F396885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 208 | 294 | 553 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10025504|Ga0070681_100255044 |
| Length | 601 |
| Sequence | MSDGAPGSPPAAGRAAPRIAGAARLLRDFAPRLHRFRPRLLDDLAGYDGHRFAADLGAGLTVGIVALPLAMAFAIASGVKPEQGIFTAIIAGFLISLLGGSSVQIGGPAGAFIVIVYGIVQRYGVANLLIATVLAGVLLLALGWLKLGALVRYIPVSIVIGFTNGIAVLIAVSQVKDLLGLRIDKVPADFFAQAHAIATHLGSINLAALALGLACFAGLLFWARLAAFPAHSLHPDLPWHHRAVLAIPHGRRFVRVATRIPGPIVALVTLSLIATWLKLPVETIGTRFGGIPRALPAFVWPAFDWETVQLLFVPTVTIAMLGAVESLLCARVADGMASQRRHDPNQELMAQGVANIVAPFFGGIPATGTIARTVTNLRAGATSPVAGIVHALTLLAIVLVAAPLAVHVPLAVLAGVLLFVAWNMGEWEAFARMSAFSVEQRVKLFSTFLLTVLVDLTVAMEVGLAAACLVFVYRMSTLFRVEADPERPPTAPGVVAYRLYGALFFAATAKLEAVADALPPGTTTLVLDMRQLVSIDASGLDALENLHLALERAHVRLVLVGLNEQPLEAVRKWGLDAMLGAENVFADRDSAFAALAGSRAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 5 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 6 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 7 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 8 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 9 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 141 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 142 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 143 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 144 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 145 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 182 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 183 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 196 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 197 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 199 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 200 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 201 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 202 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 203 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 205 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 206 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 207 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 208 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.03 |
| Metatranscriptomes | 0 |
| Isolates | 2.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.14 |
| Nodule | 0 |
| Rhizoplane | 3.3 |
| Rhizosphere | 69.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000772 | 3300002705 | Bacteria | 16645 |
| 2 | JGI25156J39149_1001157 | 3300002705 | Bacteria | 11808 |
| 3 | JGI25157J39369_1000095 | 3300002741 | Bacteria | 74770 |
| 4 | JGI25153J46596_10002983 | 3300003215 | Bacteria | 9573 |
| 5 | rootH1_10012249 | 3300003316 | Bacteria | 2313 |
| 6 | rootH2_10042226 | 3300003320 | Bacteria | 3108 |
| 7 | rootL2_10028489 | 3300003322 | Bacteria | 3163 |
| 8 | JGI26128J50194_1000269 | 3300003347 | Bacteria | 2598 |
| 9 | Ga0055540_1003166 | 3300003792 | Bacteria | 8122 |
| 10 | Ga0055531_10000317 | 3300003794 | Bacteria | 47389 |
| 11 | Ga0055531_10000689 | 3300003794 | Bacteria | 28730 |
| 12 | Ga0065707_10085323 | 3300005295 | Bacteria | 6245 |
| 13 | Ga0070658_10114379 | 3300005327 | Bacteria | 2237 |
| 14 | Ga0070676_10053941 | 3300005328 | Bacteria | 2369 |
| 15 | Ga0070670_100010647 | 3300005331 | Bacteria | 7857 |
| 16 | Ga0070670_100018231 | 3300005331 | Bacteria | 6023 |
| 17 | Ga0070670_100049189 | 3300005331 | Bacteria | 3625 |
| 18 | Ga0070677_10005676 | 3300005333 | Bacteria | 4122 |
| 19 | Ga0070660_100060521 | 3300005339 | Bacteria | 2939 |
| 20 | Ga0070661_100011920 | 3300005344 | Bacteria | 6071 |
| 21 | Ga0070669_100036240 | 3300005353 | Bacteria | 3574 |
| 22 | Ga0070675_100024595 | 3300005354 | Bacteria | 4822 |
| 23 | Ga0070675_100097613 | 3300005354 | Bacteria | 2470 |
| 24 | Ga0070671_100038907 | 3300005355 | Bacteria | 3947 |
| 25 | Ga0070674_100015515 | 3300005356 | Bacteria | 4756 |
| 26 | Ga0070673_100002488 | 3300005364 | Bacteria | 11245 |
| 27 | Ga0070673_100123037 | 3300005364 | Bacteria | 2167 |
| 28 | Ga0070659_100001144 | 3300005366 | Bacteria | 19362 |
| 29 | Ga0070667_100092376 | 3300005367 | Bacteria | 2604 |
| 30 | Ga0070700_100077012 | 3300005441 | Bacteria | 2144 |
| 31 | Ga0070708_100029828 | 3300005445 | Bacteria | 4708 |
| 32 | Ga0070663_100010855 | 3300005455 | Bacteria | 5691 |
| 33 | Ga0070678_100007079 | 3300005456 | Bacteria | 6631 |
| 34 | Ga0070678_100048187 | 3300005456 | Bacteria | 3067 |
| 35 | Ga0070662_100009364 | 3300005457 | Bacteria | 6403 |
| 36 | Ga0070662_100022654 | 3300005457 | Bacteria | 4302 |
| 37 | Ga0070662_100034822 | 3300005457 | Bacteria | 3553 |
| 38 | Ga0070681_10025504 | 3300005458 | Bacteria | 5946 |
| 39 | Ga0068867_100000173 | 3300005459 | Bacteria | 42222 |
| 40 | Ga0068867_100000215 | 3300005459 | Bacteria | 38520 |
| 41 | Ga0068867_100003075 | 3300005459 | Bacteria | 11756 |
| 42 | Ga0068867_100015395 | 3300005459 | Bacteria | 5423 |
| 43 | Ga0068867_100050769 | 3300005459 | Bacteria | 3058 |
| 44 | Ga0070672_100036676 | 3300005543 | Bacteria | 3736 |
| 45 | Ga0070672_100037799 | 3300005543 | Bacteria | 3684 |
| 46 | Ga0068855_100039716 | 3300005563 | Bacteria | 5586 |
| 47 | Ga0068855_100089253 | 3300005563 | Bacteria | 3559 |
| 48 | Ga0070664_100035443 | 3300005564 | Bacteria | 4189 |
| 49 | Ga0070664_100037163 | 3300005564 | Bacteria | 4092 |
| 50 | Ga0068857_100000469 | 3300005577 | Bacteria | 28770 |
| 51 | Ga0068854_100066942 | 3300005578 | Bacteria | 2615 |
| 52 | Ga0068856_100001938 | 3300005614 | Bacteria | 21587 |
