F395947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 198 | 289 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10007797|Ga0207671_100077976 |
| Length | 300 |
| Sequence | MAEPKNPPLQGEEDQPKAGGGVEADATLQGRIWDFLDIHRGTAPLVVGFPHTGTDLPPELEHAFVSPWLARKDADWWIDRLYAFARDLGATTIRTRLSRSVIDCNRDPSGASLYPGQTTTGLCPTETFDGEPLYPGPGPDPAEIDRRRTAYFDPYHEALATELMRLRTMHRNVVLYDAHSIRSHMPRLFEGELPQFNIGTNNGETCDPALAGAVAAICAASGHGHVLDGRFRGGWTTRHYGRPADGIHAIQMELSMRGYMAEPDVPSSDNWPSPIDPEPAILPILRQVLDACLSFAKEHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 6 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 7 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 8 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 9 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 10 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 11 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 12 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 13 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 145 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 184 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 189 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 190 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 195 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 197 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 0 |
| Isolates | 3.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.64 |
| Nodule | 0 |
| Rhizoplane | 4.32 |
| Rhizosphere | 74.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2017366 | 2162886007 | Bacteria | 4867 |
| 2 | JGI24736J21556_1000045 | 3300001904 | Bacteria | 20426 |
| 3 | JGI24740J21852_10037585 | 3300001979 | Bacteria | 1493 |
| 4 | JGI24735J21928_10014211 | 3300002067 | Bacteria | 2495 |
| 5 | JGI24738J21930_10005873 | 3300002075 | Bacteria | 2916 |
| 6 | JGI24738J21930_10014604 | 3300002075 | Bacteria | 1683 |
| 7 | JGI24749J21850_1000691 | 3300002076 | Bacteria | 4854 |
| 8 | JGI24751J29686_10001242 | 3300002459 | Bacteria | 5384 |
| 9 | JGI25165J46597_1000065 | 3300003214 | Bacteria | 199761 |
| 10 | rootH1_10084969 | 3300003323 | Bacteria | 1278 |
| 11 | Ga0065704_10070693 | 3300005289 | Bacteria | 17584 |
| 12 | Ga0065707_10162279 | 3300005295 | Bacteria | 1553 |
| 13 | Ga0070658_10024113 | 3300005327 | Bacteria | 4881 |
| 14 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 15 | Ga0070666_10146284 | 3300005335 | Bacteria | 1647 |
| 16 | Ga0070682_100071946 | 3300005337 | Bacteria | 2215 |
| 17 | Ga0070668_100000099 | 3300005347 | Bacteria | 52778 |
| 18 | Ga0070668_100026386 | 3300005347 | Bacteria | 4409 |
| 19 | Ga0070669_100000057 | 3300005353 | Bacteria | 110803 |
| 20 | Ga0070669_100000082 | 3300005353 | Bacteria | 91465 |
| 21 | Ga0070669_100008072 | 3300005353 | Bacteria | 7521 |
| 22 | Ga0070671_100013142 | 3300005355 | Bacteria | 6670 |
| 23 | Ga0070674_100035121 | 3300005356 | Bacteria | 3355 |
| 24 | Ga0070667_100000038 | 3300005367 | Bacteria | 171914 |
| 25 | Ga0070667_100000672 | 3300005367 | Bacteria | 33160 |
| 26 | Ga0070667_100007515 | 3300005367 | Bacteria | 9037 |
| 27 | Ga0070663_100041826 | 3300005455 | Bacteria | 3217 |
| 28 | Ga0070662_100212041 | 3300005457 | Bacteria | 1541 |
| 29 | Ga0068867_100082662 | 3300005459 | Bacteria | 2423 |
| 30 | Ga0070685_10202880 | 3300005466 | Bacteria | 1290 |
| 31 | Ga0068853_100492864 | 3300005539 | Bacteria | 1156 |
| 32 | Ga0070672_100004419 | 3300005543 | Bacteria | 9199 |
| 33 | Ga0070665_100001751 | 3300005548 | Bacteria | 24831 |
| 34 | Ga0070665_100016355 | 3300005548 | Bacteria | 7438 |
| 35 | Ga0068855_100487908 | 3300005563 | Bacteria | 1340 |
| 36 | Ga0068857_100110888 | 3300005577 | Bacteria | 2466 |
| 37 | Ga0068857_100252573 | 3300005577 | Bacteria | 1617 |
| 38 | Ga0068857_100370040 | 3300005577 | Bacteria | 1329 |
| 39 | Ga0068854_100003006 | 3300005578 | Bacteria | 10469 |
| 40 | Ga0068854_100188392 | 3300005578 | Bacteria | 1615 |
| 41 | Ga0068856_100590816 | 3300005614 | Bacteria | 1131 |
| 42 | Ga0068852_100390221 | 3300005616 | Bacteria | 1367 |
| 43 | Ga0068859_100233384 | 3300005617 | Bacteria | 1928 |
| 44 | Ga0068859_100358515 | 3300005617 | Bacteria | 1553 |
| 45 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 46 | Ga0068861_100012010 | 3300005719 | Bacteria | 6033 |
| 47 | Ga0068861_100169056 | 3300005719 | Bacteria | 1810 |
| 48 | Ga0068863_100000255 | 3300005841 | Bacteria | 55911 |
| 49 | Ga0068863_100013085 | 3300005841 | Bacteria | 8004 |
| 50 | Ga0068863_100360209 | 3300005841 | Bacteria | 1418 |
| 51 | Ga0068858_100000122 | 3300005842 | Bacteria | 80502 |
| 52 | Ga0068860_100010442 | 3300005843 | Bacteria | 9180 |
| 53 | Ga0068860_100042324 | 3300005843 | Bacteria | 4351 |
| 54 | Ga0068860_100049413 | 3300005843 | Bacteria | 4006 |
| 55 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 56 | Ga0068862_100000044 | 3300005844 | Bacteria | 156665 |
| 57 | Ga0068862_100002235 | 3300005844 | Bacteria | 17358 |
| 58 | Ga0068862_100050740 | 3300005844 | Bacteria | 3546 |
| 59 | Ga0068862_100341179 | 3300005844 | Bacteria | 1388 |
| 60 | Ga0081455_10033261 | 3300005937 | Bacteria | 4636 |
| 61 | Ga0081538_10007791 | 3300005981 | Bacteria | 9198 |
| 62 | Ga0075368_10001106 | 3300006042 | Bacteria | 8497 |
