100123037 Ga0070673_1001230372 509
27 3300005618 Ga0068864_100180326 Ga0068864_1001803261 509
28 3300025925 Ga0207650_10016290 Ga0207650_100162903 509
29 3300042126 Ga0450888_000023 Ga0450888_000023_770_2377 509
30 3300042127 Ga0450890_001554 Ga0450890_001554_703_2310 509
31 3300042129 Ga0450891_000928 Ga0450891_000928_1131_2738 509
32 3300042532 Ga0450893_0002199 Ga0450893_0002199_1228_2835 509
33 3300049571 Ga0501034_0136873 Ga0501034_0136873_319_1977 509
34 3300025304 Ga0209257_1019201 Ga0209257_10192012 510
35 3300003792 Ga0055540_1003166 Ga0055540_10031667 511
36 3300003794 Ga0055531_10000689 Ga0055531_1000068917 511
37 3300025273 Ga0209673_1016568 Ga0209673_10165682 511
38 3300025303 Ga0209051_1000623 Ga0209051_100062317 511
39 3300025304 Ga0209257_1000096 Ga0209257_1000096194 511
40 3300037312 Ga0395899_0002930 Ga0395899_0002930_845_2431 512
41 3300037466 Ga0395898_0003443 Ga0395898_0003443_13488_15074 512
42 3300037471 Ga0395905_0025821 Ga0395905_0025821_2095_3681 512
43 3300038443 Ga0395901_0023478 Ga0395901_0023478_4562_6148 512
44 3300044656 Ga0466969_0023951 Ga0466969_0023951_1079_2665 512
45 3300044842 Ga0466957_0098238 Ga0466957_0098238_139_1725 512
46 3300013306 Ga0163162_10203866 Ga0163162_102038662 513
47 3300049568 Ga0501031_0014091 Ga0501031_0014091_2568_4238 513
48 3300031548 Ga0307408_100058905 Ga0307408_1000589051 514
49 3300047443 Ga0495687_004808 Ga0495687_004808_1883_3577 514
50 3300053134 Ga0500658_0005470 Ga0500658_0005470_994_2688 514
51 3300005457 Ga0070662_100022654 Ga0070662_1000226544 515
52 iso_pu_bacteria 2585428057 2587729952 515
53 iso_pu_bacteria 2585428058 2587734337 515
54 3300003316 rootH1_10012249 rootH1_100122491 516
55 3300003322 rootL2_10028489 rootL2_100284893 516
56 3300032002 Ga0307416_100098537 Ga0307416_1000985372 516
57 3300045051 Ga0451576_0081171 Ga0451576_0081171_1287_2966 516
58 3300050512 nmdc:mga0n895_113719_c1 nmdc:mga0n895_113719_c1_817_2496 516
59 3300005327 Ga0070658_10114379 Ga0070658_101143792 517
60 3300003347 JGI26128J50194_1000269 JGI26128J50194_10002692 519
61 3300005459 Ga0068867_100000173 Ga0068867_10000017335 519
62 3300006195 Ga0075366_10019939 Ga0075366_100199393 519
63 3300009148 Ga0105243_10004078 Ga0105243_100040786 519
64 3300009177 Ga0105248_10002855 Ga0105248_1000285514 519
65 3300014745 Ga0157377_10000039 Ga0157377_1000003972 519
66 3300025935 Ga0207709_10002451 Ga0207709_100024516 519
67 3300025938 Ga0207704_10021744 Ga0207704_100217443 519
68 3300026095 Ga0207676_10113119 Ga0207676_101131192 519
69 3300038443 Ga0395901_0066417 Ga0395901_0066417_629_2251 519
70 3300041456 Ga0451795_0115068 Ga0451795_0115068_461_2083 519
71 3300046460 Ga0495638_0048013 Ga0495638_0048013_185_1807 519
72 3300046519 Ga0495632_0009191 Ga0495632_0009191_182_1804 519
73 3300048915 Ga0496112_0090915 Ga0496112_0090915_36_1652 519
74 3300048916 Ga0496113_0048044 Ga0496113_0048044_1399_3015 519
75 3300053093 Ga0500651_0002096 Ga0500651_0002096_8510_10132 519
76 3300053129 Ga0500628_003232 Ga0500628_003232_458_2080 519
77 3300053130 Ga0500642_0019678 Ga0500642_0019678_356_1978 519
78 3300053131 Ga0500652_002227 Ga0500652_002227_3596_5236 519
79 3300053133 Ga0500655_002128 Ga0500655_002128_1785_3407 519
80 3300053156 Ga0500622_0000262 Ga0500622_0000262_20408_22030 519
81 3300026078 Ga0207702_10098998 Ga0207702_100989982 520
82 3300028794 Ga0307515_10000030 Ga0307515_1000003062 520
83 3300031730 Ga0307516_10056116 Ga0307516_100561163 520
84 iso_pu_bacteria 2932422444 2932424828 520
85 3300025933 Ga0207706_10112439 Ga0207706_101124392 521
86 3300031730 Ga0307516_10034293 Ga0307516_100342934 521
87 iso_pu_bacteria 2919704043 2919704192 521
88 3300006048 Ga0075363_100013438 Ga0075363_1000134383 522
89 3300006177 Ga0075362_10005956 Ga0075362_100059562 522
90 3300006186 Ga0075369_10001253 Ga0075369_100012537 522
91 3300050489 nmdc:mga03683_2112_c1 nmdc:mga03683_2112_c1_795_2489 522
92 3300050493 nmdc:mga0k408_10394_c1 nmdc:mga0k408_10394_c1_1807_3501 522
93 3300050494 nmdc:mga06z11_23057_c1 nmdc:mga06z11_23057_c1_52_1746 522
94 3300050496 nmdc:mga07m45_13822_c1 nmdc:mga07m45_13822_c1_792_2486 522
95 3300050516 nmdc:mga0sz30_14572_c1 nmdc:mga0sz30_14572_c1_979_2673 522
96 3300025893 Ga0207682_10010792 Ga0207682_100107922 523
97 3300044684 Ga0466966_0017527 Ga0466966_0017527_657_2342 523
98 3300025981 Ga0207640_10061804 Ga0207640_100618043 524
99 3300026121 Ga0207683_10115581 Ga0207683_101155813 524
100 3300031250 Ga0265331_10010604 Ga0265331_100106043 524
101 3300003215 JGI25153J46596_10002983 JGI25153J46596_100029834 525
102 3300005564 Ga0070664_100037163 Ga0070664_1000371634 525
103 3300006195 Ga0075366_10002337 Ga0075366_100023373 525
104 3300006353 Ga0075370_10000149 Ga0075370_100001498 525
105 3300025297 Ga0209758_1000096 Ga0209758_100009629 525
106 3300046471 Ga0495650_0001967 Ga0495650_0001967_2266_3957 525
107 3300050493 nmdc:mga0k408_19608_c1 nmdc:mga0k408_19608_c1_1038_2759 525
108 3300050496 nmdc:mga07m45_1712_c1 nmdc:mga07m45_1712_c1_1728_3449 525
109 3300026118 Ga0207675_100129660 Ga0207675_1001296601 526
110 3300037471 Ga0395905_0044726 Ga0395905_0044726_2344_3987 526
111 3300039437 Ga0436365_1305172 Ga0436365_1305172_1823_3619 526
112 3300039447 Ga0436361_0231720 Ga0436361_0231720_17510_19165 526
113 iso_pu_bacteria 2643221639 2644217282 526
114 iso_pu_bacteria 2643221646 2644258947 526
115 iso_pu_bacteria 2643221585 2643933139 527
116 iso_pu_bacteria 2643221656 2644314388 527
117 3300028794 Ga0307515_10047036 Ga0307515_100470363 528
118 3300037471 Ga0395905_0005270 Ga0395905_0005270_5172_6818 528
119 3300044656 Ga0466969_0008460 Ga0466969_0008460_2763_4454 528
120 3300045051 Ga0451576_0145579 Ga0451576_0145579_340_2013 528
121 3300049662 Ga0501222_000510 Ga0501222_000510_489_2162 528
122 3300049705 Ga0501225_0014194 Ga0501225_0014194_17_1690 528
123 3300053108 Ga0500562_004096 Ga0500562_004096_975_2657 528
124 3300053153 Ga0500616_0036986 Ga0500616_0036986_80_1762 528
125 3300003794 Ga0055531_10000317 Ga0055531_1000031748 529
126 3300025298 Ga0209050_1007741 Ga0209050_10077414 529
127 3300025303 Ga0209051_1017618 Ga0209051_10176182 529
128 3300025304 Ga0209257_1000021 Ga0209257_1000021539 529
129 3300031711 Ga0265314_10001279 Ga0265314_1000127924 529
130 3300031730 Ga0307516_10142130 Ga0307516_101421302 529
131 3300037471 Ga0395905_0000043 Ga0395905_0000043_225771_227552 529
132 3300044656 Ga0466969_0045789 Ga0466969_0045789_447_2144 529
133 3300044693 Ga0466961_0018498 Ga0466961_0018498_609_2306 529
134 3300044719 Ga0466971_0010738 Ga0466971_0010738_179_1876 529
135 3300045049 Ga0466959_0000287 Ga0466959_0000287_582_2279 529
136 3300045051 Ga0451576_0116344 Ga0451576_0116344_855_2507 529
137 3300045976 Ga0466967_0005385 Ga0466967_0005385_469_2166 529
138 3300061719 Ga0466962_0005485 Ga0466962_0005485_2394_4091 529
139 3300005331 Ga0070670_100049189 Ga0070670_1000491892 530
140 3300005354 Ga0070675_100097613 Ga0070675_1000976132 530
141 3300006038 Ga0075365_10013130 Ga0075365_100131305 530
142 3300006195 Ga0075366_10001659 Ga0075366_100016592 530
143 3300006353 Ga0075370_10014437 Ga0075370_100144374 530
144 3300050496 nmdc:mga07m45_11143_c1 nmdc:mga07m45_11143_c1_2505_4193 530
145 3300005563 Ga0068855_100039716 Ga0068855_1000397163 531
146 3300025949 Ga0207667_10024645 Ga0207667_100246453 531
147 3300005842 Ga0068858_100005381 Ga0068858_1000053818 532
148 3300009176 Ga0105242_10008320 Ga0105242_100083207 532
149 3300009551 Ga0105238_10040770 Ga0105238_100407703 532
150 3300013306 Ga0163162_10013510 Ga0163162_100135105 532
151 3300025934 Ga0207686_10002776 Ga0207686_100027767 532
152 3300025941 Ga0207711_10011504 Ga0207711_100115043 532
153 3300026035 Ga0207703_10008991 Ga0207703_100089916 532
154 3300005445 Ga0070708_100029828 Ga0070708_1000298285 533
155 3300005616 Ga0068852_100085711 Ga0068852_1000857112 533
156 3300006195 Ga0075366_10016279 Ga0075366_100162792 533
157 3300006353 Ga0075370_10004405 Ga0075370_100044053 533
158 3300009147 Ga0114129_10033373 Ga0114129_100333733 533
159 3300014968 Ga0157379_10030241 Ga0157379_100302412 533
160 3300050507 nmdc:mga05p37_91905_c1 nmdc:mga05p37_91905_c1_1091_2746 533
161 3300005457 Ga0070662_100034822 Ga0070662_1000348223 534
162 3300006880 Ga0075429_100000370 Ga0075429_1000003709 534
163 3300044658 Ga0466972_0005453 Ga0466972_0005453_2910_4571 534
164 3300050508 nmdc:mga09592_1991_c1 nmdc:mga09592_1991_c1_2007_3737 534
165 3300005441 Ga0070700_100077012 Ga0070700_1000770122 535
166 3300011119 Ga0105246_10056645 Ga0105246_100566452 535
167 3300021361 Ga0213872_10000396 Ga0213872_1000039618 536
168 3300030521 Ga0307511_10000248 Ga0307511_100002486 536
169 3300039447 Ga0436361_0908337 Ga0436361_0908337_22011_23720 536
170 3300042876 Ga0451577_0082841 Ga0451577_0082841_228_1901 536
171 3300044658 Ga0466972_0000037 Ga0466972_0000037_30004_31707 536
172 3300044683 Ga0466965_0012886 Ga0466965_0012886_1389_3083 536
173 3300044706 Ga0466964_0003346 Ga0466964_0003346_1157_2851 536
174 3300044706 Ga0466964_0009412 Ga0466964_0009412_1301_3004 536
175 3300044712 Ga0453684_0052822 Ga0453684_0052822_1266_2939 536
176 3300053092 Ga0500583_0002675 Ga0500583_0002675_307_2058 536
177 3300053151 Ga0500604_0010157 Ga0500604_0010157_415_2181 536
178 3300005455 Ga0070663_100010855 Ga0070663_1000108553 537
179 3300005457 Ga0070662_100009364 Ga0070662_1000093642 537
180 3300005616 Ga0068852_100109174 Ga0068852_1001091742 537
181 3300005842 Ga0068858_100010293 Ga0068858_1000102936 537
182 3300006177 Ga0075362_10003562 Ga0075362_100035622 537
183 3300006178 Ga0075367_10028188 Ga0075367_100281882 537
184 3300009545 Ga0105237_10011185 Ga0105237_100111857 537
185 3300010375 Ga0105239_10111921 Ga0105239_101119212 537
186 3300014968 Ga0157379_10041630 Ga0157379_100416302 537
187 3300025298 Ga0209050_1001442 Ga0209050_100144219 537
188 3300025914 Ga0207671_10030403 Ga0207671_100304033 537
189 3300025942 Ga0207689_10017421 Ga0207689_100174212 537
190 3300026035 Ga0207703_10007009 Ga0207703_100070096 537
191 3300026067 Ga0207678_10012730 Ga0207678_100127302 537
192 3300044656 Ga0466969_0000017 Ga0466969_0000017_89747_91423 537
193 3300044684 Ga0466966_0005449 Ga0466966_0005449_264_1967 537
194 3300044684 Ga0466966_0028971 Ga0466966_0028971_1731_3407 537
195 3300046542 Ga0495597_0018294 Ga0495597_0018294_504_2192 537
196 3300047443 Ga0495687_002581 Ga0495687_002581_11357_13045 537
197 3300049579 Ga0501043_0000009 Ga0501043_0000009_154036_155721 537
198 3300049580 Ga0501046_0000022 Ga0501046_0000022_154025_155710 537
199 3300049581 Ga0501047_0000021 Ga0501047_0000021_154083_155768 537
200 3300049582 Ga0501048_0001661 Ga0501048_0001661_11126_12811 537
201 3300049824 Ga0501045_0009763 Ga0501045_0009763_1737_3422 537
202 3300050491 nmdc:mga00v17_11265_c1 nmdc:mga00v17_11265_c1_2976_4664 537
203 3300050493 nmdc:mga0k408_5664_c1 nmdc:mga0k408_5664_c1_3642_5330 537
204 3300006195 Ga0075366_10001289 Ga0075366_100012895 538
205 3300025940 Ga0207691_10116412 Ga0207691_101164122 538
206 3300026121 Ga0207683_10014082 Ga0207683_100140828 538
207 3300027526 Ga0209968_1000782 Ga0209968_10007822 538
208 3300027695 Ga0209966_1000001 Ga0209966_100000187 538
209 3300031730 Ga0307516_10018878 Ga0307516_100188788 538
210 3300037312 Ga0395899_0000723 Ga0395899_0000723_26441_28162 538
211 3300046457 Ga0495590_0008551 Ga0495590_0008551_942_2648 538
212 3300053154 Ga0500619_000479 Ga0500619_000479_2309_3997 538
213 3300005339 Ga0070660_100060521 Ga0070660_1000605212 539
214 3300005344 Ga0070661_100011920 Ga0070661_1000119205 539
215 3300005366 Ga0070659_100001144 Ga0070659_1000011444 539
216 3300005564 Ga0070664_100035443 Ga0070664_1000354434 539
217 3300009093 Ga0105240_10002442 Ga0105240_100024422 539
218 3300009545 Ga0105237_10001836 Ga0105237_1000183612 539
219 3300010375 Ga0105239_10001156 Ga0105239_1000115615 539
220 3300025919 Ga0207657_10069730 Ga0207657_100697302 539
221 3300025932 Ga0207690_10003338 Ga0207690_100033382 539
222 3300025945 Ga0207679_10003068 Ga0207679_100030686 539
223 3300031730 Ga0307516_10000678 Ga0307516_1000067827 539
224 3300042531 Ga0450918_000669 Ga0450918_000669_2830_4521 539
225 3300048905 Ga0496102_0011887 Ga0496102_0011887_984_2675 539
226 3300053117 Ga0500593_000715 Ga0500593_000715_9087_10778 539
227 iso_pu_bacteria 2643221644 2644247558 539
228 3300005459 Ga0068867_100000215 Ga0068867_10000021527 540
229 3300005719 Ga0068861_100001372 Ga0068861_1000013724 540
230 3300005843 Ga0068860_100001625 Ga0068860_10000162519 540
231 3300005844 Ga0068862_100081186 Ga0068862_1000811863 540
232 3300009148 Ga0105243_10016078 Ga0105243_100160782 540
233 3300013297 Ga0157378_10006233 Ga0157378_100062334 540
234 3300013306 Ga0163162_10000655 Ga0163162_100006556 540
235 3300013308 Ga0157375_10014204 Ga0157375_100142043 540
236 3300014326 Ga0157380_10021378 Ga0157380_100213784 540
237 3300025914 Ga0207671_10005755 Ga0207671_100057559 540
238 3300025923 Ga0207681_10048946 Ga0207681_100489462 540
239 3300026089 Ga0207648_10000579 Ga0207648_1000057933 540
240 3300026118 Ga0207675_100001767 Ga0207675_10000176710 540
241 3300028381 Ga0268264_10006569 Ga0268264_100065694 540
242 3300046660 Ga0495625_0026151 Ga0495625_0026151_1643_3334 540
243 3300003320 rootH2_10042226 rootH2_100422262 541
244 3300005295 Ga0065707_10085323 Ga0065707_100853233 541
245 3300005328 Ga0070676_10053941 Ga0070676_100539412 541
246 3300005331 Ga0070670_100010647 Ga0070670_1000106473 541
247 3300005333 Ga0070677_10005676 Ga0070677_100056762 541
248 3300005353 Ga0070669_100036240 Ga0070669_1000362402 541
249 3300005354 Ga0070675_100024595 Ga0070675_1000245953 541
250 3300005355 Ga0070671_100038907 Ga0070671_1000389072 541
251 3300005356 Ga0070674_100015515 Ga0070674_1000155153 541
252 3300005364 Ga0070673_100002488 Ga0070673_1000024886 541
253 3300005367 Ga0070667_100092376 Ga0070667_1000923762 541
254 3300005456 Ga0070678_100007079 Ga0070678_1000070795 541
255 3300005458 Ga0070681_10025504 Ga0070681_100255044 541
256 3300005459 Ga0068867_100003075 Ga0068867_1000030754 541
257 3300005459 Ga0068867_100015395 Ga0068867_1000153955 541
258 3300005459 Ga0068867_100050769 Ga0068867_1000507692 541
259 3300005543 Ga0070672_100037799 Ga0070672_1000377993 541
260 3300009148 Ga0105243_10051644 Ga0105243_100516442 541
261 3300025315 Ga0207697_10022202 Ga0207697_100222022 541
262 3300025893 Ga0207682_10001087 Ga0207682_1000108710 541
263 3300025923 Ga0207681_10031269 Ga0207681_100312693 541
264 3300025925 Ga0207650_10000607 Ga0207650_100006077 541
265 3300025926 Ga0207659_10001209 Ga0207659_100012093 541
266 3300025931 Ga0207644_10014040 Ga0207644_100140403 541
267 3300025931 Ga0207644_10092359 Ga0207644_100923592 541
268 3300025937 Ga0207669_10004742 Ga0207669_100047422 541
269 3300025940 Ga0207691_10001758 Ga0207691_1000175810 541
270 3300025960 Ga0207651_10001705 Ga0207651_100017056 541
271 3300025986 Ga0207658_10133591 Ga0207658_101335912 541
272 3300026088 Ga0207641_10114024 Ga0207641_101140242 541
273 3300026089 Ga0207648_10002224 Ga0207648_100022244 541
274 3300026089 Ga0207648_10008629 Ga0207648_100086293 541
275 3300026089 Ga0207648_10031445 Ga0207648_100314453 541
276 3300026121 Ga0207683_10010683 Ga0207683_100106837 541
277 3300037068 Ga0373925_0013001 Ga0373925_0013001_4164_5855 541
278 3300005844 Ga0068862_100079078 Ga0068862_1000790782 542
279 3300006195 Ga0075366_10051298 Ga0075366_100512983 542
280 3300009551 Ga0105238_10101988 Ga0105238_101019882 543
281 3300026116 Ga0207674_10137315 Ga0207674_101373151 543
282 3300038443 Ga0395901_0001967 Ga0395901_0001967_17372_19048 543
283 3300050496 nmdc:mga07m45_9028_c1 nmdc:mga07m45_9028_c1_2352_4031 544
284 3300021361 Ga0213872_10000012 Ga0213872_10000012130 545
285 3300039447 Ga0436361_0351372 Ga0436361_0351372_157480_159195 545
286 3300002705 JGI25156J39149_1000772 JGI25156J39149_100077218 546
287 3300002705 JGI25156J39149_1001157 JGI25156J39149_100115711 546
288 3300002741 JGI25157J39369_1000095 JGI25157J39369_10000952 546
289 3300005563 Ga0068855_100089253 Ga0068855_1000892531 546
290 3300005577 Ga0068857_100000469 Ga0068857_10000046918 546
291 3300005578 Ga0068854_100066942 Ga0068854_1000669422 546
292 3300005614 Ga0068856_100001938 Ga0068856_10000193815 546
293 3300009093 Ga0105240_10016534 Ga0105240_100165344 546
294 3300013105 Ga0157369_10043816 Ga0157369_100438163 546
295 3300025242 Ga0209258_100664 Ga0209258_1006645 546
296 3300025246 Ga0209646_1000124 Ga0209646_1000124107 546
297 3300025250 Ga0209026_1000085 Ga0209026_1000085107 546
298 3300025253 Ga0209677_101683 Ga0209677_1016832 546
299 3300025256 Ga0209759_1000068 Ga0209759_1000068105 546
300 3300025303 Ga0209051_1001697 Ga0209051_10016974 546
301 3300025913 Ga0207695_10036340 Ga0207695_100363403 546
302 3300026078 Ga0207702_10000235 Ga0207702_1000023551 546
303 3300026116 Ga0207674_10005437 Ga0207674_100054379 546

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00916

Sulfate_transp

Sulfate permease family

52

444

0.96

PF01740

STAS

STAS domain

487

591

0.91

PF13466

STAS_2

STAS domain

498

576

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ki1-assembly1.cif.gz_A the transmembrane domain of a cyanobacterium bicarbonate transporter bica 0.8707 18 416
6ki1-assembly2.cif.gz_B the transmembrane domain of a cyanobacterium bicarbonate transporter bica 0.8607 18 417
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.8524 18 420
6ki1-assembly1.cif.gz_A the transmembrane domain of a cyanobacterium bicarbonate transporter bica 0.8493 18 416
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.8467 424 543
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8535 422 504 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8446 425 543 3.30.750.24
af_Q80ZD3_447_566_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8375 419 543 3.30.750.24
af_A0A1D8PRZ2_628_764_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8341 438 541 3.30.750.24
af_Q62273_548_723_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8331 430 541 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2V6N916-F1-model_v4 Sodium-independent anion transporter 0.9716 7 376 GO:0016020
GO:0055085
AF-A0A2V6N916-F1-model_v4 Sodium-independent anion transporter 0.9581 7 376 GO:0016020
GO:0055085
AF-A0A519I993-F1-model_v4 deleted 0.957 2 397
AF-A0A2N3FH54-F1-model_v4 Sodium-independent anion transporter 0.9519 8 331 GO:0016020
GO:0055085
AF-A0A2N3FH54-F1-model_v4 Sodium-independent anion transporter 0.9459 8 331 GO:0016020
GO:0055085

Feature Viewer

pLDDT pTM Quality
81.6 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map