| 53 | Ga0068852_100085711 | 3300005616 | Bacteria | 2806 |
| 54 | Ga0068852_100109174 | 3300005616 | Bacteria | 2512 |
| 55 | Ga0068864_100180326 | 3300005618 | Bacteria | 1930 |
| 56 | Ga0068861_100001372 | 3300005719 | Bacteria | 15283 |
| 57 | Ga0068858_100005381 | 3300005842 | Bacteria | 12548 |
| 58 | Ga0068858_100010293 | 3300005842 | Bacteria | 8867 |
| 59 | Ga0068860_100001625 | 3300005843 | Bacteria | 24111 |
| 60 | Ga0068862_100079078 | 3300005844 | Bacteria | 2850 |
| 61 | Ga0068862_100081186 | 3300005844 | Bacteria | 2812 |
| 62 | Ga0075365_10006008 | 3300006038 | Bacteria | 6629 |
| 63 | Ga0075365_10013130 | 3300006038 | Bacteria | 4940 |
| 64 | Ga0075363_100013438 | 3300006048 | Bacteria | 3969 |
| 65 | Ga0075362_10003562 | 3300006177 | Bacteria | 5467 |
| 66 | Ga0075362_10005956 | 3300006177 | Bacteria | 4506 |
| 67 | Ga0075367_10028188 | 3300006178 | Bacteria | 3201 |
| 68 | Ga0075369_10001253 | 3300006186 | Bacteria | 8632 |
| 69 | Ga0075366_10001289 | 3300006195 | Bacteria | 12493 |
| 70 | Ga0075366_10001659 | 3300006195 | Bacteria | 11175 |
| 71 | Ga0075366_10002337 | 3300006195 | Bacteria | 9703 |
| 72 | Ga0075366_10009622 | 3300006195 | Bacteria | 5402 |
| 73 | Ga0075366_10016279 | 3300006195 | Bacteria | 4272 |
| 74 | Ga0075366_10019939 | 3300006195 | Bacteria | 3886 |
| 75 | Ga0075366_10051298 | 3300006195 | Bacteria | 2451 |
| 76 | Ga0075370_10000149 | 3300006353 | Bacteria | 23819 |
| 77 | Ga0075370_10004405 | 3300006353 | Bacteria | 6835 |
| 78 | Ga0075370_10014437 | 3300006353 | Bacteria | 4214 |
| 79 | Ga0075429_100000370 | 3300006880 | Bacteria | 33134 |
| 80 | Ga0075436_100022508 | 3300006914 | Bacteria | 4328 |
| 81 | Ga0105240_10002442 | 3300009093 | Bacteria | 29876 |
| 82 | Ga0105240_10016534 | 3300009093 | Bacteria | 9986 |
| 83 | Ga0114129_10033373 | 3300009147 | Bacteria | 7274 |
| 84 | Ga0105243_10004078 | 3300009148 | Bacteria | 11636 |
| 85 | Ga0105243_10016078 | 3300009148 | Bacteria | 5661 |
| 86 | Ga0105243_10051644 | 3300009148 | Bacteria | 3252 |
| 87 | Ga0105242_10008320 | 3300009176 | Bacteria | 7971 |
| 88 | Ga0105248_10002855 | 3300009177 | Bacteria | 19175 |
| 89 | Ga0105237_10001836 | 3300009545 | Bacteria | 27312 |
| 90 | Ga0105237_10011185 | 3300009545 | Bacteria | 9510 |
| 91 | Ga0105238_10040770 | 3300009551 | Bacteria | 4704 |
| 92 | Ga0105238_10101988 | 3300009551 | Bacteria | 2852 |
| 93 | Ga0105239_10001156 | 3300010375 | Bacteria | 36262 |
| 94 | Ga0105239_10111921 | 3300010375 | Bacteria | 3027 |
| 95 | Ga0105246_10056645 | 3300011119 | Bacteria | 2710 |
| 96 | Ga0157369_10043816 | 3300013105 | Bacteria | 4875 |
| 97 | Ga0157378_10006233 | 3300013297 | Bacteria | 10444 |
| 98 | Ga0163162_10000655 | 3300013306 | Bacteria | 32037 |
| 99 | Ga0163162_10013510 | 3300013306 | Bacteria | 7972 |
| 100 | Ga0163162_10203866 | 3300013306 | Bacteria | 2107 |
| 101 | Ga0157375_10014204 | 3300013308 | Bacteria | 7098 |
| 102 | Ga0157380_10021378 | 3300014326 | Bacteria | 4853 |
| 103 | Ga0157377_10000039 | 3300014745 | Bacteria | 112711 |
| 104 | Ga0157379_10030241 | 3300014968 | Bacteria | 4819 |
| 105 | Ga0157379_10041630 | 3300014968 | Bacteria | 4101 |
| 106 | Ga0163161_10085969 | 3300017792 | Bacteria | 2321 |
| 107 | Ga0213872_10000012 | 3300021361 | Bacteria | 191291 |
| 108 | Ga0213872_10000396 | 3300021361 | Bacteria | 36208 |
| 109 | Ga0209258_100664 | 3300025242 | Bacteria | 24590 |
| 110 | Ga0209646_1000124 | 3300025246 | Bacteria | 138207 |
| 111 | Ga0209026_1000085 | 3300025250 | Bacteria | 185778 |
| 112 | Ga0209677_101683 | 3300025253 | Bacteria | 9240 |
| 113 | Ga0209759_1000068 | 3300025256 | Bacteria | 183479 |
| 114 | Ga0209673_1016568 | 3300025273 | Bacteria | 2749 |
| 115 | Ga0209758_1000096 | 3300025297 | Bacteria | 231496 |
| 116 | Ga0209050_1001442 | 3300025298 | Bacteria | 25546 |
| 117 | Ga0209050_1007741 | 3300025298 | Bacteria | 5928 |
| 118 | Ga0209051_1000623 | 3300025303 | Bacteria | 40736 |
| 119 | Ga0209051_1001697 | 3300025303 | Bacteria | 17666 |
| 120 | Ga0209051_1017618 | 3300025303 | Bacteria | 3187 |
| 121 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 122 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 123 | Ga0209257_1019201 | 3300025304 | Bacteria | 2586 |
| 124 | Ga0207697_10022202 | 3300025315 | Bacteria | 2600 |
| 125 | Ga0207682_10001087 | 3300025893 | Bacteria | 12557 |
| 126 | Ga0207682_10010792 | 3300025893 | Bacteria | 3578 |
| 127 | Ga0207695_10036340 | 3300025913 | Bacteria | 5327 |
| 128 | Ga0207671_10005755 | 3300025914 | Bacteria | 11293 |
| 129 | Ga0207671_10030403 | 3300025914 | Bacteria | 4028 |
| 130 | Ga0207657_10069730 | 3300025919 | Bacteria | 2982 |
| 131 | Ga0207681_10031269 | 3300025923 | Bacteria | 3476 |
| 132 | Ga0207681_10048946 | 3300025923 | Bacteria | 2855 |
| 133 | Ga0207650_10000607 | 3300025925 | Bacteria | 28697 |
| 134 | Ga0207650_10016290 | 3300025925 | Bacteria | 5193 |
| 135 | Ga0207659_10001209 | 3300025926 | Bacteria | 15421 |
| 136 | Ga0207644_10014040 | 3300025931 | Bacteria | 5354 |
| 137 | Ga0207644_10092359 | 3300025931 | Bacteria | 2258 |
| 138 | Ga0207690_10003338 | 3300025932 | Bacteria | 9596 |
| 139 | Ga0207706_10112439 | 3300025933 | Bacteria | 2396 |
| 140 | Ga0207686_10002776 | 3300025934 | Bacteria | 9485 |
| 141 | Ga0207709_10002451 | 3300025935 | Bacteria | 11650 |
| 142 | Ga0207669_10004742 | 3300025937 | Bacteria | 6021 |
| 143 | Ga0207704_10021744 | 3300025938 | Bacteria | 3423 |
