F396575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 207 | 604 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300031903|Ga0307407_10155180|Ga0307407_101551802 |
| Length | 387 |
| Sequence | MVAANAWFGNTGAKPSDSGHSERQADMSGEKRIGILTSGGDCAGLNAVIRAVVHRATLTYGWQVIGVKEGTMGLLSRPVQYEVLDLDMVGSSMMRQGGTILGTTNKGNPFAFPMSDGTIKDRSAEIAGGYRELGLDALIGIGGDGSFAILRKLAQQCGINLVGVPKTIDNDLGLTEASIGFDTAVGVATEALDRLQPTAASHARVMVLEVMGRDAGHIAIAAGIAGGADVILIPEIPFSMDRIAAKIHQVRQQGRNFALVVVSEAVKTSEGKEIQKEYLGGEKRFGGIGNYIGEEIANVTGAETRVTVLGHVQRGSMPSPRDRLIASAFGVHAVDLIAEGKFDRMVAWSNREVIDVSIEDAIARYQAVELDGAMVRTARGLGICLGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 31 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 35 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 40 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 41 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 49 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 50 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 74 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 77 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 82 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 88 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 89 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 92 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 95 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 106 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 107 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 108 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 134 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 137 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 138 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 139 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 140 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 167 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 175 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 176 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 177 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 178 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 179 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 180 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 181 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 182 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 183 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 187 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 188 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 189 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 190 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 191 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 192 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 193 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 194 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 195 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 196 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 197 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 198 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 199 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 200 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 201 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 202 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 203 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 204 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 205 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 206 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 207 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.72 |
| Metatranscriptomes | 0 |
| Isolates | 7.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.27 |
| Nodule | 0.33 |
| Rhizoplane | 1.32 |
| Rhizosphere | 80.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307407_10155180 | 3300031903 | Bacteria | 1492 |
| 2 | JGI25151J46595_10000429 | 3300003187 | Bacteria | 41718 |
| 3 | Ga0070658_10045599 | 3300005327 | Bacteria | 3545 |
| 4 | Ga0070676_10184381 | 3300005328 | Bacteria | 1359 |
| 5 | Ga0070680_100009845 | 3300005336 | Bacteria | 7356 |
| 6 | Ga0070661_100122133 | 3300005344 | Bacteria | 1952 |
| 7 | Ga0070673_100145681 | 3300005364 | Bacteria | 2002 |
| 8 | Ga0070709_10016319 | 3300005434 | Bacteria | 4237 |
| 9 | Ga0070713_100059335 | 3300005436 | Bacteria | 3195 |
| 10 | Ga0070713_100134481 | 3300005436 | Bacteria | 2183 |
| 11 | Ga0070678_100028763 | 3300005456 | Bacteria | 3796 |
| 12 | Ga0070681_10059005 | 3300005458 | Bacteria | 3816 |
| 13 | Ga0070681_10086428 | 3300005458 | Bacteria | 3089 |
| 14 | Ga0070681_10215582 | 3300005458 | Bacteria | 1836 |
| 15 | Ga0070698_100015674 | 3300005471 | Bacteria | 8005 |
| 16 | Ga0070679_100023309 | 3300005530 | Bacteria | 6057 |
| 17 | Ga0070679_100033943 | 3300005530 | Bacteria | 5055 |
| 18 | Ga0070684_100066746 | 3300005535 | Bacteria | 3158 |
| 19 | Ga0070684_100381103 | 3300005535 | Bacteria | 1299 |
| 20 | Ga0070696_100319667 | 3300005546 | Bacteria | 1194 |
| 21 | Ga0070665_100056803 | 3300005548 | Bacteria | 3924 |
| 22 | Ga0070665_100074384 | 3300005548 | Bacteria | 3403 |
| 23 | Ga0070665_100159063 | 3300005548 | Bacteria | 2261 |
| 24 | Ga0070704_100009314 | 3300005549 | Bacteria | 5924 |
| 25 | Ga0070664_100101817 | 3300005564 | Bacteria | 2498 |
| 26 | Ga0068857_100068246 | 3300005577 | Bacteria | 3165 |
| 27 | Ga0068856_100101135 | 3300005614 | Bacteria | 2875 |
| 28 | Ga0068852_100043581 | 3300005616 | Bacteria | 3806 |
| 29 | Ga0068860_100069663 | 3300005843 | Bacteria | 3343 |
| 30 | Ga0081455_10001785 | 3300005937 | Bacteria | 25987 |
| 31 | Ga0081455_10016775 | 3300005937 | Bacteria | 7048 |
| 32 | Ga0081455_10034817 | 3300005937 | Bacteria | 4508 |
| 33 | Ga0081455_10036626 | 3300005937 | Bacteria | 4365 |
| 34 | Ga0081538_10012647 | 3300005981 | Bacteria | 6753 |
| 35 | Ga0081538_10056007 | 3300005981 | Bacteria | 2314 |
| 36 | Ga0081538_10092885 | 3300005981 | Bacteria | 1552 |
| 37 | Ga0081539_10003999 | 3300005985 | Bacteria | 16991 |
| 38 | Ga0075365_10009886 | 3300006038 | Bacteria | 5522 |
| 39 | Ga0075365_10022570 | 3300006038 | Bacteria | 3946 |
| 40 | Ga0075365_10026705 | 3300006038 | Bacteria | 3668 |
| 41 | Ga0070716_100107282 | 3300006173 | Bacteria | 1724 |
| 42 | Ga0070712_100106876 | 3300006175 | Bacteria | 2081 |
| 43 | Ga0075362_10000825 | 3300006177 | Bacteria | 9283 |
| 44 | Ga0075362_10002178 | 3300006177 | Bacteria | 6489 |
| 45 | Ga0075367_10024126 | 3300006178 | Bacteria | 3430 |
| 46 | Ga0075369_10002924 | 3300006186 | Bacteria | 6166 |
| 47 | Ga0075369_10050283 | 3300006186 | Bacteria | 1802 |
| 48 | Ga0075431_100476008 | 3300006847 | Bacteria | 1242 |
| 49 | Ga0075434_100074424 | 3300006871 | Bacteria | 3390 |
| 50 | Ga0075429_100083311 | 3300006880 | Bacteria | 2788 |
| 51 | Ga0099795_10006826 | 3300007788 | Bacteria | 3140 |
| 52 | Ga0105240_10522021 | 3300009093 | Bacteria | 1318 |
| 53 | Ga0105243_10258784 | 3300009148 | Bacteria | 1557 |
| 54 | Ga0105238_10165663 | 3300009551 | Bacteria | 2186 |
| 55 | Ga0105033_102451 | 3300009986 | Bacteria | 1534 |
| 56 | Ga0105028_100674 | 3300009993 | Bacteria | 3614 |
| 57 | Ga0099796_10008375 | 3300010159 | Bacteria | 2754 |
| 58 | Ga0157370_10002838 | 3300013104 | Bacteria | 20711 |
| 59 | Ga0157370_10062040 | 3300013104 | Bacteria | 3546 |
| 60 | Ga0157370_10106479 | 3300013104 | Bacteria | 2624 |
| 61 | Ga0157369_10019402 | 3300013105 | Bacteria | 7607 |
| 62 | Ga0157374_10176422 | 3300013296 | Bacteria | 2086 |
| 63 | Ga0157372_10251197 | 3300013307 | Bacteria | 2053 |
| 64 | Ga0157375_10476461 | 3300013308 | Bacteria | 1413 |
| 65 | Ga0163161_10065127 | 3300017792 | Bacteria | 2659 |
| 66 | Ga0213872_10057849 | 3300021361 | Bacteria | 1755 |
| 67 | Ga0213876_10003507 | 3300021384 | Bacteria | 8952 |
| 68 | Ga0209130_1000461 | 3300025284 | Bacteria | 42274 |
| 69 | Ga0209025_1000282 | 3300025294 | Bacteria | 115627 |
| 70 | Ga0209758_1004627 | 3300025297 | Bacteria | 11282 |
| 71 | Ga0207426_1000474 | 3300025302 | Bacteria | 61569 |
| 72 | Ga0207692_10088842 | 3300025898 | Bacteria | 1671 |
| 73 | Ga0207699_10086458 | 3300025906 | Bacteria | 1958 |
| 74 | Ga0207645_10110400 | 3300025907 | Bacteria | 1780 |
| 75 | Ga0207705_10122378 | 3300025909 | Bacteria | 1932 |
| 76 | Ga0207707_10015761 | 3300025912 | Bacteria | 6589 |
| 77 | Ga0207707_10031488 | 3300025912 | Bacteria | 4641 |
| 78 | Ga0207693_10000294 | 3300025915 | Bacteria | 46423 |
| 79 | Ga0207693_10110347 | 3300025915 | Bacteria | 2157 |
| 80 | Ga0207652_10181763 | 3300025921 | Bacteria | 1890 |
| 81 | Ga0207694_10002154 | 3300025924 | Bacteria | 16172 |
| 82 | Ga0207650_10190898 | 3300025925 | Bacteria | 1637 |
| 83 | Ga0207700_10042223 | 3300025928 | Bacteria | 3342 |
| 84 | Ga0207661_10172856 | 3300025944 | Bacteria | 1882 |
| 85 | Ga0207667_10023098 | 3300025949 | Bacteria | 6851 |
| 86 | Ga0207667_10026145 | 3300025949 | Bacteria | 6381 |
| 87 | Ga0207651_10375841 | 3300025960 | Bacteria | 1203 |
| 88 | Ga0207674_10099008 | 3300026116 | Bacteria | 2898 |
| 89 | Ga0207683_10032391 | 3300026121 | Bacteria | 4541 |
| 90 | Ga0207698_10017712 | 3300026142 | Bacteria | 4841 |
| 91 | Ga0268266_10000987 | 3300028379 | Bacteria | 35837 |
| 92 | Ga0268264_10331036 | 3300028381 | Bacteria | 1443 |
| 93 | Ga0265318_10007473 | 3300028577 | Bacteria | 4938 |
| 94 | Ga0265324_10001335 | 3300029957 | Bacteria | 14406 |
| 95 | Ga0265328_10013955 | 3300031239 | Bacteria | 3171 |
| 96 | Ga0265320_10024629 | 3300031240 | Bacteria | 3180 |
| 97 | Ga0265320_10076517 | 3300031240 | Bacteria | 1568 |
| 98 | Ga0265340_10008947 | 3300031247 | Bacteria | 5395 |
| 99 | Ga0265340_10065487 | 3300031247 | Bacteria | 1730 |
| 100 | Ga0265331_10000517 | 3300031250 | Bacteria | 36007 |
| 101 | Ga0265331_10001202 | 3300031250 | Bacteria | 19515 |
| 102 | Ga0265331_10005661 | 3300031250 | Bacteria | 7507 |
| 103 | Ga0265327_10000129 | 3300031251 | Bacteria | 165504 |
| 104 | Ga0265327_10000294 | 3300031251 | Bacteria | 96710 |
| 105 | Ga0265313_10000071 | 3300031595 | Bacteria | 99087 |
| 106 | Ga0265313_10001533 | 3300031595 | Bacteria | 21492 |
| 107 | Ga0265314_10018103 | 3300031711 | Bacteria | 5506 |
| 108 | Ga0265314_10063402 | 3300031711 | Bacteria | 2507 |
| 109 | Ga0265314_10088132 | 3300031711 | Bacteria | 2027 |
| 110 | Ga0265342_10012641 | 3300031712 | Bacteria | 5711 |
| 111 | Ga0316578_10038235 | 3300031728 | Bacteria | 2767 |
| 112 | Ga0307405_10191663 | 3300031731 | Bacteria | 1477 |
| 113 | Ga0307406_10107473 | 3300031901 | Bacteria | 1913 |
| 114 | Ga0307409_100084079 | 3300031995 | Bacteria | 2583 |
| 115 | Ga0307416_100071214 | 3300032002 | Bacteria | 2887 |
| 116 | Ga0307416_100246050 | 3300032002 | Bacteria | 1737 |
| 117 | Ga0373923_0002929 | 3300035111 | Bacteria | 5371 |
| 118 | Ga0373939_0079472 | 3300035114 | Bacteria | 1086 |
| 119 | Ga0373953_0046214 | 3300035117 | Bacteria | 1747 |
| 120 | Ga0373954_0067611 | 3300035118 | Bacteria | 1693 |
| 121 | Ga0373957_0047513 | 3300035120 | Bacteria | 1633 |
| 122 | Ga0373931_0064111 | 3300035691 | Bacteria | 1988 |
| 123 | Ga0373931_0070095 | 3300035691 | Bacteria | 1912 |
| 124 | Ga0373935_0120392 | 3300035692 | Bacteria | 1753 |
| 125 | Ga0373933_0026754 | 3300035724 | Bacteria | 3315 |
| 126 | Ga0373933_0056841 | 3300035724 | Bacteria | 2350 |
| 127 | Ga0373933_0101877 | 3300035724 | Bacteria | 1782 |
| 128 | Ga0373937_0000980 | 3300036401 | Bacteria | 24218 |
| 129 | Ga0373937_0005286 | 3300036401 | Bacteria | 11030 |
| 130 | Ga0373937_0039276 | 3300036401 | Bacteria | 4313 |
| 131 | Ga0373937_0088646 | 3300036401 | Bacteria | 2864 |
| 132 | Ga0373937_0093819 | 3300036401 | Bacteria | 2783 |
| 133 | Ga0373937_0330643 | 3300036401 | Bacteria | 1442 |
| 134 | Ga0316584_0021378 | 3300036712 | Bacteria | 4702 |
| 135 | Ga0373925_0040426 | 3300037068 | Bacteria | 3453 |
| 136 | Ga0395899_0010912 | 3300037312 | Bacteria | 6962 |
| 137 | Ga0395899_0028854 | 3300037312 | Bacteria | 4176 |
| 138 | Ga0395899_0041913 | 3300037312 | Bacteria | 3419 |
| 139 | Ga0395899_0104766 | 3300037312 | Bacteria | 2038 |
| 140 | Ga0395900_0025184 | 3300037418 | Bacteria | 6091 |
| 141 | Ga0395900_0220601 | 3300037418 | Bacteria | 1911 |
| 142 | Ga0395898_0005793 | 3300037466 | Bacteria | 13289 |
| 143 | Ga0395898_0011930 | 3300037466 | Bacteria | 9001 |
| 144 | Ga0395898_0020611 | 3300037466 | Bacteria | 6696 |
| 145 | Ga0395898_0160573 | 3300037466 | Bacteria | 2150 |
| 146 | Ga0395898_0266754 | 3300037466 | Bacteria | 1633 |
| 147 | Ga0395901_0000593 | 3300038443 | Bacteria | 42246 |
| 148 | Ga0395901_0018466 | 3300038443 | Bacteria | 7118 |
| 149 | Ga0395901_0035828 | 3300038443 | Bacteria | 5127 |
| 150 | Ga0395901_0201398 | 3300038443 | Bacteria | 2087 |
| 151 | Ga0395901_0246366 | 3300038443 | Bacteria | 1863 |
| 152 | Ga0436365_0945932 | 3300039437 | Bacteria | 6313 |
| 153 | Ga0436360_0916791 | 3300039438 | Bacteria | 1164 |
| 154 | Ga0436360_1263444 | 3300039438 | Bacteria | 10816 |
| 155 | Ga0436361_0721836 | 3300039447 | Bacteria | 1865 |
| 156 | Ga0436363_0227532 | 3300039450 | Bacteria | 1631 |
| 157 | Ga0436362_0765039 | 3300039453 | Bacteria | 1709 |
| 158 | Ga0436362_0845333 | 3300039453 | Bacteria | 1564 |
| 159 | Ga0439448_0010252 | 3300042005 | Bacteria | 2774 |
| 160 | Ga0450923_012662 | 3300042125 | Bacteria | 1539 |
| 161 | Ga0451577_0097758 | 3300042876 | Bacteria | 2622 |
| 162 | Ga0451577_0180328 | 3300042876 | Bacteria | 1904 |
| 163 | Ga0453683_0021493 | 3300044673 | Bacteria | 4120 |
| 164 | Ga0466963_0020260 | 3300044694 | Bacteria | 4182 |
| 165 | Ga0453684_0000077 | 3300044712 | Bacteria | 435536 |
| 166 | Ga0453684_0000882 | 3300044712 | Bacteria | 100349 |
| 167 | Ga0453684_0008522 | 3300044712 | Bacteria | 18325 |
| 168 | Ga0453684_0009885 | 3300044712 | Bacteria | 16492 |
| 169 | Ga0453684_0054972 | 3300044712 | Bacteria | 5180 |
| 170 | Ga0453684_0227214 | 3300044712 | Bacteria | 2157 |
| 171 | Ga0453684_0366759 | 3300044712 | Bacteria | 1620 |
| 172 | Ga0453684_0478173 | 3300044712 | Bacteria | 1382 |
| 173 | Ga0451576_0000724 | 3300045051 | Bacteria | 66525 |
| 174 | Ga0451576_0001675 | 3300045051 | Bacteria | 36759 |
| 175 | Ga0451576_0001824 | 3300045051 | Bacteria | 34612 |
| 176 | Ga0451576_0004939 | 3300045051 | Bacteria | 16977 |
| 177 | Ga0451576_0196081 | 3300045051 | Bacteria | 2109 |
| 178 | Ga0451576_0476169 | 3300045051 | Bacteria | 1311 |
| 179 | Ga0466967_0144238 | 3300045976 | Bacteria | 2220 |
| 180 | Ga0495592_0129050 | 3300046454 | Bacteria | 1770 |
| 181 | Ga0495664_0122365 | 3300046477 | Bacteria | 1573 |
| 182 | Ga0495618_0130762 | 3300046514 | Bacteria | 1606 |
| 183 | Ga0495628_0072795 | 3300046516 | Bacteria | 2678 |
| 184 | Ga0495643_0073264 | 3300046522 | Bacteria | 1795 |
| 185 | Ga0495652_0055832 | 3300046529 | Bacteria | 3357 |
| 186 | Ga0495587_0010363 | 3300046536 | Bacteria | 5937 |
| 187 | Ga0495587_0016737 | 3300046536 | Bacteria | 4560 |
| 188 | Ga0495645_0023078 | 3300046543 | Bacteria | 4504 |
| 189 | Ga0495667_0086324 | 3300046559 | Bacteria | 2035 |
| 190 | Ga0495657_0021876 | 3300046675 | Bacteria | 4587 |
| 191 | Ga0495657_0105334 | 3300046675 | Bacteria | 1792 |
| 192 | Ga0495623_0011287 | 3300046679 | Bacteria | 5779 |
| 193 | Ga0495646_0143296 | 3300046680 | Bacteria | 1334 |
| 194 | Ga0495604_0024668 | 3300047317 | Bacteria | 4798 |
| 195 | Ga0495604_0135009 | 3300047317 | Bacteria | 1769 |
| 196 | Ga0495674_0040306 | 3300047319 | Bacteria | 4178 |
| 197 | Ga0495674_0242580 | 3300047319 | Bacteria | 1485 |
| 198 | Ga0495680_0140920 | 3300047322 | Bacteria | 1764 |
| 199 | Ga0495675_0007841 | 3300047444 | Bacteria | 6595 |
| 200 | Ga0495675_0141079 | 3300047444 | Bacteria | 1493 |
| 201 | Ga0495602_0007712 | 3300048088 | Bacteria | 11251 |
| 202 | Ga0495602_0035743 | 3300048088 | Bacteria | 4630 |
| 203 | Ga0496103_0063430 | 3300048906 | Bacteria | 2302 |
| 204 | Ga0496106_0113449 | 3300048909 | Bacteria | 2112 |
| 205 | Ga0496107_0022817 | 3300048910 | Bacteria | 4425 |
| 206 | Ga0496113_0126730 | 3300048916 | Bacteria | 2000 |
| 207 | Ga0496116_0000117 | 3300048919 | Bacteria | 172010 |
| 208 | Ga0496117_0009727 | 3300048920 | Bacteria | 8875 |
| 209 | Ga0496118_0003278 | 3300048921 | Bacteria | 20607 |
| 210 | Ga0496124_0058168 | 3300048927 | Bacteria | 3253 |
| 211 | Ga0501031_0016511 | 3300049568 | Bacteria | 4796 |
| 212 | Ga0501032_0000045 | 3300049569 | Bacteria | 110632 |
| 213 | Ga0501033_0117080 | 3300049570 | Bacteria | 1936 |
| 214 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 215 | Ga0501034_0003079 | 3300049571 | Bacteria | 19236 |
| 216 | Ga0501034_0013813 | 3300049571 | Bacteria | 8311 |
| 217 | Ga0501034_0056438 | 3300049571 | Bacteria | 3952 |
| 218 | Ga0501034_0056602 | 3300049571 | Bacteria | 3945 |
| 219 | Ga0501034_0062374 | 3300049571 | Bacteria | 3743 |
| 220 | Ga0501034_0391349 | 3300049571 | Bacteria | 1314 |
| 221 | Ga0501036_0010706 | 3300049572 | Bacteria | 7582 |
| 222 | Ga0501036_0075287 | 3300049572 | Bacteria | 2855 |
| 223 | Ga0501036_0206415 | 3300049572 | Bacteria | 1652 |
| 224 | Ga0501038_0000048 | 3300049574 | Bacteria | 104260 |
| 225 | Ga0501039_0000041 | 3300049575 | Bacteria | 113488 |
| 226 | Ga0501039_0100585 | 3300049575 | Bacteria | 2256 |
| 227 | Ga0501039_0144266 | 3300049575 | Bacteria | 1871 |
| 228 | Ga0501040_0107046 | 3300049576 | Bacteria | 1954 |
| 229 | Ga0501041_0050033 | 3300049577 | Bacteria | 2546 |
| 230 | Ga0501042_0024025 | 3300049578 | Bacteria | 4271 |
| 231 | Ga0501043_0271137 | 3300049579 | Bacteria | 1303 |
| 232 | Ga0501046_0176164 | 3300049580 | Bacteria | 1602 |
| 233 | Ga0501068_0008088 | 3300049584 | Bacteria | 5836 |
| 234 | Ga0501068_0109287 | 3300049584 | Bacteria | 1718 |
| 235 | Ga0501069_0043904 | 3300049585 | Bacteria | 2475 |
| 236 | Ga0501070_0152678 | 3300049586 | Bacteria | 1905 |
| 237 | Ga0501070_0246248 | 3300049586 | Bacteria | 1463 |
| 238 | Ga0501072_0052873 | 3300049588 | Bacteria | 3198 |
| 239 | Ga0501074_0048123 | 3300049590 | Bacteria | 3080 |
| 240 | Ga0501074_0195512 | 3300049590 | Bacteria | 1442 |
| 241 | Ga0501075_0055330 | 3300049591 | Bacteria | 2986 |
| 242 | Ga0501075_0066015 | 3300049591 | Bacteria | 2730 |
| 243 | Ga0501075_0131516 | 3300049591 | Bacteria | 1907 |
| 244 | Ga0501076_0108176 | 3300049592 | Bacteria | 2246 |
| 245 | Ga0501076_0174450 | 3300049592 | Bacteria | 1752 |
| 246 | Ga0501077_0013103 | 3300049593 | Bacteria | 5196 |
| 247 | Ga0501080_0345147 | 3300049742 | Bacteria | 1345 |
| 248 | Ga0501035_0176974 | 3300049822 | Bacteria | 1840 |
| 249 | Ga0501035_0205532 | 3300049822 | Bacteria | 1687 |
| 250 | Ga0501044_0054846 | 3300049823 | Bacteria | 4095 |
| 251 | Ga0501044_0170373 | 3300049823 | Bacteria | 2149 |
| 252 | Ga0501045_0006919 | 3300049824 | Bacteria | 7858 |
| 253 | nmdc:mga03683_2005_c1 | 3300050489 | Bacteria | 6227 |
| 254 | nmdc:mga0yw44_107895_c1 | 3300050492 | Bacteria | 1781 |
| 255 | nmdc:mga0yw44_13915_c1 | 3300050492 | Bacteria | 4253 |
| 256 | nmdc:mga0k408_132063_c1 | 3300050493 | Bacteria | 1482 |
| 257 | nmdc:mga06z11_11781_c1 | 3300050494 | Bacteria | 3781 |
| 258 | nmdc:mga05p37_176288_c1 | 3300050507 | Bacteria | 2604 |
| 259 | nmdc:mga09592_72987_c1 | 3300050508 | Bacteria | 2915 |
| 260 | nmdc:mga08y16_101054_c1 | 3300050511 | Bacteria | 3002 |
| 261 | nmdc:mga0sz30_1920_c1 | 3300050516 | Bacteria | 7425 |
| 262 | Ga0495601_0019636 | 3300053077 | Bacteria | 4124 |
| 263 | Ga0495601_0050338 | 3300053077 | Bacteria | 2627 |
| 264 | Ga0495619_0037661 | 3300053085 | Bacteria | 3153 |
| 265 | Ga0495619_0158377 | 3300053085 | Bacteria | 1563 |
| 266 | Ga0500641_0000793 | 3300053096 | Bacteria | 11417 |
| 267 | Ga0500562_000400 | 3300053108 | Bacteria | 10524 |
| 268 | Ga0500595_013529 | 3300053119 | Bacteria | 3124 |
| 269 | Ga0500642_0010664 | 3300053130 | Bacteria | 3251 |
| 270 | Ga0500652_000332 | 3300053131 | Bacteria | 16973 |
| 271 | Ga0500568_0003656 | 3300053139 | Bacteria | 8459 |
| 272 | Ga0500616_0011246 | 3300053153 | Bacteria | 5300 |
| 273 | Ga0500637_0010972 | 3300053178 | Bacteria | 4663 |
| 274 | Ga0500552_000435 | 3300053733 | Bacteria | 3866 |
| 275 | Ga0501084_0017650 | 3300054114 | Bacteria | 5937 |
| 276 | Ga0590071_001284 | 3300059421 | Bacteria | 6742 |
| 277 | Ga0501082_0009159 | 3300060353 | Bacteria | 8537 |
| 278 | Ga0501082_0483599 | 3300060353 | Bacteria | 1082 |
| 279 | Ga0530510_0040161 | 3300061734 | Bacteria | 3376 |
| 280 | Ga0530510_0062065 | 3300061734 | Bacteria | 2706 |
| 281 | 2512033281 | 2511231221 | Bacteria | 6846400 |
| 282 | 2523105734 | 2522572158 | Bacteria | 6514390 |
| 283 | 2599104536 | 2597490356 | Bacteria | 7030811 |
| 284 | 2617914858 | 2617270889 | Bacteria | 9064343 |
| 285 | 2821450093 | 2821443989 | Bacteria | 7658172 |
| 286 | 2831430314 | 2831426010 | Bacteria | 8662725 |
| 287 | 2842336491 | 2842333319 | Bacteria | 8899485 |
| 288 | 2844536662 | 2844533157 | Bacteria | 7517899 |
| 289 | 2846953630 | 2846952575 | Bacteria | 6587527 |
| 290 | 2848697073 | 2848694841 | Bacteria | 9205737 |
| 291 | 2848860186 | 2848858292 | Bacteria | 7391279 |
| 292 | 2849665360 | 2849660919 | Bacteria | 8251853 |
| 293 | 2883296084 | 2883291878 | Bacteria | 5894118 |
| 294 | 2883358843 | 2883354860 | Bacteria | 5865246 |
| 295 | 2886629286 | 2886627955 | Bacteria | 7618130 |
| 296 | 2897809904 | 2897803580 | Bacteria | 7000062 |
| 297 | 2913845673 | 2913844669 | Bacteria | 8381711 |
| 298 | 2913913300 | 2913912277 | Bacteria | 9037797 |
| 299 | 2913915813 | 2913912277 | Bacteria | 9037797 |
| 300 | 2913944720 | 2913939268 | Bacteria | 8559644 |
| 301 | 642599798 | 642555144 | Bacteria | 9059191 |
| 302 | 8054004858 | 8054002106 | Bacteria | 7987183 |
| 303 | Ga0307407_10155180 | |||
| 304 | JGI25151J46595_10000429 | |||
| 305 | Ga0070658_10045599 | |||
| 306 | Ga0070676_10184381 | |||
| 307 | Ga0070680_100009845 | |||
| 308 | Ga0070661_100122133 | |||
| 309 | Ga0070673_100145681 | |||
| 310 | Ga0070709_10016319 | |||
| 311 | Ga0070713_100059335 | |||
| 312 | Ga0070713_100134481 | |||
| 313 | Ga0070678_100028763 | |||
| 314 | Ga0070681_10059005 | |||
| 315 | Ga0070681_10086428 | |||
| 316 | Ga0070681_10215582 | |||
| 317 | Ga0070698_100015674 | |||
| 318 | Ga0070679_100023309 | |||
| 319 | Ga0070679_100033943 | |||
| 320 | Ga0070684_100066746 | |||
| 321 | Ga0070684_100381103 | |||
| 322 | Ga0070696_100319667 | |||
| 323 | Ga0070665_100056803 | |||
| 324 | Ga0070665_100074384 | |||
| 325 | Ga0070665_100159063 | |||
| 326 | Ga0070704_100009314 | |||
| 327 | Ga0070664_100101817 | |||
| 328 | Ga0068857_100068246 | |||
| 329 | Ga0068856_100101135 | |||
| 330 | Ga0068852_100043581 | |||
| 331 | Ga0068860_100069663 | |||
| 332 | Ga0081455_10001785 | |||
| 333 | Ga0081455_10016775 | |||
| 334 | Ga0081455_10034817 | |||
| 335 | Ga0081455_10036626 | |||
| 336 | Ga0081538_10012647 | |||
| 337 | Ga0081538_10056007 | |||
| 338 | Ga0081538_10092885 | |||
| 339 | Ga0081539_10003999 | |||
| 340 | Ga0075365_10009886 | |||
| 341 | Ga0075365_10022570 | |||
| 342 | Ga0075365_10026705 | |||
| 343 | Ga0070716_100107282 | |||
| 344 | Ga0070712_100106876 | |||
| 345 | Ga0075362_10000825 | |||
| 346 | Ga0075362_10002178 | |||
| 347 | Ga0075367_10024126 | |||
| 348 | Ga0075369_10002924 | |||
| 349 | Ga0075369_10050283 | |||
| 350 | Ga0075431_100476008 | |||
| 351 | Ga0075434_100074424 | |||
| 352 | Ga0075429_100083311 | |||
| 353 | Ga0099795_10006826 | |||
| 354 | Ga0105240_10522021 | |||
| 355 | Ga0105243_10258784 | |||
| 356 | Ga0105238_10165663 | |||
| 357 | Ga0105033_102451 | |||
| 358 | Ga0105028_100674 | |||
| 359 | Ga0099796_10008375 | |||
| 360 | Ga0157370_10002838 | |||
| 361 | Ga0157370_10062040 | |||
| 362 | Ga0157370_10106479 | |||
| 363 | Ga0157369_10019402 | |||
| 364 | Ga0157374_10176422 | |||
| 365 | Ga0157372_10251197 | |||
| 366 | Ga0157375_10476461 | |||
| 367 | Ga0163161_10065127 | |||
| 368 | Ga0213872_10057849 | |||
| 369 | Ga0213876_10003507 | |||
| 370 | Ga0209130_1000461 | |||
| 371 | Ga0209025_1000282 | |||
| 372 | Ga0209758_1004627 | |||
| 373 | Ga0207426_1000474 | |||
| 374 | Ga0207692_10088842 | |||
| 375 | Ga0207699_10086458 | |||
| 376 | Ga0207645_10110400 | |||
| 377 | Ga0207705_10122378 | |||
| 378 | Ga0207707_10015761 | |||
| 379 | Ga0207707_10031488 | |||
| 380 | Ga0207693_10000294 | |||
| 381 | Ga0207693_10110347 | |||
| 382 | Ga0207652_10181763 | |||
| 383 | Ga0207694_10002154 | |||
| 384 | Ga0207650_10190898 | |||
| 385 | Ga0207700_10042223 | |||
| 386 | Ga0207661_10172856 | |||
| 387 | Ga0207667_10023098 | |||
| 388 | Ga0207667_10026145 | |||
| 389 | Ga0207651_10375841 | |||
| 390 | Ga0207674_10099008 | |||
| 391 | Ga0207683_10032391 | |||
| 392 | Ga0207698_10017712 | |||
| 393 | Ga0268266_10000987 | |||
| 394 | Ga0268264_10331036 | |||
| 395 | Ga0265318_10007473 | |||
| 396 | Ga0265324_10001335 | |||
| 397 | Ga0265328_10013955 | |||
| 398 | Ga0265320_10024629 | |||
| 399 | Ga0265320_10076517 | |||
| 400 | Ga0265340_10008947 | |||
| 401 | Ga0265340_10065487 | |||
| 402 | Ga0265331_10000517 | |||
| 403 | Ga0265331_10001202 | |||
| 404 | Ga0265331_10005661 | |||
| 405 | Ga0265327_10000129 | |||
| 406 | Ga0265327_10000294 | |||
| 407 | Ga0265313_10000071 | |||
| 408 | Ga0265313_10001533 | |||
| 409 | Ga0265314_10018103 | |||
| 410 | Ga0265314_10063402 | |||
| 411 | Ga0265314_10088132 | |||
| 412 | Ga0265342_10012641 | |||
| 413 | Ga0316578_10038235 | |||
| 414 | Ga0307405_10191663 | |||
| 415 | Ga0307406_10107473 | |||
| 416 | Ga0307409_100084079 | |||
| 417 | Ga0307416_100071214 | |||
| 418 | Ga0307416_100246050 | |||
| 419 | Ga0373923_0002929 | |||
| 420 | Ga0373939_0079472 | |||
| 421 | Ga0373953_0046214 | |||
| 422 | Ga0373954_0067611 | |||
| 423 | Ga0373957_0047513 | |||
| 424 | Ga0373931_0064111 | |||
| 425 | Ga0373931_0070095 | |||
| 426 | Ga0373935_0120392 | |||
| 427 | Ga0373933_0026754 | |||
| 428 | Ga0373933_0056841 | |||
| 429 | Ga0373933_0101877 | |||
| 430 | Ga0373937_0000980 | |||
| 431 | Ga0373937_0005286 | |||
| 432 | Ga0373937_0039276 | |||
| 433 | Ga0373937_0088646 | |||
| 434 | Ga0373937_0093819 | |||
| 435 | Ga0373937_0330643 | |||
| 436 | Ga0316584_0021378 | |||
| 437 | Ga0373925_0040426 | |||
| 438 | Ga0395899_0010912 | |||
| 439 | Ga0395899_0028854 | |||
| 440 | Ga0395899_0041913 | |||
| 441 | Ga0395899_0104766 | |||
| 442 | Ga0395900_0025184 | |||
| 443 | Ga0395900_0220601 | |||
| 444 | Ga0395898_0005793 | |||
| 445 | Ga0395898_0011930 | |||
| 446 | Ga0395898_0020611 | |||
| 447 | Ga0395898_0160573 | |||
| 448 | Ga0395898_0266754 | |||
| 449 | Ga0395901_0000593 | |||
| 450 | Ga0395901_0018466 | |||
| 451 | Ga0395901_0035828 | |||
| 452 | Ga0395901_0201398 | |||
| 453 | Ga0395901_0246366 | |||
| 454 | Ga0436365_0945932 | |||
| 455 | Ga0436360_0916791 | |||
| 456 | Ga0436360_1263444 | |||
| 457 | Ga0436361_0721836 | |||
| 458 | Ga0436363_0227532 | |||
| 459 | Ga0436362_0765039 | |||
| 460 | Ga0436362_0845333 | |||
| 461 | Ga0439448_0010252 | |||
| 462 | Ga0450923_012662 | |||
| 463 | Ga0451577_0097758 | |||
| 464 | Ga0451577_0180328 | |||
| 465 | Ga0453683_0021493 | |||
| 466 | Ga0466963_0020260 | |||
| 467 | Ga0453684_0000077 | |||
| 468 | Ga0453684_0000882 | |||
| 469 | Ga0453684_0008522 | |||
| 470 | Ga0453684_0009885 | |||
| 471 | Ga0453684_0054972 | |||
| 472 | Ga0453684_0227214 | |||
| 473 | Ga0453684_0366759 | |||
| 474 | Ga0453684_0478173 | |||
| 475 | Ga0451576_0000724 | |||
| 476 | Ga0451576_0001675 | |||
| 477 | Ga0451576_0001824 | |||
| 478 | Ga0451576_0004939 | |||
| 479 | Ga0451576_0196081 | |||
| 480 | Ga0451576_0476169 | |||
| 481 | Ga0466967_0144238 | |||
| 482 | Ga0495592_0129050 | |||
| 483 | Ga0495664_0122365 | |||
| 484 | Ga0495618_0130762 | |||
| 485 | Ga0495628_0072795 | |||
| 486 | Ga0495643_0073264 | |||
| 487 | Ga0495652_0055832 | |||
| 488 | Ga0495587_0010363 | |||
| 489 | Ga0495587_0016737 | |||
| 490 | Ga0495645_0023078 | |||
| 491 | Ga0495667_0086324 | |||
| 492 | Ga0495657_0021876 | |||
| 493 | Ga0495657_0105334 | |||
| 494 | Ga0495623_0011287 | |||
| 495 | Ga0495646_0143296 | |||
| 496 | Ga0495604_0024668 | |||
| 497 | Ga0495604_0135009 | |||
| 498 | Ga0495674_0040306 | |||
| 499 | Ga0495674_0242580 | |||
| 500 | Ga0495680_0140920 | |||
| 501 | Ga0495675_0007841 | |||
| 502 | Ga0495675_0141079 | |||
| 503 | Ga0495602_0007712 | |||
| 504 | Ga0495602_0035743 | |||
| 505 | Ga0496103_0063430 | |||
| 506 | Ga0496106_0113449 | |||
| 507 | Ga0496107_0022817 | |||
| 508 | Ga0496113_0126730 | |||
| 509 | Ga0496116_0000117 | |||
| 510 | Ga0496117_0009727 | |||
| 511 | Ga0496118_0003278 | |||
| 512 | Ga0496124_0058168 | |||
| 513 | Ga0501031_0016511 | |||
| 514 | Ga0501032_0000045 | |||
| 515 | Ga0501033_0117080 | |||
| 516 | Ga0501034_0000001 | |||
| 517 | Ga0501034_0003079 | |||
| 518 | Ga0501034_0013813 | |||
| 519 | Ga0501034_0056438 | |||
| 520 | Ga0501034_0056602 | |||
| 521 | Ga0501034_0062374 | |||
| 522 | Ga0501034_0391349 | |||
| 523 | Ga0501036_0010706 | |||
| 524 | Ga0501036_0075287 | |||
| 525 | Ga0501036_0206415 | |||
| 526 | Ga0501038_0000048 | |||
| 527 | Ga0501039_0000041 | |||
| 528 | Ga0501039_0100585 | |||
| 529 | Ga0501039_0144266 | |||
| 530 | Ga0501040_0107046 | |||
| 531 | Ga0501041_0050033 | |||
| 532 | Ga0501042_0024025 | |||
| 533 | Ga0501043_0271137 | |||
| 534 | Ga0501046_0176164 | |||
| 535 | Ga0501068_0008088 | |||
| 536 | Ga0501068_0109287 | |||
| 537 | Ga0501069_0043904 | |||
| 538 | Ga0501070_0152678 | |||
| 539 | Ga0501070_0246248 | |||
| 540 | Ga0501072_0052873 | |||
| 541 | Ga0501074_0048123 | |||
| 542 | Ga0501074_0195512 | |||
| 543 | Ga0501075_0055330 | |||
| 544 | Ga0501075_0066015 | |||
| 545 | Ga0501075_0131516 | |||
| 546 | Ga0501076_0108176 | |||
| 547 | Ga0501076_0174450 | |||
| 548 | Ga0501077_0013103 | |||
| 549 | Ga0501080_0345147 | |||
| 550 | Ga0501035_0176974 | |||
| 551 | Ga0501035_0205532 | |||
| 552 | Ga0501044_0054846 | |||
| 553 | Ga0501044_0170373 | |||
| 554 | Ga0501045_0006919 | |||
| 555 | nmdc:mga03683_2005_c1 | |||
| 556 | nmdc:mga0yw44_107895_c1 | |||
| 557 | nmdc:mga0yw44_13915_c1 | |||
| 558 | nmdc:mga0k408_132063_c1 | |||
| 559 | nmdc:mga06z11_11781_c1 | |||
| 560 | nmdc:mga05p37_176288_c1 | |||
| 561 | nmdc:mga09592_72987_c1 | |||
| 562 | nmdc:mga08y16_101054_c1 | |||
| 563 | nmdc:mga0sz30_1920_c1 | |||
| 564 | Ga0495601_0019636 | |||
| 565 | Ga0495601_0050338 | |||
| 566 | Ga0495619_0037661 | |||
| 567 | Ga0495619_0158377 | |||
| 568 | Ga0500641_0000793 | |||
| 569 | Ga0500562_000400 | |||
| 570 | Ga0500595_013529 | |||
| 571 | Ga0500642_0010664 | |||
| 572 | Ga0500652_000332 | |||
| 573 | Ga0500568_0003656 | |||
| 574 | Ga0500616_0011246 | |||
| 575 | Ga0500637_0010972 | |||
| 576 | Ga0500552_000435 | |||
| 577 | Ga0501084_0017650 | |||
| 578 | Ga0590071_001284 | |||
| 579 | Ga0501082_0009159 | |||
| 580 | Ga0501082_0483599 | |||
| 581 | Ga0530510_0040161 | |||
| 582 | Ga0530510_0062065 | |||
| 583 | 2512033281 | |||
| 584 | 2523105734 | |||
| 585 | 2599104536 | |||
| 586 | 2617914858 | |||
| 587 | 2821450093 | |||
| 588 | 2831430314 | |||
| 589 | 2842336491 | |||
| 590 | 2844536662 | |||
| 591 | 2846953630 | |||
| 592 | 2848697073 | |||
| 593 | 2848860186 | |||
| 594 | 2849665360 | |||
| 595 | 2883296084 | |||
| 596 | 2883358843 | |||
| 597 | 2886629286 | |||
| 598 | 2897809904 | |||
| 599 | 2913845673 | |||
| 600 | 2913913300 | |||
| 601 | 2913915813 | |||
| 602 | 2913944720 | |||
| 603 | 642599798 | |||
| 604 | 8054004858 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pfk-assembly2.cif.gz_D | the crystal structure of unliganded phosphofructokinase from escherichia coli | 0.9531 | 5 | 335 |
| 1mto-assembly2.cif.gz_E | crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate | 0.9446 | 5 | 356 |
| 3pfk-assembly1.cif.gz_A | phosphofructokinase. structure and control | 0.9425 | 5 | 356 |
| 3u39-assembly1.cif.gz_A | crystal structure of the apo bacillus stearothermophilus phosphofructokinase | 0.9412 | 5 | 356 |
| 4i4i-assembly1.cif.gz_D | crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep | 0.94 | 5 | 356 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9484 | 5 | 334 | 3.40.50.450 |
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9363 | 5 | 334 | 3.40.50.450 |
| 2pfkC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain | 0.9278 | 158 | 285 | 3.40.50.460 |
| af_Q27483_177_317_3.40.50.460 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain | 0.9135 | 161 | 308 | 3.40.50.460 |
| af_P52034_186_305_3.40.50.460 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain | 0.9124 | 161 | 289 | 3.40.50.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349JJJ0-F1-model_v4 | 6-phosphofructokinase | 0.9838 | 1 | 325 |
GO:0003872
GO:0005524 GO:0005945 GO:0006002 GO:0016208 GO:0030388 GO:0042802 GO:0046872 GO:0048029 GO:0061621 GO:0070095 |
| AF-A0A5J6MNF7-F1-model_v4 | ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase) | 0.983 | 4 | 360 |
GO:0003872
GO:0005524 GO:0005945 GO:0006002 GO:0016208 GO:0030388 GO:0042802 GO:0046872 GO:0047334 GO:0048029 GO:0061621 GO:0070095 |
| AF-A0A3N5JBL8-F1-model_v4 | deleted | 0.9821 | 140 | 360 |
|
| AF-A0A6P0JZP0-F1-model_v4 | ATP-dependent 6-phosphofructokinase (EC 2.7.1.11) | 0.9788 | 120 | 360 |
GO:0003872
GO:0005524 GO:0005945 GO:0006002 GO:0016208 GO:0030388 GO:0042802 GO:0046872 GO:0048029 GO:0061621 GO:0070095 |
| AF-A0A349JJJ0-F1-model_v4 | 6-phosphofructokinase | 0.9778 | 1 | 325 |
GO:0003872
GO:0005524 GO:0005945 GO:0006002 GO:0016208 GO:0030388 GO:0042802 GO:0046872 GO:0048029 GO:0061621 GO:0070095 |