| 63 | Ga0075363_100064893 | 3300006048 | Bacteria | 1973 |
| 64 | Ga0075367_10000203 | 3300006178 | Bacteria | 19754 |
| 65 | Ga0075428_100002982 | 3300006844 | Bacteria | 18442 |
| 66 | Ga0075430_100025807 | 3300006846 | Bacteria | 4999 |
| 67 | Ga0075431_100028315 | 3300006847 | Bacteria | 5755 |
| 68 | Ga0075431_100049592 | 3300006847 | Bacteria | 4328 |
| 69 | Ga0075431_100065306 | 3300006847 | Bacteria | 3758 |
| 70 | Ga0068865_100132860 | 3300006881 | Bacteria | 1867 |
| 71 | Ga0097620_100233386 | 3300006931 | Bacteria | 1928 |
| 72 | Ga0097620_100358506 | 3300006931 | Bacteria | 1553 |
| 73 | Ga0105251_10082890 | 3300009011 | Bacteria | 1481 |
| 74 | Ga0105251_10082891 | 3300009011 | Bacteria | 1481 |
| 75 | Ga0105240_10009191 | 3300009093 | Bacteria | 14016 |
| 76 | Ga0105240_10030107 | 3300009093 | Bacteria | 7060 |
| 77 | Ga0105240_10095094 | 3300009093 | Bacteria | 3633 |
| 78 | Ga0111539_10234914 | 3300009094 | Bacteria | 2134 |
| 79 | Ga0111539_10483946 | 3300009094 | Bacteria | 1441 |
| 80 | Ga0105245_10016967 | 3300009098 | Bacteria | 6356 |
| 81 | Ga0105241_10254582 | 3300009174 | Bacteria | 1490 |
| 82 | Ga0105242_10261377 | 3300009176 | Bacteria | 1564 |
| 83 | Ga0105248_10008804 | 3300009177 | Bacteria | 11084 |
| 84 | Ga0105248_10291605 | 3300009177 | Bacteria | 1837 |
| 85 | Ga0105248_10412416 | 3300009177 | Bacteria | 1521 |
| 86 | Ga0105237_10154817 | 3300009545 | Bacteria | 2289 |
| 87 | Ga0105237_10186498 | 3300009545 | Bacteria | 2074 |
| 88 | Ga0105238_10002228 | 3300009551 | Bacteria | 19578 |
| 89 | Ga0105238_10081923 | 3300009551 | Bacteria | 3217 |
| 90 | Ga0105238_10452727 | 3300009551 | Bacteria | 1281 |
| 91 | Ga0105249_10000045 | 3300009553 | Bacteria | 182927 |
| 92 | Ga0105249_10028451 | 3300009553 | Bacteria | 5044 |
| 93 | Ga0105249_10402266 | 3300009553 | Bacteria | 1400 |
| 94 | Ga0105239_10000105 | 3300010375 | Bacteria | 117635 |
| 95 | Ga0105239_10294333 | 3300010375 | Bacteria | 1828 |
| 96 | Ga0157370_10100112 | 3300013104 | Bacteria | 2716 |
| 97 | Ga0157369_10365569 | 3300013105 | Bacteria | 1498 |
| 98 | Ga0163162_10291567 | 3300013306 | Bacteria | 1763 |
| 99 | Ga0157372_10153437 | 3300013307 | Bacteria | 2659 |
| 100 | Ga0157375_10508587 | 3300013308 | Bacteria | 1368 |
| 101 | Ga0163163_10112299 | 3300014325 | Bacteria | 2754 |
| 102 | Ga0157380_10000031 | 3300014326 | Bacteria | 90245 |
| 103 | Ga0157380_10050264 | 3300014326 | Bacteria | 3292 |
| 104 | Ga0157376_10329141 | 3300014969 | Bacteria | 1455 |
| 105 | Ga0163161_10022840 | 3300017792 | Bacteria | 4407 |
| 106 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 107 | Ga0207656_10014395 | 3300025321 | Bacteria | 3046 |
| 108 | Ga0207696_1037198 | 3300025711 | Bacteria | 1442 |
| 109 | Ga0207713_1006742 | 3300025735 | Bacteria | 6934 |
| 110 | Ga0207713_1068530 | 3300025735 | Bacteria | 1319 |
| 111 | Ga0207710_10026144 | 3300025900 | Bacteria | 2520 |
| 112 | Ga0207680_10272878 | 3300025903 | Bacteria | 1173 |
| 113 | Ga0207647_10010878 | 3300025904 | Bacteria | 6403 |
| 114 | Ga0207645_10008093 | 3300025907 | Bacteria | 7374 |
| 115 | Ga0207705_10174942 | 3300025909 | Bacteria | 1617 |
| 116 | Ga0207654_10064238 | 3300025911 | Bacteria | 2157 |
| 117 | Ga0207654_10104016 | 3300025911 | Bacteria | 1755 |
| 118 | Ga0207695_10003675 | 3300025913 | Bacteria | 21388 |
| 119 | Ga0207695_10031618 | 3300025913 | Bacteria | 5802 |
| 120 | Ga0207695_10089228 | 3300025913 | Bacteria | 3101 |
| 121 | Ga0207695_10220732 | 3300025913 | Bacteria | 1803 |
| 122 | Ga0207671_10002439 | 3300025914 | Bacteria | 19902 |
| 123 | Ga0207671_10007797 | 3300025914 | Bacteria | 9211 |
| 124 | Ga0207671_10008621 | 3300025914 | Bacteria | 8615 |
| 125 | Ga0207657_10073085 | 3300025919 | Bacteria | 2899 |
| 126 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 127 | Ga0207681_10000139 | 3300025923 | Bacteria | 60094 |
| 128 | Ga0207681_10004295 | 3300025923 | Bacteria | 8796 |
| 129 | Ga0207694_10001388 | 3300025924 | Bacteria | 20808 |
| 130 | Ga0207694_10062726 | 3300025924 | Bacteria | 2894 |
| 131 | Ga0207694_10063438 | 3300025924 | Bacteria | 2878 |
| 132 | Ga0207694_10112367 | 3300025924 | Bacteria | 2168 |
| 133 | Ga0207694_10165174 | 3300025924 | Bacteria | 1790 |
| 134 | Ga0207694_10349764 | 3300025924 | Bacteria | 1223 |
| 135 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 136 | Ga0207687_10043911 | 3300025927 | Bacteria | 3082 |
| 137 | Ga0207706_10003176 | 3300025933 | Bacteria | 15789 |
| 138 | Ga0207706_10027684 | 3300025933 | Bacteria | 5067 |
| 139 | Ga0207706_10052699 | 3300025933 | Bacteria | 3592 |
| 140 | Ga0207691_10002479 | 3300025940 | Bacteria | 18051 |
| 141 | Ga0207691_10016487 | 3300025940 | Bacteria | 7013 |
| 142 | Ga0207711_10002975 | 3300025941 | Bacteria | 14809 |
| 143 | Ga0207711_10459845 | 3300025941 | Bacteria | 1185 |
| 144 | Ga0207712_10000078 | 3300025961 | Bacteria | 117785 |
| 145 | Ga0207712_10027984 | 3300025961 | Bacteria | 3767 |
| 146 | Ga0207668_10000589 | 3300025972 | Bacteria | 22573 |
| 147 | Ga0207668_10330818 | 3300025972 | Bacteria | 1267 |
| 148 | Ga0207668_10403016 | 3300025972 | Bacteria | 1157 |
| 149 | Ga0207640_10164864 | 3300025981 | Bacteria | 1644 |
| 150 | Ga0207658_10000029 | 3300025986 | Bacteria | 171928 |