| 144 | Ga0207691_10001758 | 3300025940 | Bacteria | 21323 |
| 145 | Ga0207691_10116412 | 3300025940 | Bacteria | 2372 |
| 146 | Ga0207711_10011504 | 3300025941 | Bacteria | 7355 |
| 147 | Ga0207689_10017421 | 3300025942 | Bacteria | 6078 |
| 148 | Ga0207679_10003068 | 3300025945 | Bacteria | 10343 |
| 149 | Ga0207667_10024645 | 3300025949 | Bacteria | 6601 |
| 150 | Ga0207651_10001705 | 3300025960 | Bacteria | 10141 |
| 151 | Ga0207640_10061804 | 3300025981 | Bacteria | 2482 |
| 152 | Ga0207640_10081093 | 3300025981 | Bacteria | 2217 |
| 153 | Ga0207658_10007759 | 3300025986 | Bacteria | 7314 |
| 154 | Ga0207658_10133591 | 3300025986 | Bacteria | 1997 |
| 155 | Ga0207703_10007009 | 3300026035 | Bacteria | 8968 |
| 156 | Ga0207703_10008991 | 3300026035 | Bacteria | 7867 |
| 157 | Ga0207678_10012730 | 3300026067 | Bacteria | 7387 |
| 158 | Ga0207678_10066725 | 3300026067 | Bacteria | 3089 |
| 159 | Ga0207702_10000235 | 3300026078 | Bacteria | 64091 |
| 160 | Ga0207702_10098998 | 3300026078 | Bacteria | 2570 |
| 161 | Ga0207641_10111619 | 3300026088 | Bacteria | 2425 |
| 162 | Ga0207641_10114024 | 3300026088 | Bacteria | 2401 |
| 163 | Ga0207648_10000579 | 3300026089 | Bacteria | 41056 |
| 164 | Ga0207648_10002224 | 3300026089 | Bacteria | 21032 |
| 165 | Ga0207648_10008629 | 3300026089 | Bacteria | 9849 |
| 166 | Ga0207648_10031445 | 3300026089 | Bacteria | 4693 |
| 167 | Ga0207676_10113119 | 3300026095 | Bacteria | 2275 |
| 168 | Ga0207674_10005437 | 3300026116 | Bacteria | 15126 |
| 169 | Ga0207674_10137315 | 3300026116 | Bacteria | 2406 |
| 170 | Ga0207675_100001767 | 3300026118 | Bacteria | 21608 |
| 171 | Ga0207675_100129660 | 3300026118 | Bacteria | 2391 |
| 172 | Ga0207683_10010683 | 3300026121 | Bacteria | 7826 |
| 173 | Ga0207683_10014082 | 3300026121 | Bacteria | 6815 |
| 174 | Ga0207683_10054358 | 3300026121 | Bacteria | 3512 |
| 175 | Ga0207683_10115581 | 3300026121 | Bacteria | 2405 |
| 176 | Ga0209968_1000782 | 3300027526 | Bacteria | 4903 |
| 177 | Ga0209966_1000001 | 3300027695 | Bacteria | 139125 |
| 178 | Ga0268266_10153766 | 3300028379 | Bacteria | 2076 |
| 179 | Ga0268264_10006569 | 3300028381 | Bacteria | 9790 |
| 180 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 181 | Ga0307515_10047036 | 3300028794 | Bacteria | 6575 |
| 182 | Ga0307511_10000248 | 3300030521 | Bacteria | 55337 |
| 183 | Ga0265331_10010604 | 3300031250 | Bacteria | 5088 |
| 184 | Ga0307513_10022546 | 3300031456 | Bacteria | 7395 |
| 185 | Ga0307408_100058905 | 3300031548 | Bacteria | 2794 |
| 186 | Ga0265314_10001279 | 3300031711 | Bacteria | 28615 |
| 187 | Ga0307516_10000678 | 3300031730 | Bacteria | 46164 |
| 188 | Ga0307516_10018878 | 3300031730 | Bacteria | 7157 |
| 189 | Ga0307516_10034293 | 3300031730 | Bacteria | 5102 |
| 190 | Ga0307516_10056116 | 3300031730 | Bacteria | 3842 |
| 191 | Ga0307516_10142130 | 3300031730 | Bacteria | 2168 |
| 192 | Ga0307416_100098537 | 3300032002 | Bacteria | 2536 |
| 193 | Ga0373925_0013001 | 3300037068 | Bacteria | 6027 |
| 194 | Ga0395899_0000723 | 3300037312 | Bacteria | 33030 |
| 195 | Ga0395899_0002930 | 3300037312 | Bacteria | 13693 |
| 196 | Ga0395898_0003443 | 3300037466 | Bacteria | 17693 |
| 197 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 198 | Ga0395905_0004910 | 3300037471 | Bacteria | 13772 |
| 199 | Ga0395905_0005270 | 3300037471 | Bacteria | 13222 |
| 200 | Ga0395905_0025821 | 3300037471 | Bacteria | 5537 |
| 201 | Ga0395905_0044726 | 3300037471 | Bacteria | 4154 |
| 202 | Ga0395901_0001967 | 3300038443 | Bacteria | 21139 |
| 203 | Ga0395901_0023478 | 3300038443 | Bacteria | 6323 |
| 204 | Ga0395901_0066417 | 3300038443 | Bacteria | 3757 |
| 205 | Ga0436365_1305172 | 3300039437 | Bacteria | 4855 |
| 206 | Ga0436361_0231720 | 3300039447 | Bacteria | 61956 |
| 207 | Ga0436361_0351372 | 3300039447 | Bacteria | 183069 |
| 208 | Ga0436361_0406743 | 3300039447 | Bacteria | 1948 |
| 209 | Ga0436361_0908337 | 3300039447 | Bacteria | 39649 |
| 210 | Ga0451795_0115068 | 3300041456 | Bacteria | 2876 |
| 211 | Ga0450888_000023 | 3300042126 | Bacteria | 10988 |
| 212 | Ga0450890_001554 | 3300042127 | Bacteria | 3296 |
| 213 | Ga0450891_000928 | 3300042129 | Bacteria | 3056 |
| 214 | Ga0450918_000669 | 3300042531 | Bacteria | 7305 |
| 215 | Ga0450893_0002199 | 3300042532 | Bacteria | 3036 |
| 216 | Ga0451577_0082841 | 3300042876 | Bacteria | 2861 |
| 217 | Ga0466969_0000017 | 3300044656 | Bacteria | 103792 |
| 218 | Ga0466969_0008460 | 3300044656 | Bacteria | 5459 |
| 219 | Ga0466969_0023951 | 3300044656 | Bacteria | 3142 |
| 220 | Ga0466969_0045789 | 3300044656 | Bacteria | 2170 |
| 221 | Ga0466972_0000037 | 3300044658 | Bacteria | 137184 |
| 222 | Ga0466972_0005453 | 3300044658 | Bacteria | 6375 |
| 223 | Ga0466965_0012886 | 3300044683 | Bacteria | 3937 |
| 224 | Ga0466966_0005449 | 3300044684 | Bacteria | 8368 |
| 225 | Ga0466966_0017527 | 3300044684 | Bacteria | 4731 |
| 226 | Ga0466966_0028971 | 3300044684 | Bacteria | 3604 |
| 227 | Ga0466961_0018498 | 3300044693 | Bacteria | 4482 |
| 228 | Ga0466964_0003346 | 3300044706 | Bacteria | 5842 |
| 229 | Ga0466964_0009412 | 3300044706 | Bacteria | 3678 |
| 230 | Ga0453684_0052822 | 3300044712 | Bacteria | 5310 |
| 231 | Ga0466971_0010738 | 3300044719 | Bacteria | 4006 |
| 232 | Ga0466957_0098238 | 3300044842 | Bacteria | 1842 |
| 233 | Ga0466959_0000287 | 3300045049 | Bacteria | 30550 |
| 234 | Ga0451576_0081171 | 3300045051 | Bacteria | 3373 |
| 235 | Ga0451576_0116344 | 3300045051 | Bacteria | 2784 |
| 236 | Ga0451576_0145579 | 3300045051 | Bacteria | 2470 |
| 237 | Ga0466967_0005385 | 3300045976 | Bacteria | 8858 |
| 238 | Ga0495590_0008551 | 3300046457 | Bacteria | 3907 |
| 239 | Ga0495638_0048013 | 3300046460 | Bacteria | 2674 |
| 240 | Ga0495650_0001967 | 3300046471 | Bacteria | 18141 |
| 241 | Ga0495632_0009191 | 3300046519 | Bacteria | 5974 |
| 242 | Ga0495597_0018294 | 3300046542 | Bacteria | 3289 |
| 243 | Ga0495625_0026151 | 3300046660 | Bacteria | 4413 |
| 244 | Ga0495687_002581 | 3300047443 | Bacteria | 14284 |
| 245 | Ga0495687_004808 | 3300047443 | Bacteria | 8900 |
| 246 | Ga0496102_0011887 | 3300048905 | Bacteria | 7516 |
| 247 | Ga0496105_0101235 | 3300048908 | Bacteria | 2379 |
| 248 | Ga0496107_0109818 | 3300048910 | Bacteria | 2026 |
| 249 | Ga0496108_0065396 | 3300048911 | Bacteria | 3065 |
| 250 | Ga0496109_0051665 | 3300048912 | Bacteria | 3744 |
| 251 | Ga0496110_0056554 | 3300048913 | Bacteria | 3452 |
| 252 | Ga0496111_0009448 | 3300048914 | Bacteria | 6510 |
| 253 | Ga0496112_0090915 | 3300048915 | Bacteria | 3021 |
| 254 | Ga0496113_0048044 | 3300048916 | Bacteria | 3174 |
| 255 | Ga0501031_0014091 | 3300049568 | Bacteria | 5202 |
| 256 | Ga0501034_0031433 | 3300049571 | Bacteria | 5391 |
| 257 | Ga0501034_0136873 | 3300049571 | Bacteria | 2430 |
| 258 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 259 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 260 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 261 | Ga0501048_0001661 | 3300049582 | Bacteria | 16948 |
| 262 | Ga0501222_000510 | 3300049662 | Bacteria | 5776 |
| 263 | Ga0501221_001061 | 3300049704 | Bacteria | 4521 |
| 264 | Ga0501225_0014194 | 3300049705 | Bacteria | 2226 |
| 265 | Ga0501045_0009763 | 3300049824 | Bacteria | 6711 |
| 266 | nmdc:mga03683_2112_c1 | 3300050489 | Bacteria | 6116 |
| 267 | nmdc:mga00v17_11265_c1 | 3300050491 | Bacteria | 4913 |
| 268 | nmdc:mga0yw44_55744_c1 | 3300050492 | Bacteria | 2406 |
| 269 | nmdc:mga0k408_10394_c1 | 3300050493 | Bacteria | 5034 |
| 270 | nmdc:mga0k408_19608_c1 | 3300050493 | Bacteria | 3782 |
| 271 | nmdc:mga0k408_5664_c1 | 3300050493 | Bacteria | 6639 |
| 272 | nmdc:mga06z11_23057_c1 | 3300050494 | Bacteria | 2918 |
| 273 | nmdc:mga07m45_11143_c1 | 3300050496 | Bacteria | 4717 |
| 274 | nmdc:mga07m45_13822_c1 | 3300050496 | Bacteria | 4289 |
| 275 | nmdc:mga07m45_1712_c1 | 3300050496 | Bacteria | 10106 |
| 276 | nmdc:mga07m45_9028_c1 | 3300050496 | Bacteria | 5150 |
| 277 | nmdc:mga05p37_91905_c1 | 3300050507 | Bacteria | 3739 |
| 278 | nmdc:mga09592_1991_c1 | 3300050508 | Bacteria | 16488 |
| 279 | nmdc:mga0n895_113719_c1 | 3300050512 | Bacteria | 2724 |
| 280 | nmdc:mga0sz30_14572_c1 | 3300050516 | Bacteria | 3097 |
| 281 | Ga0500583_0002675 | 3300053092 | Bacteria | 5421 |
| 282 | Ga0500651_0002096 | 3300053093 | Bacteria | 10370 |
| 283 | Ga0500562_004096 | 3300053108 | Bacteria | 3674 |
| 284 | Ga0500593_000715 | 3300053117 | Bacteria | 12608 |
| 285 | Ga0500628_003232 | 3300053129 | Bacteria | 2682 |
| 286 | Ga0500642_0019678 | 3300053130 | Bacteria | 2638 |
| 287 | Ga0500652_002227 | 3300053131 | Bacteria | 5829 |
| 288 | Ga0500655_002128 | 3300053133 | Bacteria | 3666 |
| 289 | Ga0500658_0005470 | 3300053134 | Bacteria | 4725 |
| 290 | Ga0500604_0010157 | 3300053151 | Bacteria | 2515 |
| 291 | Ga0500616_0036986 | 3300053153 | Bacteria | 2645 |
| 292 | Ga0500619_000479 | 3300053154 | Bacteria | 6999 |
| 293 | Ga0500622_0000262 | 3300053156 | Bacteria | 53796 |
| 294 | Ga0466962_0005485 | 3300061719 | Bacteria | 6097 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0101235 | Ga0496105_0101235_16_1392 | 401 |
| 2 | 3300006914 | Ga0075436_100022508 | Ga0075436_1000225084 | 469 |
| 3 | 3300048910 | Ga0496107_0109818 | Ga0496107_0109818_35_1723 | 469 |
| 4 | 3300048911 | Ga0496108_0065396 | Ga0496108_0065396_492_2180 | 469 |
| 5 | 3300048912 | Ga0496109_0051665 | Ga0496109_0051665_1686_3374 | 469 |
| 6 | 3300048913 | Ga0496110_0056554 | Ga0496110_0056554_776_2464 | 469 |
| 7 | 3300048914 | Ga0496111_0009448 | Ga0496111_0009448_620_2308 | 469 |
| 8 | 3300031456 | Ga0307513_10022546 | Ga0307513_100225463 | 471 |
| 9 | 3300006038 | Ga0075365_10006008 | Ga0075365_100060084 | 490 |
| 10 | 3300050492 | nmdc:mga0yw44_55744_c1 | nmdc:mga0yw44_55744_c1_236_1894 | 490 |
| 11 | 3300025986 | Ga0207658_10007759 | Ga0207658_100077592 | 499 |
| 12 | 3300005456 | Ga0070678_100048187 | Ga0070678_1000481873 | 500 |
| 13 | 3300005543 | Ga0070672_100036676 | Ga0070672_1000366764 | 500 |
| 14 | 3300025981 | Ga0207640_10081093 | Ga0207640_100810932 | 500 |
| 15 | 3300026067 | Ga0207678_10066725 | Ga0207678_100667252 | 500 |
| 16 | 3300026121 | Ga0207683_10054358 | Ga0207683_100543582 | 500 |
| 17 | 3300028379 | Ga0268266_10153766 | Ga0268266_101537661 | 500 |
| 18 | 3300006195 | Ga0075366_10009622 | Ga0075366_100096224 | 501 |
| 19 | 3300039447 | Ga0436361_0406743 | Ga0436361_0406743_339_1925 | 501 |
| 20 | 3300049704 | Ga0501221_001061 | Ga0501221_001061_2813_4486 | 501 |
| 21 | 3300037471 | Ga0395905_0004910 | Ga0395905_0004910_1835_3388 | 502 |
| 22 | 3300049571 | Ga0501034_0031433 | Ga0501034_0031433_1373_3082 | 502 |
| 23 | 3300026088 | Ga0207641_10111619 | Ga0207641_101116192 | 503 |
| 24 | 3300017792 | Ga0163161_10085969 | Ga0163161_100859692 | 504 |
| 25 | 3300005331 | Ga0070670_100018231 | Ga0070670_1000182313 | 509 |
| 26 | 3300005364 | Ga0070673_100123037 | Ga0070673_1001230372 | 509 |
| 27 | 3300005618 | Ga0068864_100180326 | Ga0068864_1001803261 | 509 |
| 28 | 3300025925 | Ga0207650_10016290 | Ga0207650_100162903 | 509 |
| 29 | 3300042126 | Ga0450888_000023 | Ga0450888_000023_770_2377 | 509 |
| 30 | 3300042127 | Ga0450890_001554 | Ga0450890_001554_703_2310 | 509 |
| 31 | 3300042129 | Ga0450891_000928 | Ga0450891_000928_1131_2738 | 509 |
| 32 | 3300042532 | Ga0450893_0002199 | Ga0450893_0002199_1228_2835 | 509 |
| 33 | 3300049571 | Ga0501034_0136873 | Ga0501034_0136873_319_1977 | 509 |
| 34 | 3300025304 | Ga0209257_1019201 | Ga0209257_10192012 | 510 |
| 35 | 3300003792 | Ga0055540_1003166 | Ga0055540_10031667 | 511 |
| 36 | 3300003794 | Ga0055531_10000689 | Ga0055531_1000068917 | 511 |
| 37 | 3300025273 | Ga0209673_1016568 | Ga0209673_10165682 | 511 |
| 38 | 3300025303 | Ga0209051_1000623 | Ga0209051_100062317 | 511 |
| 39 | 3300025304 | Ga0209257_1000096 | Ga0209257_1000096194 | 511 |
| 40 | 3300037312 | Ga0395899_0002930 | Ga0395899_0002930_845_2431 | 512 |
| 41 | 3300037466 | Ga0395898_0003443 | Ga0395898_0003443_13488_15074 | 512 |
| 42 | 3300037471 | Ga0395905_0025821 | Ga0395905_0025821_2095_3681 | 512 |
| 43 | 3300038443 | Ga0395901_0023478 | Ga0395901_0023478_4562_6148 | 512 |
| 44 | 3300044656 | Ga0466969_0023951 | Ga0466969_0023951_1079_2665 | 512 |
| 45 | 3300044842 | Ga0466957_0098238 | Ga0466957_0098238_139_1725 | 512 |
| 46 | 3300013306 | Ga0163162_10203866 | Ga0163162_102038662 | 513 |
| 47 | 3300049568 | Ga0501031_0014091 | Ga0501031_0014091_2568_4238 | 513 |
| 48 | 3300031548 | Ga0307408_100058905 | Ga0307408_1000589051 | 514 |
| 49 | 3300047443 | Ga0495687_004808 | Ga0495687_004808_1883_3577 | 514 |
| 50 | 3300053134 | Ga0500658_0005470 | Ga0500658_0005470_994_2688 | 514 |
| 51 | 3300005457 | Ga0070662_100022654 | Ga0070662_1000226544 | 515 |
| 52 | iso_pu_bacteria | 2585428057 | 2587729952 | 515 |
| 53 | iso_pu_bacteria | 2585428058 | 2587734337 | 515 |
| 54 | 3300003316 | rootH1_10012249 | rootH1_100122491 | 516 |
| 55 | 3300003322 | rootL2_10028489 | rootL2_100284893 | 516 |
| 56 | 3300032002 | Ga0307416_100098537 | Ga0307416_1000985372 | 516 |
| 57 | 3300045051 | Ga0451576_0081171 | Ga0451576_0081171_1287_2966 | 516 |
| 58 | 3300050512 | nmdc:mga0n895_113719_c1 | nmdc:mga0n895_113719_c1_817_2496 | 516 |
| 59 | 3300005327 | Ga0070658_10114379 | Ga0070658_101143792 | 517 |
| 60 | 3300003347 | JGI26128J50194_1000269 | JGI26128J50194_10002692 | 519 |
| 61 | 3300005459 | Ga0068867_100000173 | Ga0068867_10000017335 | 519 |
| 62 | 3300006195 | Ga0075366_10019939 | Ga0075366_100199393 | 519 |
| 63 | 3300009148 | Ga0105243_10004078 | Ga0105243_100040786 | 519 |
| 64 | 3300009177 | Ga0105248_10002855 | Ga0105248_1000285514 | 519 |
| 65 | 3300014745 | Ga0157377_10000039 | Ga0157377_1000003972 | 519 |
| 66 | 3300025935 | Ga0207709_10002451 | Ga0207709_100024516 | 519 |
| 67 | 3300025938 | Ga0207704_10021744 | Ga0207704_100217443 | 519 |
| 68 | 3300026095 | Ga0207676_10113119 | Ga0207676_101131192 | 519 |
| 69 | 3300038443 | Ga0395901_0066417 | Ga0395901_0066417_629_2251 | 519 |
| 70 | 3300041456 | Ga0451795_0115068 | Ga0451795_0115068_461_2083 | 519 |
| 71 | 3300046460 | Ga0495638_0048013 | Ga0495638_0048013_185_1807 | 519 |
| 72 | 3300046519 | Ga0495632_0009191 | Ga0495632_0009191_182_1804 | 519 |
| 73 | 3300048915 | Ga0496112_0090915 | Ga0496112_0090915_36_1652 | 519 |
| 74 | 3300048916 | Ga0496113_0048044 | Ga0496113_0048044_1399_3015 | 519 |
| 75 | 3300053093 | Ga0500651_0002096 | Ga0500651_0002096_8510_10132 | 519 |
| 76 | 3300053129 | Ga0500628_003232 | Ga0500628_003232_458_2080 | 519 |
| 77 | 3300053130 | Ga0500642_0019678 | Ga0500642_0019678_356_1978 | 519 |
| 78 | 3300053131 | Ga0500652_002227 | Ga0500652_002227_3596_5236 | 519 |
| 79 | 3300053133 | Ga0500655_002128 | Ga0500655_002128_1785_3407 | 519 |
| 80 | 3300053156 | Ga0500622_0000262 | Ga0500622_0000262_20408_22030 | 519 |
| 81 | 3300026078 | Ga0207702_10098998 | Ga0207702_100989982 | 520 |
| 82 | 3300028794 | Ga0307515_10000030 | Ga0307515_1000003062 | 520 |
| 83 | 3300031730 | Ga0307516_10056116 | Ga0307516_100561163 | 520 |
| 84 | iso_pu_bacteria | 2932422444 | 2932424828 | 520 |
| 85 | 3300025933 | Ga0207706_10112439 | Ga0207706_101124392 | 521 |
| 86 | 3300031730 | Ga0307516_10034293 | Ga0307516_100342934 | 521 |
| 87 | iso_pu_bacteria | 2919704043 | 2919704192 | 521 |
| 88 | 3300006048 | Ga0075363_100013438 | Ga0075363_1000134383 | 522 |
| 89 | 3300006177 | Ga0075362_10005956 | Ga0075362_100059562 | 522 |
| 90 | 3300006186 | Ga0075369_10001253 | Ga0075369_100012537 | 522 |
| 91 | 3300050489 | nmdc:mga03683_2112_c1 | nmdc:mga03683_2112_c1_795_2489 | 522 |
| 92 | 3300050493 | nmdc:mga0k408_10394_c1 | nmdc:mga0k408_10394_c1_1807_3501 | 522 |
| 93 | 3300050494 | nmdc:mga06z11_23057_c1 | nmdc:mga06z11_23057_c1_52_1746 | 522 |
| 94 | 3300050496 | nmdc:mga07m45_13822_c1 | nmdc:mga07m45_13822_c1_792_2486 | 522 |
| 95 | 3300050516 | nmdc:mga0sz30_14572_c1 | nmdc:mga0sz30_14572_c1_979_2673 | 522 |
| 96 | 3300025893 | Ga0207682_10010792 | Ga0207682_100107922 | 523 |
| 97 | 3300044684 | Ga0466966_0017527 | Ga0466966_0017527_657_2342 | 523 |
| 98 | 3300025981 | Ga0207640_10061804 | Ga0207640_100618043 | 524 |
| 99 | 3300026121 | Ga0207683_10115581 | Ga0207683_101155813 | 524 |
| 100 | 3300031250 | Ga0265331_10010604 | Ga0265331_100106043 | 524 |
| 101 | 3300003215 | JGI25153J46596_10002983 | JGI25153J46596_100029834 | 525 |
| 102 | 3300005564 | Ga0070664_100037163 | Ga0070664_1000371634 | 525 |
| 103 | 3300006195 | Ga0075366_10002337 | Ga0075366_100023373 | 525 |
| 104 | 3300006353 | Ga0075370_10000149 | Ga0075370_100001498 | 525 |
| 105 | 3300025297 | Ga0209758_1000096 | Ga0209758_100009629 | 525 |
| 106 | 3300046471 | Ga0495650_0001967 | Ga0495650_0001967_2266_3957 | 525 |
| 107 | 3300050493 | nmdc:mga0k408_19608_c1 | nmdc:mga0k408_19608_c1_1038_2759 | 525 |
| 108 | 3300050496 | nmdc:mga07m45_1712_c1 | nmdc:mga07m45_1712_c1_1728_3449 | 525 |
| 109 | 3300026118 | Ga0207675_100129660 | Ga0207675_1001296601 | 526 |
| 110 | 3300037471 | Ga0395905_0044726 | Ga0395905_0044726_2344_3987 | 526 |
| 111 | 3300039437 | Ga0436365_1305172 | Ga0436365_1305172_1823_3619 | 526 |
| 112 | 3300039447 | Ga0436361_0231720 | Ga0436361_0231720_17510_19165 | 526 |
| 113 | iso_pu_bacteria | 2643221639 | 2644217282 | 526 |
| 114 | iso_pu_bacteria | 2643221646 | 2644258947 | 526 |
| 115 | iso_pu_bacteria | 2643221585 | 2643933139 | 527 |
| 116 | iso_pu_bacteria | 2643221656 | 2644314388 | 527 |
| 117 | 3300028794 | Ga0307515_10047036 | Ga0307515_100470363 | 528 |
| 118 | 3300037471 | Ga0395905_0005270 | Ga0395905_0005270_5172_6818 | 528 |
| 119 | 3300044656 | Ga0466969_0008460 | Ga0466969_0008460_2763_4454 | 528 |
| 120 | 3300045051 | Ga0451576_0145579 | Ga0451576_0145579_340_2013 | 528 |
| 121 | 3300049662 | Ga0501222_000510 | Ga0501222_000510_489_2162 | 528 |
| 122 | 3300049705 | Ga0501225_0014194 | Ga0501225_0014194_17_1690 | 528 |
| 123 | 3300053108 | Ga0500562_004096 | Ga0500562_004096_975_2657 | 528 |
| 124 | 3300053153 | Ga0500616_0036986 | Ga0500616_0036986_80_1762 | 528 |
| 125 | 3300003794 | Ga0055531_10000317 | Ga0055531_1000031748 | 529 |
| 126 | 3300025298 | Ga0209050_1007741 | Ga0209050_10077414 | 529 |
| 127 | 3300025303 | Ga0209051_1017618 | Ga0209051_10176182 | 529 |
| 128 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021539 | 529 |
| 129 | 3300031711 | Ga0265314_10001279 | Ga0265314_1000127924 | 529 |
| 130 | 3300031730 | Ga0307516_10142130 | Ga0307516_101421302 | 529 |
| 131 | 3300037471 | Ga0395905_0000043 | Ga0395905_0000043_225771_227552 | 529 |
| 132 | 3300044656 | Ga0466969_0045789 | Ga0466969_0045789_447_2144 | 529 |
| 133 | 3300044693 | Ga0466961_0018498 | Ga0466961_0018498_609_2306 | 529 |
| 134 | 3300044719 | Ga0466971_0010738 | Ga0466971_0010738_179_1876 | 529 |
| 135 | 3300045049 | Ga0466959_0000287 | Ga0466959_0000287_582_2279 | 529 |
| 136 | 3300045051 | Ga0451576_0116344 | Ga0451576_0116344_855_2507 | 529 |
| 137 | 3300045976 | Ga0466967_0005385 | Ga0466967_0005385_469_2166 | 529 |
| 138 | 3300061719 | Ga0466962_0005485 | Ga0466962_0005485_2394_4091 | 529 |
| 139 | 3300005331 | Ga0070670_100049189 | Ga0070670_1000491892 | 530 |
| 140 | 3300005354 | Ga0070675_100097613 | Ga0070675_1000976132 | 530 |
| 141 | 3300006038 | Ga0075365_10013130 | Ga0075365_100131305 | 530 |
| 142 | 3300006195 | Ga0075366_10001659 | Ga0075366_100016592 | 530 |
| 143 | 3300006353 | Ga0075370_10014437 | Ga0075370_100144374 | 530 |
| 144 | 3300050496 | nmdc:mga07m45_11143_c1 | nmdc:mga07m45_11143_c1_2505_4193 | 530 |
| 145 | 3300005563 | Ga0068855_100039716 | Ga0068855_1000397163 | 531 |
| 146 | 3300025949 | Ga0207667_10024645 | Ga0207667_100246453 | 531 |
| 147 | 3300005842 | Ga0068858_100005381 | Ga0068858_1000053818 | 532 |
| 148 | 3300009176 | Ga0105242_10008320 | Ga0105242_100083207 | 532 |
| 149 | 3300009551 | Ga0105238_10040770 | Ga0105238_100407703 | 532 |
| 150 | 3300013306 | Ga0163162_10013510 | Ga0163162_100135105 | 532 |
| 151 | 3300025934 | Ga0207686_10002776 | Ga0207686_100027767 | 532 |
| 152 | 3300025941 | Ga0207711_10011504 | Ga0207711_100115043 | 532 |
| 153 | 3300026035 | Ga0207703_10008991 | Ga0207703_100089916 | 532 |
| 154 | 3300005445 | Ga0070708_100029828 | Ga0070708_1000298285 | 533 |
| 155 | 3300005616 | Ga0068852_100085711 | Ga0068852_1000857112 | 533 |
| 156 | 3300006195 | Ga0075366_10016279 | Ga0075366_100162792 | 533 |
| 157 | 3300006353 | Ga0075370_10004405 | Ga0075370_100044053 | 533 |
| 158 | 3300009147 | Ga0114129_10033373 | Ga0114129_100333733 | 533 |
| 159 | 3300014968 | Ga0157379_10030241 | Ga0157379_100302412 | 533 |
| 160 | 3300050507 | nmdc:mga05p37_91905_c1 | nmdc:mga05p37_91905_c1_1091_2746 | 533 |
| 161 | 3300005457 | Ga0070662_100034822 | Ga0070662_1000348223 | 534 |
| 162 | 3300006880 | Ga0075429_100000370 | Ga0075429_1000003709 | 534 |
| 163 | 3300044658 | Ga0466972_0005453 | Ga0466972_0005453_2910_4571 | 534 |
| 164 | 3300050508 | nmdc:mga09592_1991_c1 | nmdc:mga09592_1991_c1_2007_3737 | 534 |
| 165 | 3300005441 | Ga0070700_100077012 | Ga0070700_1000770122 | 535 |
| 166 | 3300011119 | Ga0105246_10056645 | Ga0105246_100566452 | 535 |
| 167 | 3300021361 | Ga0213872_10000396 | Ga0213872_1000039618 | 536 |
| 168 | 3300030521 | Ga0307511_10000248 | Ga0307511_100002486 | 536 |
| 169 | 3300039447 | Ga0436361_0908337 | Ga0436361_0908337_22011_23720 | 536 |
| 170 | 3300042876 | Ga0451577_0082841 | Ga0451577_0082841_228_1901 | 536 |
| 171 | 3300044658 | Ga0466972_0000037 | Ga0466972_0000037_30004_31707 | 536 |
| 172 | 3300044683 | Ga0466965_0012886 | Ga0466965_0012886_1389_3083 | 536 |
| 173 | 3300044706 | Ga0466964_0003346 | Ga0466964_0003346_1157_2851 | 536 |
| 174 | 3300044706 | Ga0466964_0009412 | Ga0466964_0009412_1301_3004 | 536 |
| 175 | 3300044712 | Ga0453684_0052822 | Ga0453684_0052822_1266_2939 | 536 |
| 176 | 3300053092 | Ga0500583_0002675 | Ga0500583_0002675_307_2058 | 536 |
| 177 | 3300053151 | Ga0500604_0010157 | Ga0500604_0010157_415_2181 | 536 |
| 178 | 3300005455 | Ga0070663_100010855 | Ga0070663_1000108553 | 537 |
| 179 | 3300005457 | Ga0070662_100009364 | Ga0070662_1000093642 | 537 |
| 180 | 3300005616 | Ga0068852_100109174 | Ga0068852_1001091742 | 537 |
| 181 | 3300005842 | Ga0068858_100010293 | Ga0068858_1000102936 | 537 |
| 182 | 3300006177 | Ga0075362_10003562 | Ga0075362_100035622 | 537 |
| 183 | 3300006178 | Ga0075367_10028188 | Ga0075367_100281882 | 537 |
| 184 | 3300009545 | Ga0105237_10011185 | Ga0105237_100111857 | 537 |
| 185 | 3300010375 | Ga0105239_10111921 | Ga0105239_101119212 | 537 |
| 186 | 3300014968 | Ga0157379_10041630 | Ga0157379_100416302 | 537 |
| 187 | 3300025298 | Ga0209050_1001442 | Ga0209050_100144219 | 537 |
| 188 | 3300025914 | Ga0207671_10030403 | Ga0207671_100304033 | 537 |
| 189 | 3300025942 | Ga0207689_10017421 | Ga0207689_100174212 | 537 |
| 190 | 3300026035 | Ga0207703_10007009 | Ga0207703_100070096 | 537 |
| 191 | 3300026067 | Ga0207678_10012730 | Ga0207678_100127302 | 537 |
| 192 | 3300044656 | Ga0466969_0000017 | Ga0466969_0000017_89747_91423 | 537 |
| 193 | 3300044684 | Ga0466966_0005449 | Ga0466966_0005449_264_1967 | 537 |
| 194 | 3300044684 | Ga0466966_0028971 | Ga0466966_0028971_1731_3407 | 537 |
| 195 | 3300046542 | Ga0495597_0018294 | Ga0495597_0018294_504_2192 | 537 |
| 196 | 3300047443 | Ga0495687_002581 | Ga0495687_002581_11357_13045 | 537 |
| 197 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_154036_155721 | 537 |
| 198 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_154025_155710 | 537 |
| 199 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_154083_155768 | 537 |
| 200 | 3300049582 | Ga0501048_0001661 | Ga0501048_0001661_11126_12811 | 537 |
| 201 | 3300049824 | Ga0501045_0009763 | Ga0501045_0009763_1737_3422 | 537 |
| 202 | 3300050491 | nmdc:mga00v17_11265_c1 | nmdc:mga00v17_11265_c1_2976_4664 | 537 |
| 203 | 3300050493 | nmdc:mga0k408_5664_c1 | nmdc:mga0k408_5664_c1_3642_5330 | 537 |
| 204 | 3300006195 | Ga0075366_10001289 | Ga0075366_100012895 | 538 |
| 205 | 3300025940 | Ga0207691_10116412 | Ga0207691_101164122 | 538 |
| 206 | 3300026121 | Ga0207683_10014082 | Ga0207683_100140828 | 538 |
| 207 | 3300027526 | Ga0209968_1000782 | Ga0209968_10007822 | 538 |
| 208 | 3300027695 | Ga0209966_1000001 | Ga0209966_100000187 | 538 |
| 209 | 3300031730 | Ga0307516_10018878 | Ga0307516_100188788 | 538 |
| 210 | 3300037312 | Ga0395899_0000723 | Ga0395899_0000723_26441_28162 | 538 |
| 211 | 3300046457 | Ga0495590_0008551 | Ga0495590_0008551_942_2648 | 538 |
| 212 | 3300053154 | Ga0500619_000479 | Ga0500619_000479_2309_3997 | 538 |
| 213 | 3300005339 | Ga0070660_100060521 | Ga0070660_1000605212 | 539 |
| 214 | 3300005344 | Ga0070661_100011920 | Ga0070661_1000119205 | 539 |
| 215 | 3300005366 | Ga0070659_100001144 | Ga0070659_1000011444 | 539 |
| 216 | 3300005564 | Ga0070664_100035443 | Ga0070664_1000354434 | 539 |
| 217 | 3300009093 | Ga0105240_10002442 | Ga0105240_100024422 | 539 |
| 218 | 3300009545 | Ga0105237_10001836 | Ga0105237_1000183612 | 539 |
| 219 | 3300010375 | Ga0105239_10001156 | Ga0105239_1000115615 | 539 |
| 220 | 3300025919 | Ga0207657_10069730 | Ga0207657_100697302 | 539 |
| 221 | 3300025932 | Ga0207690_10003338 | Ga0207690_100033382 | 539 |
| 222 | 3300025945 | Ga0207679_10003068 | Ga0207679_100030686 | 539 |
| 223 | 3300031730 | Ga0307516_10000678 | Ga0307516_1000067827 | 539 |
| 224 | 3300042531 | Ga0450918_000669 | Ga0450918_000669_2830_4521 | 539 |
| 225 | 3300048905 | Ga0496102_0011887 | Ga0496102_0011887_984_2675 | 539 |
| 226 | 3300053117 | Ga0500593_000715 | Ga0500593_000715_9087_10778 | 539 |
| 227 | iso_pu_bacteria | 2643221644 | 2644247558 | 539 |
| 228 | 3300005459 | Ga0068867_100000215 | Ga0068867_10000021527 | 540 |
| 229 | 3300005719 | Ga0068861_100001372 | Ga0068861_1000013724 | 540 |
| 230 | 3300005843 | Ga0068860_100001625 | Ga0068860_10000162519 | 540 |
| 231 | 3300005844 | Ga0068862_100081186 | Ga0068862_1000811863 | 540 |
| 232 | 3300009148 | Ga0105243_10016078 | Ga0105243_100160782 | 540 |
| 233 | 3300013297 | Ga0157378_10006233 | Ga0157378_100062334 | 540 |
| 234 | 3300013306 | Ga0163162_10000655 | Ga0163162_100006556 | 540 |
| 235 | 3300013308 | Ga0157375_10014204 | Ga0157375_100142043 | 540 |
| 236 | 3300014326 | Ga0157380_10021378 | Ga0157380_100213784 | 540 |
| 237 | 3300025914 | Ga0207671_10005755 | Ga0207671_100057559 | 540 |
| 238 | 3300025923 | Ga0207681_10048946 | Ga0207681_100489462 | 540 |
| 239 | 3300026089 | Ga0207648_10000579 | Ga0207648_1000057933 | 540 |
| 240 | 3300026118 | Ga0207675_100001767 | Ga0207675_10000176710 | 540 |
| 241 | 3300028381 | Ga0268264_10006569 | Ga0268264_100065694 | 540 |
| 242 | 3300046660 | Ga0495625_0026151 | Ga0495625_0026151_1643_3334 | 540 |
| 243 | 3300003320 | rootH2_10042226 | rootH2_100422262 | 541 |
| 244 | 3300005295 | Ga0065707_10085323 | Ga0065707_100853233 | 541 |
| 245 | 3300005328 | Ga0070676_10053941 | Ga0070676_100539412 | 541 |
| 246 | 3300005331 | Ga0070670_100010647 | Ga0070670_1000106473 | 541 |
| 247 | 3300005333 | Ga0070677_10005676 | Ga0070677_100056762 | 541 |
| 248 | 3300005353 | Ga0070669_100036240 | Ga0070669_1000362402 | 541 |
| 249 | 3300005354 | Ga0070675_100024595 | Ga0070675_1000245953 | 541 |
| 250 | 3300005355 | Ga0070671_100038907 | Ga0070671_1000389072 | 541 |
| 251 | 3300005356 | Ga0070674_100015515 | Ga0070674_1000155153 | 541 |
| 252 | 3300005364 | Ga0070673_100002488 | Ga0070673_1000024886 | 541 |
| 253 | 3300005367 | Ga0070667_100092376 | Ga0070667_1000923762 | 541 |
| 254 | 3300005456 | Ga0070678_100007079 | Ga0070678_1000070795 | 541 |
| 255 | 3300005458 | Ga0070681_10025504 | Ga0070681_100255044 | 541 |
| 256 | 3300005459 | Ga0068867_100003075 | Ga0068867_1000030754 | 541 |
| 257 | 3300005459 | Ga0068867_100015395 | Ga0068867_1000153955 | 541 |
| 258 | 3300005459 | Ga0068867_100050769 | Ga0068867_1000507692 | 541 |
| 259 | 3300005543 | Ga0070672_100037799 | Ga0070672_1000377993 | 541 |
| 260 | 3300009148 | Ga0105243_10051644 | Ga0105243_100516442 | 541 |
| 261 | 3300025315 | Ga0207697_10022202 | Ga0207697_100222022 | 541 |
| 262 | 3300025893 | Ga0207682_10001087 | Ga0207682_1000108710 | 541 |
| 263 | 3300025923 | Ga0207681_10031269 | Ga0207681_100312693 | 541 |
| 264 | 3300025925 | Ga0207650_10000607 | Ga0207650_100006077 | 541 |
| 265 | 3300025926 | Ga0207659_10001209 | Ga0207659_100012093 | 541 |
| 266 | 3300025931 | Ga0207644_10014040 | Ga0207644_100140403 | 541 |
| 267 | 3300025931 | Ga0207644_10092359 | Ga0207644_100923592 | 541 |
| 268 | 3300025937 | Ga0207669_10004742 | Ga0207669_100047422 | 541 |
| 269 | 3300025940 | Ga0207691_10001758 | Ga0207691_1000175810 | 541 |
| 270 | 3300025960 | Ga0207651_10001705 | Ga0207651_100017056 | 541 |
| 271 | 3300025986 | Ga0207658_10133591 | Ga0207658_101335912 | 541 |
| 272 | 3300026088 | Ga0207641_10114024 | Ga0207641_101140242 | 541 |
| 273 | 3300026089 | Ga0207648_10002224 | Ga0207648_100022244 | 541 |
| 274 | 3300026089 | Ga0207648_10008629 | Ga0207648_100086293 | 541 |
| 275 | 3300026089 | Ga0207648_10031445 | Ga0207648_100314453 | 541 |
| 276 | 3300026121 | Ga0207683_10010683 | Ga0207683_100106837 | 541 |
| 277 | 3300037068 | Ga0373925_0013001 | Ga0373925_0013001_4164_5855 | 541 |
| 278 | 3300005844 | Ga0068862_100079078 | Ga0068862_1000790782 | 542 |
| 279 | 3300006195 | Ga0075366_10051298 | Ga0075366_100512983 | 542 |
| 280 | 3300009551 | Ga0105238_10101988 | Ga0105238_101019882 | 543 |
| 281 | 3300026116 | Ga0207674_10137315 | Ga0207674_101373151 | 543 |
| 282 | 3300038443 | Ga0395901_0001967 | Ga0395901_0001967_17372_19048 | 543 |
| 283 | 3300050496 | nmdc:mga07m45_9028_c1 | nmdc:mga07m45_9028_c1_2352_4031 | 544 |
| 284 | 3300021361 | Ga0213872_10000012 | Ga0213872_10000012130 | 545 |
| 285 | 3300039447 | Ga0436361_0351372 | Ga0436361_0351372_157480_159195 | 545 |
| 286 | 3300002705 | JGI25156J39149_1000772 | JGI25156J39149_100077218 | 546 |
| 287 | 3300002705 | JGI25156J39149_1001157 | JGI25156J39149_100115711 | 546 |
| 288 | 3300002741 | JGI25157J39369_1000095 | JGI25157J39369_10000952 | 546 |
| 289 | 3300005563 | Ga0068855_100089253 | Ga0068855_1000892531 | 546 |
| 290 | 3300005577 | Ga0068857_100000469 | Ga0068857_10000046918 | 546 |
| 291 | 3300005578 | Ga0068854_100066942 | Ga0068854_1000669422 | 546 |
| 292 | 3300005614 | Ga0068856_100001938 | Ga0068856_10000193815 | 546 |
| 293 | 3300009093 | Ga0105240_10016534 | Ga0105240_100165344 | 546 |
| 294 | 3300013105 | Ga0157369_10043816 | Ga0157369_100438163 | 546 |
| 295 | 3300025242 | Ga0209258_100664 | Ga0209258_1006645 | 546 |
| 296 | 3300025246 | Ga0209646_1000124 | Ga0209646_1000124107 | 546 |
| 297 | 3300025250 | Ga0209026_1000085 | Ga0209026_1000085107 | 546 |
| 298 | 3300025253 | Ga0209677_101683 | Ga0209677_1016832 | 546 |
| 299 | 3300025256 | Ga0209759_1000068 | Ga0209759_1000068105 | 546 |
| 300 | 3300025303 | Ga0209051_1001697 | Ga0209051_10016974 | 546 |
| 301 | 3300025913 | Ga0207695_10036340 | Ga0207695_100363403 | 546 |
| 302 | 3300026078 | Ga0207702_10000235 | Ga0207702_1000023551 | 546 |
| 303 | 3300026116 | Ga0207674_10005437 | Ga0207674_100054379 | 546 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ki1-assembly1.cif.gz_A | the transmembrane domain of a cyanobacterium bicarbonate transporter bica | 0.8707 | 18 | 416 |
| 6ki1-assembly2.cif.gz_B | the transmembrane domain of a cyanobacterium bicarbonate transporter bica | 0.8607 | 18 | 417 |
| 5iof-assembly1.cif.gz_A | structure of the transmembrane domain of the transporter slc26dg | 0.8524 | 18 | 420 |
| 6ki1-assembly1.cif.gz_A | the transmembrane domain of a cyanobacterium bicarbonate transporter bica | 0.8493 | 18 | 416 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.8467 | 424 | 543 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3if5A02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8535 | 422 | 504 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8446 | 425 | 543 | 3.30.750.24 |
| af_Q80ZD3_447_566_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8375 | 419 | 543 | 3.30.750.24 |
| af_A0A1D8PRZ2_628_764_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8341 | 438 | 541 | 3.30.750.24 |
| af_Q62273_548_723_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8331 | 430 | 541 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6N916-F1-model_v4 | Sodium-independent anion transporter | 0.9716 | 7 | 376 |
GO:0016020
GO:0055085 |
| AF-A0A2V6N916-F1-model_v4 | Sodium-independent anion transporter | 0.9581 | 7 | 376 |
GO:0016020
GO:0055085 |
| AF-A0A519I993-F1-model_v4 | deleted | 0.957 | 2 | 397 |
|
| AF-A0A2N3FH54-F1-model_v4 | Sodium-independent anion transporter | 0.9519 | 8 | 331 |
GO:0016020
GO:0055085 |
| AF-A0A2N3FH54-F1-model_v4 | Sodium-independent anion transporter | 0.9459 | 8 | 331 |
GO:0016020
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar