F396575

General Info

Members Datasets Scaffolds Average Seq Length
302 207 604 359

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10155180|Ga0307407_101551802
Length 387
Sequence MVAANAWFGNTGAKPSDSGHSERQADMSGEKRIGILTSGGDCAGLNAVIRAVVHRATLTYGWQVIGVKEGTMGLLSRPVQYEVLDLDMVGSSMMRQGGTILGTTNKGNPFAFPMSDGTIKDRSAEIAGGYRELGLDALIGIGGDGSFAILRKLAQQCGINLVGVPKTIDNDLGLTEASIGFDTAVGVATEALDRLQPTAASHARVMVLEVMGRDAGHIAIAAGIAGGADVILIPEIPFSMDRIAAKIHQVRQQGRNFALVVVSEAVKTSEGKEIQKEYLGGEKRFGGIGNYIGEEIANVTGAETRVTVLGHVQRGSMPSPRDRLIASAFGVHAVDLIAEGKFDRMVAWSNREVIDVSIEDAIARYQAVELDGAMVRTARGLGICLGD

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
188 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
189 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
190 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
191 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
192 2831426010 Nostoc sp. 106C Isolate Unclassified
193 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
194 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
195 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
196 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
197 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
198 2849660919 Nostoc sp. T09 Isolate Unclassified
199 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
200 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
201 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
202 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
203 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
204 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
205 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
206 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
207 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.72
Metatranscriptomes 0
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0.33
Rhizoplane 1.32
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10155180 3300031903 Bacteria 1492
2 JGI25151J46595_10000429 3300003187 Bacteria 41718
3 Ga0070658_10045599 3300005327 Bacteria 3545
4 Ga0070676_10184381 3300005328 Bacteria 1359
5 Ga0070680_100009845 3300005336 Bacteria 7356
6 Ga0070661_100122133 3300005344 Bacteria 1952
7 Ga0070673_100145681 3300005364 Bacteria 2002
8 Ga0070709_10016319 3300005434 Bacteria 4237
9 Ga0070713_100059335 3300005436 Bacteria 3195
10 Ga0070713_100134481 3300005436 Bacteria 2183
11 Ga0070678_100028763 3300005456 Bacteria 3796
12 Ga0070681_10059005 3300005458 Bacteria 3816
13 Ga0070681_10086428 3300005458 Bacteria 3089
14 Ga0070681_10215582 3300005458 Bacteria 1836
15 Ga0070698_100015674 3300005471 Bacteria 8005
16 Ga0070679_100023309 3300005530 Bacteria 6057
17 Ga0070679_100033943 3300005530 Bacteria 5055
18 Ga0070684_100066746 3300005535 Bacteria 3158
19 Ga0070684_100381103 3300005535 Bacteria 1299
20 Ga0070696_100319667 3300005546 Bacteria 1194
21 Ga0070665_100056803 3300005548 Bacteria 3924
22 Ga0070665_100074384 3300005548 Bacteria 3403
23 Ga0070665_100159063 3300005548 Bacteria 2261
24 Ga0070704_100009314 3300005549 Bacteria 5924
25 Ga0070664_100101817 3300005564 Bacteria 2498
26 Ga0068857_100068246 3300005577 Bacteria 3165
27 Ga0068856_100101135 3300005614 Bacteria 2875
28 Ga0068852_100043581 3300005616 Bacteria 3806
29 Ga0068860_100069663 3300005843 Bacteria 3343
30 Ga0081455_10001785 3300005937 Bacteria 25987
31 Ga0081455_10016775 3300005937 Bacteria 7048
32 Ga0081455_10034817 3300005937 Bacteria 4508
33 Ga0081455_10036626 3300005937 Bacteria 4365
34 Ga0081538_10012647 3300005981 Bacteria 6753
35 Ga0081538_10056007 3300005981 Bacteria 2314
36 Ga0081538_10092885 3300005981 Bacteria 1552
37 Ga0081539_10003999 3300005985 Bacteria 16991
38 Ga0075365_10009886 3300006038 Bacteria 5522
39 Ga0075365_10022570 3300006038 Bacteria 3946
40 Ga0075365_10026705 3300006038 Bacteria 3668
41 Ga0070716_100107282 3300006173 Bacteria 1724
42 Ga0070712_100106876 3300006175 Bacteria 2081
43 Ga0075362_10000825 3300006177 Bacteria 9283
44 Ga0075362_10002178 3300006177 Bacteria 6489
45 Ga0075367_10024126 3300006178 Bacteria 3430
46 Ga0075369_10002924 3300006186 Bacteria 6166
47 Ga0075369_10050283 3300006186 Bacteria 1802
48 Ga0075431_100476008 3300006847 Bacteria 1242
49 Ga0075434_100074424 3300006871 Bacteria 3390
50 Ga0075429_100083311 3300006880 Bacteria 2788
51 Ga0099795_10006826 3300007788 Bacteria 3140
52 Ga0105240_10522021 3300009093 Bacteria 1318
53 Ga0105243_10258784 3300009148 Bacteria 1557
54 Ga0105238_10165663 3300009551 Bacteria 2186
55 Ga0105033_102451 3300009986 Bacteria 1534
56 Ga0105028_100674 3300009993 Bacteria 3614
57 Ga0099796_10008375 3300010159 Bacteria 2754
58 Ga0157370_10002838 3300013104 Bacteria 20711
59 Ga0157370_10062040 3300013104 Bacteria 3546
60 Ga0157370_10106479 3300013104 Bacteria 2624
61 Ga0157369_10019402 3300013105 Bacteria 7607
62 Ga0157374_10176422 3300013296 Bacteria 2086
63 Ga0157372_10251197 3300013307 Bacteria 2053
64 Ga0157375_10476461 3300013308 Bacteria 1413
65 Ga0163161_10065127 3300017792 Bacteria 2659
66 Ga0213872_10057849 3300021361 Bacteria 1755
67 Ga0213876_10003507 3300021384 Bacteria 8952
68 Ga0209130_1000461 3300025284 Bacteria 42274
69 Ga0209025_1000282 3300025294 Bacteria 115627
70 Ga0209758_1004627 3300025297 Bacteria 11282
71 Ga0207426_1000474 3300025302 Bacteria 61569
72 Ga0207692_10088842 3300025898 Bacteria 1671
73 Ga0207699_10086458 3300025906 Bacteria 1958
74 Ga0207645_10110400 3300025907 Bacteria 1780
75 Ga0207705_10122378 3300025909 Bacteria 1932
76 Ga0207707_10015761 3300025912 Bacteria 6589
77 Ga0207707_10031488 3300025912 Bacteria 4641
78 Ga0207693_10000294 3300025915 Bacteria 46423
79 Ga0207693_10110347 3300025915 Bacteria 2157
80 Ga0207652_10181763 3300025921 Bacteria 1890
81 Ga0207694_10002154 3300025924 Bacteria 16172
82 Ga0207650_10190898 3300025925 Bacteria 1637
83 Ga0207700_10042223 3300025928 Bacteria 3342
84 Ga0207661_10172856 3300025944 Bacteria 1882
85 Ga0207667_10023098 3300025949 Bacteria 6851
86 Ga0207667_10026145 3300025949 Bacteria 6381
87 Ga0207651_10375841 3300025960 Bacteria 1203
88 Ga0207674_10099008 3300026116 Bacteria 2898
89 Ga0207683_10032391 3300026121 Bacteria 4541
90 Ga0207698_10017712 3300026142 Bacteria 4841
91 Ga0268266_10000987 3300028379 Bacteria 35837
92 Ga0268264_10331036 3300028381 Bacteria 1443
93 Ga0265318_10007473 3300028577 Bacteria 4938
94 Ga0265324_10001335 3300029957 Bacteria 14406
95 Ga0265328_10013955 3300031239 Bacteria 3171
96 Ga0265320_10024629 3300031240 Bacteria 3180
97 Ga0265320_10076517 3300031240 Bacteria 1568
98 Ga0265340_10008947 3300031247 Bacteria 5395
99 Ga0265340_10065487 3300031247 Bacteria 1730
100 Ga0265331_10000517 3300031250 Bacteria 36007
101 Ga0265331_10001202 3300031250 Bacteria 19515
102 Ga0265331_10005661 3300031250 Bacteria 7507
103 Ga0265327_10000129 3300031251 Bacteria 165504
104 Ga0265327_10000294 3300031251 Bacteria 96710
105 Ga0265313_10000071 3300031595 Bacteria 99087
106 Ga0265313_10001533 3300031595 Bacteria 21492
107 Ga0265314_10018103 3300031711 Bacteria 5506
108 Ga0265314_10063402 3300031711 Bacteria 2507
109 Ga0265314_10088132 3300031711 Bacteria 2027
110 Ga0265342_10012641 3300031712 Bacteria 5711
111 Ga0316578_10038235 3300031728 Bacteria 2767
112 Ga0307405_10191663 3300031731 Bacteria 1477
113 Ga0307406_10107473 3300031901 Bacteria 1913
114 Ga0307409_100084079 3300031995 Bacteria 2583
115 Ga0307416_100071214 3300032002 Bacteria 2887
116 Ga0307416_100246050 3300032002 Bacteria 1737
117 Ga0373923_0002929 3300035111 Bacteria 5371
118 Ga0373939_0079472 3300035114 Bacteria 1086
119 Ga0373953_0046214 3300035117 Bacteria 1747
120 Ga0373954_0067611 3300035118 Bacteria 1693
121 Ga0373957_0047513 3300035120 Bacteria 1633
122 Ga0373931_0064111 3300035691 Bacteria 1988
123 Ga0373931_0070095 3300035691 Bacteria 1912
124 Ga0373935_0120392 3300035692 Bacteria 1753
125 Ga0373933_0026754 3300035724 Bacteria 3315
126 Ga0373933_0056841 3300035724 Bacteria 2350
127 Ga0373933_0101877 3300035724 Bacteria 1782
128 Ga0373937_0000980 3300036401 Bacteria 24218
129 Ga0373937_0005286 3300036401 Bacteria 11030
130 Ga0373937_0039276 3300036401 Bacteria 4313
131 Ga0373937_0088646 3300036401 Bacteria 2864
132 Ga0373937_0093819 3300036401 Bacteria 2783
133 Ga0373937_0330643 3300036401 Bacteria 1442
134 Ga0316584_0021378 3300036712 Bacteria 4702
135 Ga0373925_0040426 3300037068 Bacteria 3453
136 Ga0395899_0010912 3300037312 Bacteria 6962
137 Ga0395899_0028854 3300037312 Bacteria 4176
138 Ga0395899_0041913 3300037312 Bacteria 3419
139 Ga0395899_0104766 3300037312 Bacteria 2038
140 Ga0395900_0025184 3300037418 Bacteria 6091
141 Ga0395900_0220601 3300037418 Bacteria 1911
142 Ga0395898_0005793 3300037466 Bacteria 13289
143 Ga0395898_0011930 3300037466 Bacteria 9001
144 Ga0395898_0020611 3300037466 Bacteria 6696
145 Ga0395898_0160573 3300037466 Bacteria 2150
146 Ga0395898_0266754 3300037466 Bacteria 1633
147 Ga0395901_0000593 3300038443 Bacteria 42246
148 Ga0395901_0018466 3300038443 Bacteria 7118
149 Ga0395901_0035828 3300038443 Bacteria 5127
150 Ga0395901_0201398 3300038443 Bacteria 2087
151 Ga0395901_0246366 3300038443 Bacteria 1863
152 Ga0436365_0945932 3300039437 Bacteria 6313
153 Ga0436360_0916791 3300039438 Bacteria 1164
154 Ga0436360_1263444 3300039438 Bacteria 10816
155 Ga0436361_0721836 3300039447 Bacteria 1865
156 Ga0436363_0227532 3300039450 Bacteria 1631
157 Ga0436362_0765039 3300039453 Bacteria 1709
158 Ga0436362_0845333 3300039453 Bacteria 1564
159 Ga0439448_0010252 3300042005 Bacteria 2774
160 Ga0450923_012662 3300042125 Bacteria 1539
161 Ga0451577_0097758 3300042876 Bacteria 2622
162 Ga0451577_0180328 3300042876 Bacteria 1904
163 Ga0453683_0021493 3300044673 Bacteria 4120
164 Ga0466963_0020260 3300044694 Bacteria 4182
165 Ga0453684_0000077 3300044712 Bacteria 435536
166 Ga0453684_0000882 3300044712 Bacteria 100349
167 Ga0453684_0008522 3300044712 Bacteria 18325
168 Ga0453684_0009885 3300044712 Bacteria 16492
169 Ga0453684_0054972 3300044712 Bacteria 5180
170 Ga0453684_0227214 3300044712 Bacteria 2157
171 Ga0453684_0366759 3300044712 Bacteria 1620
172 Ga0453684_0478173 3300044712 Bacteria 1382
173 Ga0451576_0000724 3300045051 Bacteria 66525
174 Ga0451576_0001675 3300045051 Bacteria 36759
175 Ga0451576_0001824 3300045051 Bacteria 34612
176 Ga0451576_0004939 3300045051 Bacteria 16977
177 Ga0451576_0196081 3300045051 Bacteria 2109
178 Ga0451576_0476169 3300045051 Bacteria 1311
179 Ga0466967_0144238 3300045976 Bacteria 2220
180 Ga0495592_0129050 3300046454 Bacteria 1770
181 Ga0495664_0122365 3300046477 Bacteria 1573
182 Ga0495618_0130762 3300046514 Bacteria 1606
183 Ga0495628_0072795 3300046516 Bacteria 2678
184 Ga0495643_0073264 3300046522 Bacteria 1795
185 Ga0495652_0055832 3300046529 Bacteria 3357
186 Ga0495587_0010363 3300046536 Bacteria 5937
187 Ga0495587_0016737 3300046536 Bacteria 4560
188 Ga0495645_0023078 3300046543 Bacteria 4504
189 Ga0495667_0086324 3300046559 Bacteria 2035
190 Ga0495657_0021876 3300046675 Bacteria 4587
191 Ga0495657_0105334 3300046675 Bacteria 1792
192 Ga0495623_0011287 3300046679 Bacteria 5779
193 Ga0495646_0143296 3300046680 Bacteria 1334
194 Ga0495604_0024668 3300047317 Bacteria 4798
195 Ga0495604_0135009 3300047317 Bacteria 1769
196 Ga0495674_0040306 3300047319 Bacteria 4178
197 Ga0495674_0242580 3300047319 Bacteria 1485
198 Ga0495680_0140920 3300047322 Bacteria 1764
199 Ga0495675_0007841 3300047444 Bacteria 6595
200 Ga0495675_0141079 3300047444 Bacteria 1493
201 Ga0495602_0007712 3300048088 Bacteria 11251
202 Ga0495602_0035743 3300048088 Bacteria 4630
203 Ga0496103_0063430 3300048906 Bacteria 2302
204 Ga0496106_0113449 3300048909 Bacteria 2112
205 Ga0496107_0022817 3300048910 Bacteria 4425
206 Ga0496113_0126730 3300048916 Bacteria 2000
207 Ga0496116_0000117 3300048919 Bacteria 172010
208 Ga0496117_0009727 3300048920 Bacteria 8875
209 Ga0496118_0003278 3300048921 Bacteria 20607
210 Ga0496124_0058168 3300048927 Bacteria 3253
211 Ga0501031_0016511 3300049568 Bacteria 4796
212 Ga0501032_0000045 3300049569 Bacteria 110632
213 Ga0501033_0117080 3300049570 Bacteria 1936
214 Ga0501034_0000001 3300049571 Bacteria 2184493
215 Ga0501034_0003079 3300049571 Bacteria 19236
216 Ga0501034_0013813 3300049571 Bacteria 8311
217 Ga0501034_0056438 3300049571 Bacteria 3952
218 Ga0501034_0056602 3300049571 Bacteria 3945
219 Ga0501034_0062374 3300049571 Bacteria 3743
220 Ga0501034_0391349 3300049571 Bacteria 1314
221 Ga0501036_0010706 3300049572 Bacteria 7582
222 Ga0501036_0075287 3300049572 Bacteria 2855
223 Ga0501036_0206415 3300049572 Bacteria 1652
224 Ga0501038_0000048 3300049574 Bacteria 104260
225 Ga0501039_0000041 3300049575 Bacteria 113488
226 Ga0501039_0100585 3300049575 Bacteria 2256
227 Ga0501039_0144266 3300049575 Bacteria 1871
228 Ga0501040_0107046 3300049576 Bacteria 1954
229 Ga0501041_0050033 3300049577 Bacteria 2546
230 Ga0501042_0024025 3300049578 Bacteria 4271
231 Ga0501043_0271137 3300049579 Bacteria 1303
232 Ga0501046_0176164 3300049580 Bacteria 1602
233 Ga0501068_0008088 3300049584 Bacteria 5836
234 Ga0501068_0109287 3300049584 Bacteria 1718
235 Ga0501069_0043904 3300049585 Bacteria 2475
236 Ga0501070_0152678 3300049586 Bacteria 1905
237 Ga0501070_0246248 3300049586 Bacteria 1463
238 Ga0501072_0052873 3300049588 Bacteria 3198
239 Ga0501074_0048123 3300049590 Bacteria 3080
240 Ga0501074_0195512 3300049590 Bacteria 1442
241 Ga0501075_0055330 3300049591 Bacteria 2986
242 Ga0501075_0066015 3300049591 Bacteria 2730
243 Ga0501075_0131516 3300049591 Bacteria 1907
244 Ga0501076_0108176 3300049592 Bacteria 2246
245 Ga0501076_0174450 3300049592 Bacteria 1752
246 Ga0501077_0013103 3300049593 Bacteria 5196
247 Ga0501080_0345147 3300049742 Bacteria 1345
248 Ga0501035_0176974 3300049822 Bacteria 1840
249 Ga0501035_0205532 3300049822 Bacteria 1687
250 Ga0501044_0054846 3300049823 Bacteria 4095
251 Ga0501044_0170373 3300049823 Bacteria 2149
252 Ga0501045_0006919 3300049824 Bacteria 7858
253 nmdc:mga03683_2005_c1 3300050489 Bacteria 6227
254 nmdc:mga0yw44_107895_c1 3300050492 Bacteria 1781
255 nmdc:mga0yw44_13915_c1 3300050492 Bacteria 4253
256 nmdc:mga0k408_132063_c1 3300050493 Bacteria 1482
257 nmdc:mga06z11_11781_c1 3300050494 Bacteria 3781
258 nmdc:mga05p37_176288_c1 3300050507 Bacteria 2604
259 nmdc:mga09592_72987_c1 3300050508 Bacteria 2915
260 nmdc:mga08y16_101054_c1 3300050511 Bacteria 3002
261 nmdc:mga0sz30_1920_c1 3300050516 Bacteria 7425
262 Ga0495601_0019636 3300053077 Bacteria 4124
263 Ga0495601_0050338 3300053077 Bacteria 2627
264 Ga0495619_0037661 3300053085 Bacteria 3153
265 Ga0495619_0158377 3300053085 Bacteria 1563
266 Ga0500641_0000793 3300053096 Bacteria 11417
267 Ga0500562_000400 3300053108 Bacteria 10524
268 Ga0500595_013529 3300053119 Bacteria 3124
269 Ga0500642_0010664 3300053130 Bacteria 3251
270 Ga0500652_000332 3300053131 Bacteria 16973
271 Ga0500568_0003656 3300053139 Bacteria 8459
272 Ga0500616_0011246 3300053153 Bacteria 5300
273 Ga0500637_0010972 3300053178 Bacteria 4663
274 Ga0500552_000435 3300053733 Bacteria 3866
275 Ga0501084_0017650 3300054114 Bacteria 5937
276 Ga0590071_001284 3300059421 Bacteria 6742
277 Ga0501082_0009159 3300060353 Bacteria 8537
278 Ga0501082_0483599 3300060353 Bacteria 1082
279 Ga0530510_0040161 3300061734 Bacteria 3376
280 Ga0530510_0062065 3300061734 Bacteria 2706
281 2512033281 2511231221 Bacteria 6846400
282 2523105734 2522572158 Bacteria 6514390
283 2599104536 2597490356 Bacteria 7030811
284 2617914858 2617270889 Bacteria 9064343
285 2821450093 2821443989 Bacteria 7658172
286 2831430314 2831426010 Bacteria 8662725
287 2842336491 2842333319 Bacteria 8899485
288 2844536662 2844533157 Bacteria 7517899
289 2846953630 2846952575 Bacteria 6587527
290 2848697073 2848694841 Bacteria 9205737
291 2848860186 2848858292 Bacteria 7391279
292 2849665360 2849660919 Bacteria 8251853
293 2883296084 2883291878 Bacteria 5894118
294 2883358843 2883354860 Bacteria 5865246
295 2886629286 2886627955 Bacteria 7618130
296 2897809904 2897803580 Bacteria 7000062
297 2913845673 2913844669 Bacteria 8381711
298 2913913300 2913912277 Bacteria 9037797
299 2913915813 2913912277 Bacteria 9037797
300 2913944720 2913939268 Bacteria 8559644
301 642599798 642555144 Bacteria 9059191
302 8054004858 8054002106 Bacteria 7987183
303 Ga0307407_10155180
304 JGI25151J46595_10000429
305 Ga0070658_10045599
306 Ga0070676_10184381
307 Ga0070680_100009845
308 Ga0070661_100122133
309 Ga0070673_100145681
310 Ga0070709_10016319
311 Ga0070713_100059335
312 Ga0070713_100134481
313 Ga0070678_100028763
314 Ga0070681_10059005
315 Ga0070681_10086428
316 Ga0070681_10215582
317 Ga0070698_100015674
318 Ga0070679_100023309
319 Ga0070679_100033943
320 Ga0070684_100066746
321 Ga0070684_100381103
322 Ga0070696_100319667
323 Ga0070665_100056803
324 Ga0070665_100074384
325 Ga0070665_100159063
326 Ga0070704_100009314
327 Ga0070664_100101817
328 Ga0068857_100068246
329 Ga0068856_100101135
330 Ga0068852_100043581
331 Ga0068860_100069663
332 Ga0081455_10001785
333 Ga0081455_10016775
334 Ga0081455_10034817
335 Ga0081455_10036626
336 Ga0081538_10012647
337 Ga0081538_10056007
338 Ga0081538_10092885
339 Ga0081539_10003999
340 Ga0075365_10009886
341 Ga0075365_10022570
342 Ga0075365_10026705
343 Ga0070716_100107282
344 Ga0070712_100106876
345 Ga0075362_10000825
346 Ga0075362_10002178
347 Ga0075367_10024126
348 Ga0075369_10002924
349 Ga0075369_10050283
350 Ga0075431_100476008
351 Ga0075434_100074424
352 Ga0075429_100083311
353 Ga0099795_10006826
354 Ga0105240_10522021
355 Ga0105243_10258784
356 Ga0105238_10165663
357 Ga0105033_102451
358 Ga0105028_100674
359 Ga0099796_10008375
360 Ga0157370_10002838
361 Ga0157370_10062040
362 Ga0157370_10106479
363 Ga0157369_10019402
364 Ga0157374_10176422
365 Ga0157372_10251197
366 Ga0157375_10476461
367 Ga0163161_10065127
368 Ga0213872_10057849
369 Ga0213876_10003507
370 Ga0209130_1000461
371 Ga0209025_1000282
372 Ga0209758_1004627
373 Ga0207426_1000474
374 Ga0207692_10088842
375 Ga0207699_10086458
376 Ga0207645_10110400
377 Ga0207705_10122378
378 Ga0207707_10015761
379 Ga0207707_10031488
380 Ga0207693_10000294
381 Ga0207693_10110347
382 Ga0207652_10181763
383 Ga0207694_10002154
384 Ga0207650_10190898
385 Ga0207700_10042223
386 Ga0207661_10172856
387 Ga0207667_10023098
388 Ga0207667_10026145
389 Ga0207651_10375841
390 Ga0207674_10099008
391 Ga0207683_10032391
392 Ga0207698_10017712
393 Ga0268266_10000987
394 Ga0268264_10331036
395 Ga0265318_10007473
396 Ga0265324_10001335
397 Ga0265328_10013955
398 Ga0265320_10024629
399 Ga0265320_10076517
400 Ga0265340_10008947
401 Ga0265340_10065487
402 Ga0265331_10000517
403 Ga0265331_10001202
404 Ga0265331_10005661
405 Ga0265327_10000129
406 Ga0265327_10000294
407 Ga0265313_10000071
408 Ga0265313_10001533
409 Ga0265314_10018103
410 Ga0265314_10063402
411 Ga0265314_10088132
412 Ga0265342_10012641
413 Ga0316578_10038235
414 Ga0307405_10191663
415 Ga0307406_10107473
416 Ga0307409_100084079
417 Ga0307416_100071214
418 Ga0307416_100246050
419 Ga0373923_0002929
420 Ga0373939_0079472
421 Ga0373953_0046214
422 Ga0373954_0067611
423 Ga0373957_0047513
424 Ga0373931_0064111
425 Ga0373931_0070095
426 Ga0373935_0120392
427 Ga0373933_0026754
428 Ga0373933_0056841
429 Ga0373933_0101877
430 Ga0373937_0000980
431 Ga0373937_0005286
432 Ga0373937_0039276
433 Ga0373937_0088646
434 Ga0373937_0093819
435 Ga0373937_0330643
436 Ga0316584_0021378
437 Ga0373925_0040426
438 Ga0395899_0010912
439 Ga0395899_0028854
440 Ga0395899_0041913
441 Ga0395899_0104766
442 Ga0395900_0025184
443 Ga0395900_0220601
444 Ga0395898_0005793
445 Ga0395898_0011930
446 Ga0395898_0020611
447 Ga0395898_0160573
448 Ga0395898_0266754
449 Ga0395901_0000593
450 Ga0395901_0018466
451 Ga0395901_0035828
452 Ga0395901_0201398
453 Ga0395901_0246366
454 Ga0436365_0945932
455 Ga0436360_0916791
456 Ga0436360_1263444
457 Ga0436361_0721836
458 Ga0436363_0227532
459 Ga0436362_0765039
460 Ga0436362_0845333
461 Ga0439448_0010252
462 Ga0450923_012662
463 Ga0451577_0097758
464 Ga0451577_0180328
465 Ga0453683_0021493
466 Ga0466963_0020260
467 Ga0453684_0000077
468 Ga0453684_0000882
469 Ga0453684_0008522
470 Ga0453684_0009885
471 Ga0453684_0054972
472 Ga0453684_0227214
473 Ga0453684_0366759
474 Ga0453684_0478173
475 Ga0451576_0000724
476 Ga0451576_0001675
477 Ga0451576_0001824
478 Ga0451576_0004939
479 Ga0451576_0196081
480 Ga0451576_0476169
481 Ga0466967_0144238
482 Ga0495592_0129050
483 Ga0495664_0122365
484 Ga0495618_0130762
485 Ga0495628_0072795
486 Ga0495643_0073264
487 Ga0495652_0055832
488 Ga0495587_0010363
489 Ga0495587_0016737
490 Ga0495645_0023078
491 Ga0495667_0086324
492 Ga0495657_0021876
493 Ga0495657_0105334
494 Ga0495623_0011287
495 Ga0495646_0143296
496 Ga0495604_0024668
497 Ga0495604_0135009
498 Ga0495674_0040306
499 Ga0495674_0242580
500 Ga0495680_0140920
501 Ga0495675_0007841
502 Ga0495675_0141079
503 Ga0495602_0007712
504 Ga0495602_0035743
505 Ga0496103_0063430
506 Ga0496106_0113449
507 Ga0496107_0022817
508 Ga0496113_0126730
509 Ga0496116_0000117
510 Ga0496117_0009727
511 Ga0496118_0003278
512 Ga0496124_0058168
513 Ga0501031_0016511
514 Ga0501032_0000045
515 Ga0501033_0117080
516 Ga0501034_0000001
517 Ga0501034_0003079
518 Ga0501034_0013813
519 Ga0501034_0056438
520 Ga0501034_0056602
521 Ga0501034_0062374
522 Ga0501034_0391349
523 Ga0501036_0010706
524 Ga0501036_0075287
525 Ga0501036_0206415
526 Ga0501038_0000048
527 Ga0501039_0000041
528 Ga0501039_0100585
529 Ga0501039_0144266
530 Ga0501040_0107046
531 Ga0501041_0050033
532 Ga0501042_0024025
533 Ga0501043_0271137
534 Ga0501046_0176164
535 Ga0501068_0008088
536 Ga0501068_0109287
537 Ga0501069_0043904
538 Ga0501070_0152678
539 Ga0501070_0246248
540 Ga0501072_0052873
541 Ga0501074_0048123
542 Ga0501074_0195512
543 Ga0501075_0055330
544 Ga0501075_0066015
545 Ga0501075_0131516
546 Ga0501076_0108176
547 Ga0501076_0174450
548 Ga0501077_0013103
549 Ga0501080_0345147
550 Ga0501035_0176974
551 Ga0501035_0205532
552 Ga0501044_0054846
553 Ga0501044_0170373
554 Ga0501045_0006919
555 nmdc:mga03683_2005_c1
556 nmdc:mga0yw44_107895_c1
557 nmdc:mga0yw44_13915_c1
558 nmdc:mga0k408_132063_c1
559 nmdc:mga06z11_11781_c1
560 nmdc:mga05p37_176288_c1
561 nmdc:mga09592_72987_c1
562 nmdc:mga08y16_101054_c1
563 nmdc:mga0sz30_1920_c1
564 Ga0495601_0019636
565 Ga0495601_0050338
566 Ga0495619_0037661
567 Ga0495619_0158377
568 Ga0500641_0000793
569 Ga0500562_000400
570 Ga0500595_013529
571 Ga0500642_0010664
572 Ga0500652_000332
573 Ga0500568_0003656
574 Ga0500616_0011246
575 Ga0500637_0010972
576 Ga0500552_000435
577 Ga0501084_0017650
578 Ga0590071_001284
579 Ga0501082_0009159
580 Ga0501082_0483599
581 Ga0530510_0040161
582 Ga0530510_0062065
583 2512033281
584 2523105734
585 2599104536
586 2617914858
587 2821450093
588 2831430314
589 2842336491
590 2844536662
591 2846953630
592 2848697073
593 2848860186
594 2849665360
595 2883296084
596 2883358843
597 2886629286
598 2897809904
599 2913845673
600 2913913300
601 2913915813
602 2913944720
603 642599798
604 8054004858

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

32

337

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfk-assembly2.cif.gz_D the crystal structure of unliganded phosphofructokinase from escherichia coli 0.9531 5 335
1mto-assembly2.cif.gz_E crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate 0.9446 5 356
3pfk-assembly1.cif.gz_A phosphofructokinase. structure and control 0.9425 5 356
3u39-assembly1.cif.gz_A crystal structure of the apo bacillus stearothermophilus phosphofructokinase 0.9412 5 356
4i4i-assembly1.cif.gz_D crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep 0.94 5 356
ID Description Score Start End Superfamily
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9484 5 334 3.40.50.450
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9363 5 334 3.40.50.450
2pfkC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9278 158 285 3.40.50.460
af_Q27483_177_317_3.40.50.460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9135 161 308 3.40.50.460
af_P52034_186_305_3.40.50.460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9124 161 289 3.40.50.460

Map