| 151 | Ga0207658_10001923 | 3300025986 | Bacteria | 15501 |
| 152 | Ga0207658_10006268 | 3300025986 | Bacteria | 8127 |
| 153 | Ga0207703_10000159 | 3300026035 | Bacteria | 78106 |
| 154 | Ga0207639_10027129 | 3300026041 | Bacteria | 4168 |
| 155 | Ga0207639_10282554 | 3300026041 | Bacteria | 1460 |
| 156 | Ga0207678_10021236 | 3300026067 | Bacteria | 5691 |
| 157 | Ga0207702_10020163 | 3300026078 | Bacteria | 5523 |
| 158 | Ga0207641_10000343 | 3300026088 | Bacteria | 56041 |
| 159 | Ga0207641_10029832 | 3300026088 | Bacteria | 4511 |
| 160 | Ga0207641_10314990 | 3300026088 | Bacteria | 1482 |
| 161 | Ga0207648_10003167 | 3300026089 | Bacteria | 17348 |
| 162 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 163 | Ga0207674_10071257 | 3300026116 | Bacteria | 3492 |
| 164 | Ga0207674_10153221 | 3300026116 | Bacteria | 2261 |
| 165 | Ga0207674_10179545 | 3300026116 | Bacteria | 2068 |
| 166 | Ga0207674_10342773 | 3300026116 | Bacteria | 1445 |
| 167 | Ga0207675_100004907 | 3300026118 | Bacteria | 12886 |
| 168 | Ga0207698_10255955 | 3300026142 | Bacteria | 1605 |
| 169 | Ga0207698_10431493 | 3300026142 | Bacteria | 1267 |
| 170 | Ga0209982_1006709 | 3300027552 | Bacteria | 1677 |
| 171 | Ga0209971_1004557 | 3300027682 | Bacteria | 3288 |
| 172 | Ga0209813_10000045 | 3300027866 | Bacteria | 50254 |
| 173 | Ga0209974_10021065 | 3300027876 | Bacteria | 2160 |
| 174 | Ga0268266_10000127 | 3300028379 | Bacteria | 149198 |
| 175 | Ga0268266_10005633 | 3300028379 | Bacteria | 11624 |
| 176 | Ga0268266_10031090 | 3300028379 | Bacteria | 4533 |
| 177 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 178 | Ga0268265_10000045 | 3300028380 | Bacteria | 180378 |
| 179 | Ga0268265_10003980 | 3300028380 | Bacteria | 10412 |
| 180 | Ga0268265_10047990 | 3300028380 | Bacteria | 3203 |
| 181 | Ga0268265_10293080 | 3300028380 | Bacteria | 1461 |
| 182 | Ga0268264_10000440 | 3300028381 | Bacteria | 57263 |
| 183 | Ga0268264_10040763 | 3300028381 | Bacteria | 3837 |
| 184 | Ga0268264_10072287 | 3300028381 | Bacteria | 2925 |
| 185 | Ga0307513_10084536 | 3300031456 | Bacteria | 3259 |
| 186 | Ga0307509_10275103 | 3300031507 | Bacteria | 1449 |
| 187 | Ga0307408_100075506 | 3300031548 | Bacteria | 2504 |
| 188 | Ga0307508_10000302 | 3300031616 | Bacteria | 60090 |
| 189 | Ga0307405_10003711 | 3300031731 | Bacteria | 7088 |
| 190 | Ga0307405_10005702 | 3300031731 | Bacteria | 6042 |
| 191 | Ga0307413_10011743 | 3300031824 | Bacteria | 4325 |
| 192 | Ga0307410_10020242 | 3300031852 | Bacteria | 4066 |
| 193 | Ga0307406_10021068 | 3300031901 | Bacteria | 3850 |
| 194 | Ga0307412_10605184 | 3300031911 | Bacteria | 929 |
| 195 | Ga0307409_100003772 | 3300031995 | Bacteria | 8341 |
| 196 | Ga0307409_100118672 | 3300031995 | Bacteria | 2235 |
| 197 | Ga0307416_100310436 | 3300032002 | Bacteria | 1573 |
| 198 | Ga0307414_10004890 | 3300032004 | Bacteria | 7319 |
| 199 | Ga0307414_10065414 | 3300032004 | Bacteria | 2594 |
| 200 | Ga0307411_10012700 | 3300032005 | Bacteria | 4611 |
| 201 | Ga0307415_100043264 | 3300032126 | Bacteria | 3004 |
| 202 | Ga0307510_10234522 | 3300033180 | Bacteria | 1335 |
| 203 | Ga0373944_0002416 | 3300035089 | Bacteria | 4743 |
| 204 | Ga0373946_0006756 | 3300035171 | Bacteria | 4168 |
| 205 | Ga0373925_0370891 | 3300037068 | Bacteria | 1165 |
| 206 | Ga0395898_0002683 | 3300037466 | Bacteria | 20607 |
| 207 | Ga0395898_0199566 | 3300037466 | Bacteria | 1910 |
| 208 | Ga0395905_0008862 | 3300037471 | Bacteria | 9883 |
| 209 | Ga0451787_560951 | 3300041441 | Bacteria | 1546 |
| 210 | Ga0451807_1383667 | 3300041486 | Bacteria | 1538 |
| 211 | Ga0439444_0013155 | 3300042437 | Bacteria | 1367 |
| 212 | Ga0453684_0245064 | 3300044712 | Bacteria | 2061 |
| 213 | Ga0495627_000248 | 3300046453 | Bacteria | 56262 |
| 214 | Ga0495638_0000470 | 3300046460 | Bacteria | 48486 |
| 215 | Ga0495650_0004372 | 3300046471 | Bacteria | 9726 |
| 216 | Ga0495630_0529712 | 3300046517 | Bacteria | 903 |
| 217 | Ga0495632_0078338 | 3300046519 | Bacteria | 1579 |
| 218 | Ga0495644_0033601 | 3300046523 | Bacteria | 1937 |
| 219 | Ga0495648_0008692 | 3300046524 | Bacteria | 7959 |
| 220 | Ga0495587_0048005 | 3300046536 | Bacteria | 2530 |
| 221 | Ga0495625_0154343 | 3300046660 | Bacteria | 1542 |
| 222 | Ga0495670_0337072 | 3300046691 | Bacteria | 811 |
| 223 | Ga0495674_0046474 | 3300047319 | Bacteria | 3853 |
| 224 | Ga0495686_0000278 | 3300047472 | Bacteria | 90520 |
| 225 | Ga0496101_0081021 | 3300048904 | Bacteria | 2399 |
| 226 | Ga0496102_0000284 | 3300048905 | Bacteria | 64681 |
| 227 | Ga0496103_0000081 | 3300048906 | Bacteria | 109734 |
| 228 | Ga0496103_0000176 | 3300048906 | Bacteria | 65606 |
| 229 | Ga0496104_0000081 | 3300048907 | Bacteria | 94514 |
| 230 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 231 | Ga0496105_0391265 | 3300048908 | Bacteria | 1105 |
| 232 | Ga0496111_0260106 | 3300048914 | Bacteria | 1288 |
| 233 | Ga0496112_0402521 | 3300048915 | Bacteria | 1308 |
| 234 | Ga0496113_0000118 | 3300048916 | Bacteria | 34086 |
| 235 | Ga0496115_0191281 | 3300048918 | Bacteria | 1691 |
| 236 | Ga0496116_0002314 | 3300048919 | Bacteria | 20195 |
| 237 | Ga0496117_0000146 | 3300048920 | Bacteria | 152244 |
| 238 | Ga0496117_0000501 | 3300048920 | Bacteria | 64696 |
| 239 | Ga0496118_0000503 | 3300048921 | Bacteria | 64696 |
| 240 | Ga0496118_0004051 | 3300048921 | Bacteria | 17777 |
| 241 | Ga0496118_0012866 | 3300048921 | Bacteria | 7976 |
| 242 | Ga0496118_0268304 | 3300048921 | Bacteria | 958 |
| 243 | Ga0496118_0289494 | 3300048921 | Bacteria | 906 |
| 244 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 245 | Ga0496120_0022518 | 3300048923 | Bacteria | 3961 |
| 246 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 247 | Ga0496121_0000176 | 3300048924 | Bacteria | 142585 |
| 248 | Ga0496121_0000319 | 3300048924 | Bacteria | 100692 |
| 249 | Ga0496121_0005467 | 3300048924 | Bacteria | 16277 |
| 250 | Ga0496121_0013781 | 3300048924 | Bacteria | 8654 |
| 251 | Ga0496121_0125985 | 3300048924 | Bacteria | 1925 |
| 252 | Ga0496122_0000723 | 3300048925 | Bacteria | 64694 |
| 253 | Ga0496122_0019015 | 3300048925 | Bacteria | 6302 |
| 254 | Ga0496123_0001828 | 3300048926 | Bacteria | 27963 |
| 255 | Ga0496123_0064449 | 3300048926 | Bacteria | 2335 |
| 256 | Ga0496124_0000534 | 3300048927 | Bacteria | 64668 |
| 257 | Ga0496124_0003533 | 3300048927 | Bacteria | 19028 |
| 258 | Ga0496125_0016652 | 3300048928 | Bacteria | 7048 |
| 259 | Ga0496125_0137536 | 3300048928 | Bacteria | 1705 |
| 260 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 261 | Ga0496126_0014410 | 3300048929 | Bacteria | 7994 |
| 262 | Ga0496126_0156506 | 3300048929 | Bacteria | 1950 |
| 263 | Ga0501073_0026783 | 3300049589 | Bacteria | 4128 |
| 264 | Ga0501075_0057213 | 3300049591 | Bacteria | 2936 |
| 265 | Ga0501075_0308569 | 3300049591 | Bacteria | 1206 |
| 266 | Ga0501045_0214637 | 3300049824 | Bacteria | 1433 |
| 267 | nmdc:mga03n38_116654_c1 | 3300050490 | Bacteria | 1307 |
| 268 | nmdc:mga0k408_196683_c1 | 3300050493 | Bacteria | 1203 |
| 269 | nmdc:mga06z11_124_c1 | 3300050494 | Bacteria | 31823 |
| 270 | nmdc:mga04h51_2327_c1 | 3300050495 | Bacteria | 4496 |
| 271 | nmdc:mga06r32_12663_c1 | 3300050510 | Bacteria | 7623 |
| 272 | nmdc:mga06r32_132992_c1 | 3300050510 | Bacteria | 2461 |
| 273 | nmdc:mga08y16_390165_c1 | 3300050511 | Bacteria | 1426 |
| 274 | nmdc:mga08y16_432278_c1 | 3300050511 | Bacteria | 1344 |
| 275 | nmdc:mga08y16_79433_c1 | 3300050511 | Bacteria | 3419 |
| 276 | Ga0500643_000177 | 3300053087 | Bacteria | 63023 |
| 277 | Ga0500643_001053 | 3300053087 | Bacteria | 16728 |
| 278 | Ga0500643_001105 | 3300053087 | Bacteria | 16152 |
| 279 | Ga0500595_074593 | 3300053119 | Bacteria | 1001 |
| 280 | Ga0500618_002932 | 3300053125 | Bacteria | 6101 |
| 281 | Ga0500658_0038254 | 3300053134 | Bacteria | 1911 |
| 282 | Ga0500559_0075222 | 3300053136 | Bacteria | 1527 |
| 283 | Ga0500559_0152073 | 3300053136 | Bacteria | 1086 |
| 284 | Ga0500622_0056350 | 3300053156 | Bacteria | 2012 |
| 285 | Ga0500634_0153780 | 3300053161 | Bacteria | 1071 |
| 286 | Ga0500636_0011537 | 3300053177 | Bacteria | 5173 |
| 287 | Ga0500596_022173 | 3300053735 | Bacteria | 959 |
| 288 | Ga0500661_000142 | 3300055283 | Bacteria | 12130 |
| 289 | Ga0530510_0128606 | 3300061734 | Bacteria | 1863 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046691 | Ga0495670_0337072 | Ga0495670_0337072_42_725 | 222 |
| 2 | 3300046523 | Ga0495644_0033601 | Ga0495644_0033601_23_718 | 226 |
| 3 | 3300046517 | Ga0495630_0529712 | Ga0495630_0529712_17_745 | 234 |
| 4 | 3300048918 | Ga0496115_0191281 | Ga0496115_0191281_323_1033 | 236 |
| 5 | 3300053087 | Ga0500643_000177 | Ga0500643_000177_46518_47327 | 239 |
| 6 | 3300037466 | Ga0395898_0199566 | Ga0395898_0199566_933_1709 | 240 |
| 7 | 3300061734 | Ga0530510_0128606 | Ga0530510_0128606_458_1255 | 241 |
| 8 | 3300005981 | Ga0081538_10007791 | Ga0081538_100077912 | 247 |
| 9 | 3300026041 | Ga0207639_10282554 | Ga0207639_102825541 | 247 |
| 10 | 3300031548 | Ga0307408_100075506 | Ga0307408_1000755062 | 252 |
| 11 | 3300031731 | Ga0307405_10005702 | Ga0307405_100057022 | 252 |
| 12 | 3300031824 | Ga0307413_10011743 | Ga0307413_100117432 | 252 |
| 13 | 3300031852 | Ga0307410_10020242 | Ga0307410_100202423 | 252 |
| 14 | 3300031901 | Ga0307406_10021068 | Ga0307406_100210683 | 252 |
| 15 | 3300031911 | Ga0307412_10605184 | Ga0307412_106051842 | 252 |
| 16 | 3300031995 | Ga0307409_100003772 | Ga0307409_1000037724 | 252 |
| 17 | 3300032002 | Ga0307416_100310436 | Ga0307416_1003104362 | 252 |
| 18 | 3300032005 | Ga0307411_10012700 | Ga0307411_100127002 | 252 |
| 19 | 3300032126 | Ga0307415_100043264 | Ga0307415_1000432642 | 252 |
| 20 | 3300050493 | nmdc:mga0k408_196683_c1 | nmdc:mga0k408_196683_c1_272_1078 | 253 |
| 21 | 3300053087 | Ga0500643_001053 | Ga0500643_001053_3424_4218 | 253 |
| 22 | 3300053087 | Ga0500643_001105 | Ga0500643_001105_12229_13023 | 253 |
| 23 | 3300002075 | JGI24738J21930_10014604 | JGI24738J21930_100146042 | 255 |
| 24 | 3300005937 | Ga0081455_10033261 | Ga0081455_100332613 | 255 |
| 25 | 3300035089 | Ga0373944_0002416 | Ga0373944_0002416_1006_1803 | 255 |
| 26 | 3300035171 | Ga0373946_0006756 | Ga0373946_0006756_2790_3587 | 255 |
| 27 | 3300049591 | Ga0501075_0308569 | Ga0501075_0308569_244_1041 | 255 |
| 28 | iso_pu_bacteria | 2512564014 | 2512642209 | 257 |
| 29 | 3300005842 | Ga0068858_100000122 | Ga0068858_10000012269 | 258 |
| 30 | 3300026035 | Ga0207703_10000159 | Ga0207703_1000015910 | 258 |
| 31 | 3300046460 | Ga0495638_0000470 | Ga0495638_0000470_5725_6534 | 258 |
| 32 | 3300046660 | Ga0495625_0154343 | Ga0495625_0154343_520_1329 | 258 |
| 33 | 3300053134 | Ga0500658_0038254 | Ga0500658_0038254_166_975 | 258 |
| 34 | 3300001904 | JGI24736J21556_1000045 | JGI24736J21556_100004523 | 259 |
| 35 | 3300001979 | JGI24740J21852_10037585 | JGI24740J21852_100375852 | 259 |
| 36 | 3300002067 | JGI24735J21928_10014211 | JGI24735J21928_100142112 | 259 |
| 37 | 3300002075 | JGI24738J21930_10005873 | JGI24738J21930_100058732 | 259 |
| 38 | 3300002076 | JGI24749J21850_1000691 | JGI24749J21850_10006912 | 259 |
| 39 | 3300002459 | JGI24751J29686_10001242 | JGI24751J29686_100012424 | 259 |
| 40 | 3300003214 | JGI25165J46597_1000065 | JGI25165J46597_1000065175 | 259 |
| 41 | 3300005295 | Ga0065707_10162279 | Ga0065707_101622792 | 259 |
| 42 | 3300005327 | Ga0070658_10024113 | Ga0070658_100241137 | 259 |
| 43 | 3300005331 | Ga0070670_100000005 | Ga0070670_100000005231 | 259 |
| 44 | 3300005347 | Ga0070668_100000099 | Ga0070668_10000009913 | 259 |
| 45 | 3300005347 | Ga0070668_100026386 | Ga0070668_1000263864 | 259 |
| 46 | 3300005353 | Ga0070669_100000057 | Ga0070669_10000005785 | 259 |
| 47 | 3300005353 | Ga0070669_100008072 | Ga0070669_1000080724 | 259 |
| 48 | 3300005367 | Ga0070667_100000038 | Ga0070667_100000038140 | 259 |
| 49 | 3300005367 | Ga0070667_100000672 | Ga0070667_10000067212 | 259 |
| 50 | 3300005455 | Ga0070663_100041826 | Ga0070663_1000418262 | 259 |
| 51 | 3300005457 | Ga0070662_100212041 | Ga0070662_1002120412 | 259 |
| 52 | 3300005539 | Ga0068853_100492864 | Ga0068853_1004928642 | 259 |
| 53 | 3300005563 | Ga0068855_100487908 | Ga0068855_1004879082 | 259 |
| 54 | 3300005577 | Ga0068857_100110888 | Ga0068857_1001108882 | 259 |
| 55 | 3300005577 | Ga0068857_100370040 | Ga0068857_1003700402 | 259 |
| 56 | 3300005578 | Ga0068854_100003006 | Ga0068854_1000030069 | 259 |
| 57 | 3300005578 | Ga0068854_100188392 | Ga0068854_1001883922 | 259 |
| 58 | 3300005616 | Ga0068852_100390221 | Ga0068852_1003902212 | 259 |
| 59 | 3300005617 | Ga0068859_100233384 | Ga0068859_1002333842 | 259 |
| 60 | 3300005618 | Ga0068864_100000011 | Ga0068864_100000011229 | 259 |
| 61 | 3300005719 | Ga0068861_100012010 | Ga0068861_1000120102 | 259 |
| 62 | 3300005841 | Ga0068863_100000255 | Ga0068863_10000025514 | 259 |
| 63 | 3300005843 | Ga0068860_100042324 | Ga0068860_1000423244 | 259 |
| 64 | 3300005844 | Ga0068862_100000011 | Ga0068862_1000000113 | 259 |
| 65 | 3300006931 | Ga0097620_100233386 | Ga0097620_1002333862 | 259 |
| 66 | 3300009093 | Ga0105240_10009191 | Ga0105240_1000919117 | 259 |
| 67 | 3300009093 | Ga0105240_10095094 | Ga0105240_100950942 | 259 |
| 68 | 3300009177 | Ga0105248_10008804 | Ga0105248_100088048 | 259 |
| 69 | 3300009545 | Ga0105237_10154817 | Ga0105237_101548172 | 259 |
| 70 | 3300009545 | Ga0105237_10186498 | Ga0105237_101864982 | 259 |
| 71 | 3300009551 | Ga0105238_10002228 | Ga0105238_100022282 | 259 |
| 72 | 3300009551 | Ga0105238_10452727 | Ga0105238_104527272 | 259 |
| 73 | 3300010375 | Ga0105239_10000105 | Ga0105239_1000010567 | 259 |
| 74 | 3300010375 | Ga0105239_10294333 | Ga0105239_102943332 | 259 |
| 75 | 3300013104 | Ga0157370_10100112 | Ga0157370_101001122 | 259 |
| 76 | 3300014325 | Ga0163163_10112299 | Ga0163163_101122992 | 259 |
| 77 | 3300014326 | Ga0157380_10000031 | Ga0157380_1000003188 | 259 |
| 78 | 3300017792 | Ga0163161_10022840 | Ga0163161_100228404 | 259 |
| 79 | 3300025261 | Ga0209233_1000107 | Ga0209233_100010733 | 259 |
| 80 | 3300025321 | Ga0207656_10014395 | Ga0207656_100143953 | 259 |
| 81 | 3300025904 | Ga0207647_10010878 | Ga0207647_100108782 | 259 |
| 82 | 3300025911 | Ga0207654_10064238 | Ga0207654_100642382 | 259 |
| 83 | 3300025911 | Ga0207654_10104016 | Ga0207654_101040162 | 259 |
| 84 | 3300025913 | Ga0207695_10003675 | Ga0207695_1000367515 | 259 |
| 85 | 3300025913 | Ga0207695_10089228 | Ga0207695_100892282 | 259 |
| 86 | 3300025913 | Ga0207695_10220732 | Ga0207695_102207322 | 259 |
| 87 | 3300025914 | Ga0207671_10002439 | Ga0207671_100024397 | 259 |
| 88 | 3300025914 | Ga0207671_10007797 | Ga0207671_100077976 | 259 |
| 89 | 3300025919 | Ga0207657_10073085 | Ga0207657_100730852 | 259 |
| 90 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001428 | 259 |
| 91 | 3300025923 | Ga0207681_10004295 | Ga0207681_100042957 | 259 |
| 92 | 3300025924 | Ga0207694_10001388 | Ga0207694_1000138815 | 259 |
| 93 | 3300025924 | Ga0207694_10062726 | Ga0207694_100627262 | 259 |
| 94 | 3300025924 | Ga0207694_10165174 | Ga0207694_101651742 | 259 |
| 95 | 3300025924 | Ga0207694_10349764 | Ga0207694_103497642 | 259 |
| 96 | 3300025925 | Ga0207650_10000018 | Ga0207650_10000018229 | 259 |
| 97 | 3300025933 | Ga0207706_10027684 | Ga0207706_100276844 | 259 |
| 98 | 3300025933 | Ga0207706_10052699 | Ga0207706_100526992 | 259 |
| 99 | 3300025941 | Ga0207711_10002975 | Ga0207711_1000297511 | 259 |
| 100 | 3300025972 | Ga0207668_10000589 | Ga0207668_1000058913 | 259 |
| 101 | 3300025972 | Ga0207668_10330818 | Ga0207668_103308182 | 259 |
| 102 | 3300025981 | Ga0207640_10164864 | Ga0207640_101648642 | 259 |
| 103 | 3300025986 | Ga0207658_10000029 | Ga0207658_10000029139 | 259 |
| 104 | 3300025986 | Ga0207658_10001923 | Ga0207658_1000192312 | 259 |
| 105 | 3300026041 | Ga0207639_10027129 | Ga0207639_100271293 | 259 |
| 106 | 3300026067 | Ga0207678_10021236 | Ga0207678_100212364 | 259 |
| 107 | 3300026078 | Ga0207702_10020163 | Ga0207702_100201635 | 259 |
| 108 | 3300026088 | Ga0207641_10000343 | Ga0207641_1000034314 | 259 |
| 109 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004622 | 259 |
| 110 | 3300026116 | Ga0207674_10071257 | Ga0207674_100712572 | 259 |
| 111 | 3300026116 | Ga0207674_10153221 | Ga0207674_101532212 | 259 |
| 112 | 3300026116 | Ga0207674_10179545 | Ga0207674_101795452 | 259 |
| 113 | 3300026142 | Ga0207698_10255955 | Ga0207698_102559552 | 259 |
| 114 | 3300026142 | Ga0207698_10431493 | Ga0207698_104314931 | 259 |
| 115 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002444 | 259 |
| 116 | 3300028381 | Ga0268264_10040763 | Ga0268264_100407633 | 259 |
| 117 | 3300031507 | Ga0307509_10275103 | Ga0307509_102751032 | 259 |
| 118 | 3300031731 | Ga0307405_10003711 | Ga0307405_100037113 | 259 |
| 119 | 3300033180 | Ga0307510_10234522 | Ga0307510_102345222 | 259 |
| 120 | 3300044712 | Ga0453684_0245064 | Ga0453684_0245064_1210_2016 | 259 |
| 121 | 3300046471 | Ga0495650_0004372 | Ga0495650_0004372_8512_9315 | 259 |
| 122 | 3300047472 | Ga0495686_0000278 | Ga0495686_0000278_37335_38144 | 259 |
| 123 | 3300048905 | Ga0496102_0000284 | Ga0496102_0000284_47299_48108 | 259 |
| 124 | 3300048906 | Ga0496103_0000176 | Ga0496103_0000176_16568_17377 | 259 |
| 125 | 3300048908 | Ga0496105_0391265 | Ga0496105_0391265_176_985 | 259 |
| 126 | 3300048919 | Ga0496116_0002314 | Ga0496116_0002314_13538_14347 | 259 |
| 127 | 3300048920 | Ga0496117_0000501 | Ga0496117_0000501_16589_17398 | 259 |
| 128 | 3300048921 | Ga0496118_0000503 | Ga0496118_0000503_47299_48108 | 259 |
| 129 | 3300048921 | Ga0496118_0012866 | Ga0496118_0012866_5759_6568 | 259 |
| 130 | 3300048921 | Ga0496118_0268304 | Ga0496118_0268304_35_844 | 259 |
| 131 | 3300048921 | Ga0496118_0289494 | Ga0496118_0289494_59_865 | 259 |
| 132 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_346408_347217 | 259 |
| 133 | 3300048924 | Ga0496121_0000176 | Ga0496121_0000176_85552_86361 | 259 |
| 134 | 3300048924 | Ga0496121_0000319 | Ga0496121_0000319_30738_31547 | 259 |
| 135 | 3300048924 | Ga0496121_0013781 | Ga0496121_0013781_6114_6923 | 259 |
| 136 | 3300048925 | Ga0496122_0019015 | Ga0496122_0019015_2687_3493 | 259 |
| 137 | 3300048926 | Ga0496123_0064449 | Ga0496123_0064449_1420_2226 | 259 |
| 138 | 3300048927 | Ga0496124_0000534 | Ga0496124_0000534_47299_48108 | 259 |
| 139 | 3300048928 | Ga0496125_0016652 | Ga0496125_0016652_2139_2945 | 259 |
| 140 | 3300048929 | Ga0496126_0014410 | Ga0496126_0014410_1016_1825 | 259 |
| 141 | 3300048929 | Ga0496126_0156506 | Ga0496126_0156506_272_1078 | 259 |
| 142 | 3300053119 | Ga0500595_074593 | Ga0500595_074593_179_991 | 259 |
| 143 | 3300053177 | Ga0500636_0011537 | Ga0500636_0011537_2955_3794 | 259 |
| 144 | 3300053735 | Ga0500596_022173 | Ga0500596_022173_54_863 | 259 |
| 145 | 3300055283 | Ga0500661_000142 | Ga0500661_000142_5846_6664 | 259 |
| 146 | iso_pu_bacteria | 2585428106 | 2587918571 | 259 |
| 147 | iso_pu_bacteria | 2643221605 | 2644038294 | 259 |
| 148 | iso_pu_bacteria | 2643221640 | 2644224864 | 259 |
| 149 | iso_pu_bacteria | 2643221642 | 2644234202 | 259 |
| 150 | 3300013105 | Ga0157369_10365569 | Ga0157369_103655692 | 260 |
| 151 | 3300037471 | Ga0395905_0008862 | Ga0395905_0008862_4809_5618 | 260 |
| 152 | 3300048924 | Ga0496121_0125985 | Ga0496121_0125985_581_1390 | 260 |
| 153 | 3300053136 | Ga0500559_0075222 | Ga0500559_0075222_447_1268 | 260 |
| 154 | iso_pu_bacteria | 2738541275 | 2738709588 | 260 |
| 155 | iso_pu_bacteria | 2738541301 | 2738848013 | 260 |
| 156 | iso_pu_bacteria | 2738541304 | 2738863742 | 260 |
| 157 | iso_pu_bacteria | 2738543022 | 2739296260 | 260 |
| 158 | iso_pu_bacteria | 2738543033 | 2739357938 | 260 |
| 159 | iso_pu_bacteria | 2928100450 | 2928101143 | 260 |
| 160 | iso_pu_bacteria | 2928959182 | 2928960446 | 260 |
| 161 | 3300005617 | Ga0068859_100358515 | Ga0068859_1003585151 | 261 |
| 162 | 3300006042 | Ga0075368_10001106 | Ga0075368_100011064 | 261 |
| 163 | 3300006048 | Ga0075363_100064893 | Ga0075363_1000648932 | 261 |
| 164 | 3300006178 | Ga0075367_10000203 | Ga0075367_100002036 | 261 |
| 165 | 3300006931 | Ga0097620_100358506 | Ga0097620_1003585062 | 261 |
| 166 | 3300009098 | Ga0105245_10016967 | Ga0105245_100169672 | 261 |
| 167 | 3300013306 | Ga0163162_10291567 | Ga0163162_102915672 | 261 |
| 168 | 3300025927 | Ga0207687_10043911 | Ga0207687_100439112 | 261 |
| 169 | 3300027866 | Ga0209813_10000045 | Ga0209813_100000454 | 261 |
| 170 | 3300032004 | Ga0307414_10004890 | Ga0307414_100048906 | 261 |
| 171 | 3300049589 | Ga0501073_0026783 | Ga0501073_0026783_13_840 | 261 |
| 172 | 3300050490 | nmdc:mga03n38_116654_c1 | nmdc:mga03n38_116654_c1_50_862 | 261 |
| 173 | 3300050494 | nmdc:mga06z11_124_c1 | nmdc:mga06z11_124_c1_10027_10839 | 261 |
| 174 | 3300050495 | nmdc:mga04h51_2327_c1 | nmdc:mga04h51_2327_c1_492_1304 | 261 |
| 175 | 3300053125 | Ga0500618_002932 | Ga0500618_002932_5113_5922 | 261 |
| 176 | 3300053136 | Ga0500559_0152073 | Ga0500559_0152073_109_927 | 261 |
| 177 | 3300003323 | rootH1_10084969 | rootH1_100849692 | 262 |
| 178 | 3300005337 | Ga0070682_100071946 | Ga0070682_1000719462 | 262 |
| 179 | 3300005466 | Ga0070685_10202880 | Ga0070685_102028802 | 262 |
| 180 | 3300005548 | Ga0070665_100001751 | Ga0070665_1000017518 | 262 |
| 181 | 3300005548 | Ga0070665_100016355 | Ga0070665_1000163552 | 262 |
| 182 | 3300005577 | Ga0068857_100252573 | Ga0068857_1002525732 | 262 |
| 183 | 3300005614 | Ga0068856_100590816 | Ga0068856_1005908162 | 262 |
| 184 | 3300005841 | Ga0068863_100013085 | Ga0068863_1000130857 | 262 |
| 185 | 3300005841 | Ga0068863_100360209 | Ga0068863_1003602092 | 262 |
| 186 | 3300005843 | Ga0068860_100010442 | Ga0068860_1000104424 | 262 |
| 187 | 3300005844 | Ga0068862_100000044 | Ga0068862_10000004497 | 262 |
| 188 | 3300005844 | Ga0068862_100002235 | Ga0068862_10000223513 | 262 |
| 189 | 3300005844 | Ga0068862_100050740 | Ga0068862_1000507402 | 262 |
| 190 | 3300009093 | Ga0105240_10030107 | Ga0105240_100301076 | 262 |
| 191 | 3300009094 | Ga0111539_10483946 | Ga0111539_104839462 | 262 |
| 192 | 3300009174 | Ga0105241_10254582 | Ga0105241_102545821 | 262 |
| 193 | 3300009177 | Ga0105248_10412416 | Ga0105248_104124162 | 262 |
| 194 | 3300009551 | Ga0105238_10081923 | Ga0105238_100819232 | 262 |
| 195 | 3300009553 | Ga0105249_10000045 | Ga0105249_1000004593 | 262 |
| 196 | 3300013307 | Ga0157372_10153437 | Ga0157372_101534372 | 262 |
| 197 | 3300014326 | Ga0157380_10050264 | Ga0157380_100502642 | 262 |
| 198 | 3300014969 | Ga0157376_10329141 | Ga0157376_103291412 | 262 |
| 199 | 3300025900 | Ga0207710_10026144 | Ga0207710_100261442 | 262 |
| 200 | 3300025909 | Ga0207705_10174942 | Ga0207705_101749422 | 262 |
| 201 | 3300025913 | Ga0207695_10031618 | Ga0207695_100316184 | 262 |
| 202 | 3300025914 | Ga0207671_10008621 | Ga0207671_100086212 | 262 |
| 203 | 3300025924 | Ga0207694_10063438 | Ga0207694_100634383 | 262 |
| 204 | 3300025924 | Ga0207694_10112367 | Ga0207694_101123672 | 262 |
| 205 | 3300025940 | Ga0207691_10002479 | Ga0207691_100024796 | 262 |
| 206 | 3300025941 | Ga0207711_10459845 | Ga0207711_104598452 | 262 |
| 207 | 3300025961 | Ga0207712_10000078 | Ga0207712_1000007829 | 262 |
| 208 | 3300025972 | Ga0207668_10403016 | Ga0207668_104030162 | 262 |
| 209 | 3300026088 | Ga0207641_10029832 | Ga0207641_100298324 | 262 |
| 210 | 3300026088 | Ga0207641_10314990 | Ga0207641_103149902 | 262 |
| 211 | 3300026116 | Ga0207674_10342773 | Ga0207674_103427732 | 262 |
| 212 | 3300028379 | Ga0268266_10000127 | Ga0268266_100001274 | 262 |
| 213 | 3300028379 | Ga0268266_10031090 | Ga0268266_100310902 | 262 |
| 214 | 3300028380 | Ga0268265_10000045 | Ga0268265_1000004588 | 262 |
| 215 | 3300028380 | Ga0268265_10003980 | Ga0268265_100039803 | 262 |
| 216 | 3300028381 | Ga0268264_10000440 | Ga0268264_1000044047 | 262 |
| 217 | 3300031456 | Ga0307513_10084536 | Ga0307513_100845363 | 262 |
| 218 | 3300031995 | Ga0307409_100118672 | Ga0307409_1001186722 | 262 |
| 219 | 3300037068 | Ga0373925_0370891 | Ga0373925_0370891_211_1056 | 262 |
| 220 | 3300037466 | Ga0395898_0002683 | Ga0395898_0002683_4548_5393 | 262 |
| 221 | 3300041441 | Ga0451787_560951 | Ga0451787_560951_419_1261 | 262 |
| 222 | 3300041486 | Ga0451807_1383667 | Ga0451807_1383667_330_1172 | 262 |
| 223 | 3300046453 | Ga0495627_000248 | Ga0495627_000248_9777_10595 | 262 |
| 224 | 3300046519 | Ga0495632_0078338 | Ga0495632_0078338_744_1565 | 262 |
| 225 | 3300046524 | Ga0495648_0008692 | Ga0495648_0008692_1279_2097 | 262 |
| 226 | 3300046536 | Ga0495587_0048005 | Ga0495587_0048005_181_999 | 262 |
| 227 | 3300047319 | Ga0495674_0046474 | Ga0495674_0046474_729_1547 | 262 |
| 228 | 3300049591 | Ga0501075_0057213 | Ga0501075_0057213_1404_2270 | 262 |
| 229 | 3300049824 | Ga0501045_0214637 | Ga0501045_0214637_329_1195 | 262 |
| 230 | 3300050511 | nmdc:mga08y16_390165_c1 | nmdc:mga08y16_390165_c1_440_1285 | 262 |
| 231 | 3300053156 | Ga0500622_0056350 | Ga0500622_0056350_742_1566 | 262 |
| 232 | 3300053161 | Ga0500634_0153780 | Ga0500634_0153780_35_856 | 262 |
| 233 | 3300005356 | Ga0070674_100035121 | Ga0070674_1000351214 | 263 |
| 234 | 3300005459 | Ga0068867_100082662 | Ga0068867_1000826623 | 263 |
| 235 | 3300005543 | Ga0070672_100004419 | Ga0070672_10000441912 | 263 |
| 236 | 3300005719 | Ga0068861_100169056 | Ga0068861_1001690562 | 263 |
| 237 | 3300005844 | Ga0068862_100341179 | Ga0068862_1003411792 | 263 |
| 238 | 3300006846 | Ga0075430_100025807 | Ga0075430_1000258073 | 263 |
| 239 | 3300006847 | Ga0075431_100028315 | Ga0075431_1000283154 | 263 |
| 240 | 3300006847 | Ga0075431_100049592 | Ga0075431_1000495925 | 263 |
| 241 | 3300006881 | Ga0068865_100132860 | Ga0068865_1001328603 | 263 |
| 242 | 3300009176 | Ga0105242_10261377 | Ga0105242_102613772 | 263 |
| 243 | 3300009553 | Ga0105249_10402266 | Ga0105249_104022663 | 263 |
| 244 | 3300013308 | Ga0157375_10508587 | Ga0157375_105085871 | 263 |
| 245 | 3300025907 | Ga0207645_10008093 | Ga0207645_100080933 | 263 |
| 246 | 3300025933 | Ga0207706_10003176 | Ga0207706_100031763 | 263 |
| 247 | 3300025940 | Ga0207691_10016487 | Ga0207691_100164879 | 263 |
| 248 | 3300026089 | Ga0207648_10003167 | Ga0207648_1000316719 | 263 |
| 249 | 3300026118 | Ga0207675_100004907 | Ga0207675_1000049073 | 263 |
| 250 | 3300027552 | Ga0209982_1006709 | Ga0209982_10067093 | 263 |
| 251 | 3300027682 | Ga0209971_1004557 | Ga0209971_10045575 | 263 |
| 252 | 3300027876 | Ga0209974_10021065 | Ga0209974_100210653 | 263 |
| 253 | 3300028380 | Ga0268265_10047990 | Ga0268265_100479901 | 263 |
| 254 | 3300031616 | Ga0307508_10000302 | Ga0307508_100003027 | 263 |
| 255 | 3300032004 | Ga0307414_10065414 | Ga0307414_100654142 | 263 |
| 256 | 3300050510 | nmdc:mga06r32_132992_c1 | nmdc:mga06r32_132992_c1_1155_2027 | 263 |
| 257 | 3300050511 | nmdc:mga08y16_79433_c1 | nmdc:mga08y16_79433_c1_2456_3328 | 263 |
| 258 | 2162886007 | SwRhRL2b_contig_2017366 | SwRhRL2b_0436.00001840 | 264 |
| 259 | 3300005289 | Ga0065704_10070693 | Ga0065704_100706934 | 264 |
| 260 | 3300005335 | Ga0070666_10146284 | Ga0070666_101462841 | 264 |
| 261 | 3300005353 | Ga0070669_100000082 | Ga0070669_10000008239 | 264 |
| 262 | 3300005355 | Ga0070671_100013142 | Ga0070671_1000131423 | 264 |
| 263 | 3300005367 | Ga0070667_100007515 | Ga0070667_1000075156 | 264 |
| 264 | 3300005843 | Ga0068860_100049413 | Ga0068860_1000494132 | 264 |
| 265 | 3300006844 | Ga0075428_100002982 | Ga0075428_1000029829 | 264 |
| 266 | 3300006847 | Ga0075431_100065306 | Ga0075431_1000653063 | 264 |
| 267 | 3300009011 | Ga0105251_10082890 | Ga0105251_100828902 | 264 |
| 268 | 3300009011 | Ga0105251_10082891 | Ga0105251_100828912 | 264 |
| 269 | 3300009094 | Ga0111539_10234914 | Ga0111539_102349142 | 264 |
| 270 | 3300009177 | Ga0105248_10291605 | Ga0105248_102916052 | 264 |
| 271 | 3300009553 | Ga0105249_10028451 | Ga0105249_100284512 | 264 |
| 272 | 3300025711 | Ga0207696_1037198 | Ga0207696_10371982 | 264 |
| 273 | 3300025735 | Ga0207713_1006742 | Ga0207713_10067423 | 264 |
| 274 | 3300025735 | Ga0207713_1068530 | Ga0207713_10685302 | 264 |
| 275 | 3300025903 | Ga0207680_10272878 | Ga0207680_102728781 | 264 |
| 276 | 3300025923 | Ga0207681_10000139 | Ga0207681_1000013939 | 264 |
| 277 | 3300025961 | Ga0207712_10027984 | Ga0207712_100279843 | 264 |
| 278 | 3300025986 | Ga0207658_10006268 | Ga0207658_100062684 | 264 |
| 279 | 3300028379 | Ga0268266_10005633 | Ga0268266_100056335 | 264 |
| 280 | 3300028380 | Ga0268265_10293080 | Ga0268265_102930801 | 264 |
| 281 | 3300028381 | Ga0268264_10072287 | Ga0268264_100722872 | 264 |
| 282 | 3300042437 | Ga0439444_0013155 | Ga0439444_0013155_214_1083 | 264 |
| 283 | 3300048904 | Ga0496101_0081021 | Ga0496101_0081021_1372_2166 | 264 |
| 284 | 3300048906 | Ga0496103_0000081 | Ga0496103_0000081_79484_80278 | 264 |
| 285 | 3300048907 | Ga0496104_0000081 | Ga0496104_0000081_36773_37567 | 264 |
| 286 | 3300048908 | Ga0496105_0000034 | Ga0496105_0000034_70115_70909 | 264 |
| 287 | 3300048914 | Ga0496111_0260106 | Ga0496111_0260106_112_906 | 264 |
| 288 | 3300048915 | Ga0496112_0402521 | Ga0496112_0402521_394_1188 | 264 |
| 289 | 3300048916 | Ga0496113_0000118 | Ga0496113_0000118_565_1359 | 264 |
| 290 | 3300048920 | Ga0496117_0000146 | Ga0496117_0000146_115270_116064 | 264 |
| 291 | 3300048921 | Ga0496118_0004051 | Ga0496118_0004051_10784_11578 | 264 |
| 292 | 3300048922 | Ga0496119_0000057 | Ga0496119_0000057_102838_103632 | 264 |
| 293 | 3300048923 | Ga0496120_0022518 | Ga0496120_0022518_290_1084 | 264 |
| 294 | 3300048924 | Ga0496121_0005467 | Ga0496121_0005467_14559_15353 | 264 |
| 295 | 3300048925 | Ga0496122_0000723 | Ga0496122_0000723_62220_63014 | 264 |
| 296 | 3300048926 | Ga0496123_0001828 | Ga0496123_0001828_2606_3400 | 264 |
| 297 | 3300048927 | Ga0496124_0003533 | Ga0496124_0003533_6318_7112 | 264 |
| 298 | 3300048928 | Ga0496125_0137536 | Ga0496125_0137536_214_1008 | 264 |
| 299 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_121197_121991 | 264 |
| 300 | 3300050510 | nmdc:mga06r32_12663_c1 | nmdc:mga06r32_12663_c1_238_1107 | 264 |
| 301 | 3300050511 | nmdc:mga08y16_432278_c1 | nmdc:mga08y16_432278_c1_336_1205 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8005 | 1 | 263 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.7949 | 1 | 263 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.7923 | 1 | 263 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.7868 | 1 | 263 |
| 2odf-assembly2.cif.gz_B | the crystal structure of gene product atu2144 from agrobacterium tumefaciens | 0.7731 | 3 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7725 | 4 | 261 | 3.40.630.40 |
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.766 | 1 | 263 | 3.40.630.40 |
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7608 | 4 | 261 | 3.40.630.40 |
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.758 | 1 | 263 | 3.40.630.40 |
| af_P46941_603_826_1.10.555.10 | Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein | 0.5602 | 225 | 263 | 1.10.555.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A183CGZ3-F1-model_v4 | Histidine ammonia-lyase (EC 3.5.2.7) (EC 4.3.1.3) (Probable imidazolonepropionase) | 0.9886 | 6 | 264 |
GO:0004397
GO:0005737 GO:0019556 GO:0019557 GO:0046872 GO:0050480 |
| AF-A0A7V8FH00-F1-model_v4 | Histidine ammonia-lyase (EC 4.3.1.3) | 0.9864 | 1 | 262 |
GO:0004397
GO:0005737 GO:0019556 GO:0019557 |
| AF-A0A528XDZ9-F1-model_v4 | N-formylglutamate deformylase (EC 3.5.1.68) | 0.9861 | 1 | 264 |
GO:0050129
|
| AF-A0A2W4MA33-F1-model_v4 | N-formylglutamate deformylase | 0.9853 | 1 | 264 |
|
| AF-A0A3S3J4E7-F1-model_v4 | N-formylglutamate deformylase | 0.9848 | 102 | 264 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar