F395947

General Info

Members Datasets Scaffolds Average Seq Length
301 198 289 272

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10007797|Ga0207671_100077976
Length 300
Sequence MAEPKNPPLQGEEDQPKAGGGVEADATLQGRIWDFLDIHRGTAPLVVGFPHTGTDLPPELEHAFVSPWLARKDADWWIDRLYAFARDLGATTIRTRLSRSVIDCNRDPSGASLYPGQTTTGLCPTETFDGEPLYPGPGPDPAEIDRRRTAYFDPYHEALATELMRLRTMHRNVVLYDAHSIRSHMPRLFEGELPQFNIGTNNGETCDPALAGAVAAICAASGHGHVLDGRFRGGWTTRHYGRPADGIHAIQMELSMRGYMAEPDVPSSDNWPSPIDPEPAILPILRQVLDACLSFAKEHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221640 Caulobacter sp. Root342 Isolate Unclassified
6 2643221642 Caulobacter sp. Root343 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
13 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
197 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0
Rhizoplane 4.32
Rhizosphere 74.42
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2017366 2162886007 Bacteria 4867
2 JGI24736J21556_1000045 3300001904 Bacteria 20426
3 JGI24740J21852_10037585 3300001979 Bacteria 1493
4 JGI24735J21928_10014211 3300002067 Bacteria 2495
5 JGI24738J21930_10005873 3300002075 Bacteria 2916
6 JGI24738J21930_10014604 3300002075 Bacteria 1683
7 JGI24749J21850_1000691 3300002076 Bacteria 4854
8 JGI24751J29686_10001242 3300002459 Bacteria 5384
9 JGI25165J46597_1000065 3300003214 Bacteria 199761
10 rootH1_10084969 3300003323 Bacteria 1278
11 Ga0065704_10070693 3300005289 Bacteria 17584
12 Ga0065707_10162279 3300005295 Bacteria 1553
13 Ga0070658_10024113 3300005327 Bacteria 4881
14 Ga0070670_100000005 3300005331 Bacteria 351569
15 Ga0070666_10146284 3300005335 Bacteria 1647
16 Ga0070682_100071946 3300005337 Bacteria 2215
17 Ga0070668_100000099 3300005347 Bacteria 52778
18 Ga0070668_100026386 3300005347 Bacteria 4409
19 Ga0070669_100000057 3300005353 Bacteria 110803
20 Ga0070669_100000082 3300005353 Bacteria 91465
21 Ga0070669_100008072 3300005353 Bacteria 7521
22 Ga0070671_100013142 3300005355 Bacteria 6670
23 Ga0070674_100035121 3300005356 Bacteria 3355
24 Ga0070667_100000038 3300005367 Bacteria 171914
25 Ga0070667_100000672 3300005367 Bacteria 33160
26 Ga0070667_100007515 3300005367 Bacteria 9037
27 Ga0070663_100041826 3300005455 Bacteria 3217
28 Ga0070662_100212041 3300005457 Bacteria 1541
29 Ga0068867_100082662 3300005459 Bacteria 2423
30 Ga0070685_10202880 3300005466 Bacteria 1290
31 Ga0068853_100492864 3300005539 Bacteria 1156
32 Ga0070672_100004419 3300005543 Bacteria 9199
33 Ga0070665_100001751 3300005548 Bacteria 24831
34 Ga0070665_100016355 3300005548 Bacteria 7438
35 Ga0068855_100487908 3300005563 Bacteria 1340
36 Ga0068857_100110888 3300005577 Bacteria 2466
37 Ga0068857_100252573 3300005577 Bacteria 1617
38 Ga0068857_100370040 3300005577 Bacteria 1329
39 Ga0068854_100003006 3300005578 Bacteria 10469
40 Ga0068854_100188392 3300005578 Bacteria 1615
41 Ga0068856_100590816 3300005614 Bacteria 1131
42 Ga0068852_100390221 3300005616 Bacteria 1367
43 Ga0068859_100233384 3300005617 Bacteria 1928
44 Ga0068859_100358515 3300005617 Bacteria 1553
45 Ga0068864_100000011 3300005618 Bacteria 350056
46 Ga0068861_100012010 3300005719 Bacteria 6033
47 Ga0068861_100169056 3300005719 Bacteria 1810
48 Ga0068863_100000255 3300005841 Bacteria 55911
49 Ga0068863_100013085 3300005841 Bacteria 8004
50 Ga0068863_100360209 3300005841 Bacteria 1418
51 Ga0068858_100000122 3300005842 Bacteria 80502
52 Ga0068860_100010442 3300005843 Bacteria 9180
53 Ga0068860_100042324 3300005843 Bacteria 4351
54 Ga0068860_100049413 3300005843 Bacteria 4006
55 Ga0068862_100000011 3300005844 Bacteria 270105
56 Ga0068862_100000044 3300005844 Bacteria 156665
57 Ga0068862_100002235 3300005844 Bacteria 17358
58 Ga0068862_100050740 3300005844 Bacteria 3546
59 Ga0068862_100341179 3300005844 Bacteria 1388
60 Ga0081455_10033261 3300005937 Bacteria 4636
61 Ga0081538_10007791 3300005981 Bacteria 9198
62 Ga0075368_10001106 3300006042 Bacteria 8497
63 Ga0075363_100064893 3300006048 Bacteria 1973
64 Ga0075367_10000203 3300006178 Bacteria 19754
65 Ga0075428_100002982 3300006844 Bacteria 18442
66 Ga0075430_100025807 3300006846 Bacteria 4999
67 Ga0075431_100028315 3300006847 Bacteria 5755
68 Ga0075431_100049592 3300006847 Bacteria 4328
69 Ga0075431_100065306 3300006847 Bacteria 3758
70 Ga0068865_100132860 3300006881 Bacteria 1867
71 Ga0097620_100233386 3300006931 Bacteria 1928
72 Ga0097620_100358506 3300006931 Bacteria 1553
73 Ga0105251_10082890 3300009011 Bacteria 1481
74 Ga0105251_10082891 3300009011 Bacteria 1481
75 Ga0105240_10009191 3300009093 Bacteria 14016
76 Ga0105240_10030107 3300009093 Bacteria 7060
77 Ga0105240_10095094 3300009093 Bacteria 3633
78 Ga0111539_10234914 3300009094 Bacteria 2134
79 Ga0111539_10483946 3300009094 Bacteria 1441
80 Ga0105245_10016967 3300009098 Bacteria 6356
81 Ga0105241_10254582 3300009174 Bacteria 1490
82 Ga0105242_10261377 3300009176 Bacteria 1564
83 Ga0105248_10008804 3300009177 Bacteria 11084
84 Ga0105248_10291605 3300009177 Bacteria 1837
85 Ga0105248_10412416 3300009177 Bacteria 1521
86 Ga0105237_10154817 3300009545 Bacteria 2289
87 Ga0105237_10186498 3300009545 Bacteria 2074
88 Ga0105238_10002228 3300009551 Bacteria 19578
89 Ga0105238_10081923 3300009551 Bacteria 3217
90 Ga0105238_10452727 3300009551 Bacteria 1281
91 Ga0105249_10000045 3300009553 Bacteria 182927
92 Ga0105249_10028451 3300009553 Bacteria 5044
93 Ga0105249_10402266 3300009553 Bacteria 1400
94 Ga0105239_10000105 3300010375 Bacteria 117635
95 Ga0105239_10294333 3300010375 Bacteria 1828
96 Ga0157370_10100112 3300013104 Bacteria 2716
97 Ga0157369_10365569 3300013105 Bacteria 1498
98 Ga0163162_10291567 3300013306 Bacteria 1763
99 Ga0157372_10153437 3300013307 Bacteria 2659
100 Ga0157375_10508587 3300013308 Bacteria 1368
101 Ga0163163_10112299 3300014325 Bacteria 2754
102 Ga0157380_10000031 3300014326 Bacteria 90245
103 Ga0157380_10050264 3300014326 Bacteria 3292
104 Ga0157376_10329141 3300014969 Bacteria 1455
105 Ga0163161_10022840 3300017792 Bacteria 4407
106 Ga0209233_1000107 3300025261 Bacteria 267399
107 Ga0207656_10014395 3300025321 Bacteria 3046
108 Ga0207696_1037198 3300025711 Bacteria 1442
109 Ga0207713_1006742 3300025735 Bacteria 6934
110 Ga0207713_1068530 3300025735 Bacteria 1319
111 Ga0207710_10026144 3300025900 Bacteria 2520
112 Ga0207680_10272878 3300025903 Bacteria 1173
113 Ga0207647_10010878 3300025904 Bacteria 6403
114 Ga0207645_10008093 3300025907 Bacteria 7374
115 Ga0207705_10174942 3300025909 Bacteria 1617
116 Ga0207654_10064238 3300025911 Bacteria 2157
117 Ga0207654_10104016 3300025911 Bacteria 1755
118 Ga0207695_10003675 3300025913 Bacteria 21388
119 Ga0207695_10031618 3300025913 Bacteria 5802
120 Ga0207695_10089228 3300025913 Bacteria 3101
121 Ga0207695_10220732 3300025913 Bacteria 1803
122 Ga0207671_10002439 3300025914 Bacteria 19902
123 Ga0207671_10007797 3300025914 Bacteria 9211
124 Ga0207671_10008621 3300025914 Bacteria 8615
125 Ga0207657_10073085 3300025919 Bacteria 2899
126 Ga0207681_10000001 3300025923 Bacteria 1105841
127 Ga0207681_10000139 3300025923 Bacteria 60094
128 Ga0207681_10004295 3300025923 Bacteria 8796
129 Ga0207694_10001388 3300025924 Bacteria 20808
130 Ga0207694_10062726 3300025924 Bacteria 2894
131 Ga0207694_10063438 3300025924 Bacteria 2878
132 Ga0207694_10112367 3300025924 Bacteria 2168
133 Ga0207694_10165174 3300025924 Bacteria 1790
134 Ga0207694_10349764 3300025924 Bacteria 1223
135 Ga0207650_10000018 3300025925 Bacteria 352120
136 Ga0207687_10043911 3300025927 Bacteria 3082
137 Ga0207706_10003176 3300025933 Bacteria 15789
138 Ga0207706_10027684 3300025933 Bacteria 5067
139 Ga0207706_10052699 3300025933 Bacteria 3592
140 Ga0207691_10002479 3300025940 Bacteria 18051
141 Ga0207691_10016487 3300025940 Bacteria 7013
142 Ga0207711_10002975 3300025941 Bacteria 14809
143 Ga0207711_10459845 3300025941 Bacteria 1185
144 Ga0207712_10000078 3300025961 Bacteria 117785
145 Ga0207712_10027984 3300025961 Bacteria 3767
146 Ga0207668_10000589 3300025972 Bacteria 22573
147 Ga0207668_10330818 3300025972 Bacteria 1267
148 Ga0207668_10403016 3300025972 Bacteria 1157
149 Ga0207640_10164864 3300025981 Bacteria 1644
150 Ga0207658_10000029 3300025986 Bacteria 171928
151 Ga0207658_10001923 3300025986 Bacteria 15501
152 Ga0207658_10006268 3300025986 Bacteria 8127
153 Ga0207703_10000159 3300026035 Bacteria 78106
154 Ga0207639_10027129 3300026041 Bacteria 4168
155 Ga0207639_10282554 3300026041 Bacteria 1460
156 Ga0207678_10021236 3300026067 Bacteria 5691
157 Ga0207702_10020163 3300026078 Bacteria 5523
158 Ga0207641_10000343 3300026088 Bacteria 56041
159 Ga0207641_10029832 3300026088 Bacteria 4511
160 Ga0207641_10314990 3300026088 Bacteria 1482
161 Ga0207648_10003167 3300026089 Bacteria 17348
162 Ga0207676_10000004 3300026095 Bacteria 725417
163 Ga0207674_10071257 3300026116 Bacteria 3492
164 Ga0207674_10153221 3300026116 Bacteria 2261
165 Ga0207674_10179545 3300026116 Bacteria 2068
166 Ga0207674_10342773 3300026116 Bacteria 1445
167 Ga0207675_100004907 3300026118 Bacteria 12886
168 Ga0207698_10255955 3300026142 Bacteria 1605
169 Ga0207698_10431493 3300026142 Bacteria 1267
170 Ga0209982_1006709 3300027552 Bacteria 1677
171 Ga0209971_1004557 3300027682 Bacteria 3288
172 Ga0209813_10000045 3300027866 Bacteria 50254
173 Ga0209974_10021065 3300027876 Bacteria 2160
174 Ga0268266_10000127 3300028379 Bacteria 149198
175 Ga0268266_10005633 3300028379 Bacteria 11624
176 Ga0268266_10031090 3300028379 Bacteria 4533
177 Ga0268265_10000002 3300028380 Bacteria 1035381
178 Ga0268265_10000045 3300028380 Bacteria 180378
179 Ga0268265_10003980 3300028380 Bacteria 10412
180 Ga0268265_10047990 3300028380 Bacteria 3203
181 Ga0268265_10293080 3300028380 Bacteria 1461
182 Ga0268264_10000440 3300028381 Bacteria 57263
183 Ga0268264_10040763 3300028381 Bacteria 3837
184 Ga0268264_10072287 3300028381 Bacteria 2925
185 Ga0307513_10084536 3300031456 Bacteria 3259
186 Ga0307509_10275103 3300031507 Bacteria 1449
187 Ga0307408_100075506 3300031548 Bacteria 2504
188 Ga0307508_10000302 3300031616 Bacteria 60090
189 Ga0307405_10003711 3300031731 Bacteria 7088
190 Ga0307405_10005702 3300031731 Bacteria 6042
191 Ga0307413_10011743 3300031824 Bacteria 4325
192 Ga0307410_10020242 3300031852 Bacteria 4066
193 Ga0307406_10021068 3300031901 Bacteria 3850
194 Ga0307412_10605184 3300031911 Bacteria 929
195 Ga0307409_100003772 3300031995 Bacteria 8341
196 Ga0307409_100118672 3300031995 Bacteria 2235
197 Ga0307416_100310436 3300032002 Bacteria 1573
198 Ga0307414_10004890 3300032004 Bacteria 7319
199 Ga0307414_10065414 3300032004 Bacteria 2594
200 Ga0307411_10012700 3300032005 Bacteria 4611
201 Ga0307415_100043264 3300032126 Bacteria 3004
202 Ga0307510_10234522 3300033180 Bacteria 1335
203 Ga0373944_0002416 3300035089 Bacteria 4743
204 Ga0373946_0006756 3300035171 Bacteria 4168
205 Ga0373925_0370891 3300037068 Bacteria 1165
206 Ga0395898_0002683 3300037466 Bacteria 20607
207 Ga0395898_0199566 3300037466 Bacteria 1910
208 Ga0395905_0008862 3300037471 Bacteria 9883
209 Ga0451787_560951 3300041441 Bacteria 1546
210 Ga0451807_1383667 3300041486 Bacteria 1538
211 Ga0439444_0013155 3300042437 Bacteria 1367
212 Ga0453684_0245064 3300044712 Bacteria 2061
213 Ga0495627_000248 3300046453 Bacteria 56262
214 Ga0495638_0000470 3300046460 Bacteria 48486
215 Ga0495650_0004372 3300046471 Bacteria 9726
216 Ga0495630_0529712 3300046517 Bacteria 903
217 Ga0495632_0078338 3300046519 Bacteria 1579
218 Ga0495644_0033601 3300046523 Bacteria 1937
219 Ga0495648_0008692 3300046524 Bacteria 7959
220 Ga0495587_0048005 3300046536 Bacteria 2530
221 Ga0495625_0154343 3300046660 Bacteria 1542
222 Ga0495670_0337072 3300046691 Bacteria 811
223 Ga0495674_0046474 3300047319 Bacteria 3853
224 Ga0495686_0000278 3300047472 Bacteria 90520
225 Ga0496101_0081021 3300048904 Bacteria 2399
226 Ga0496102_0000284 3300048905 Bacteria 64681
227 Ga0496103_0000081 3300048906 Bacteria 109734
228 Ga0496103_0000176 3300048906 Bacteria 65606
229 Ga0496104_0000081 3300048907 Bacteria 94514
230 Ga0496105_0000034 3300048908 Bacteria 127505
231 Ga0496105_0391265 3300048908 Bacteria 1105
232 Ga0496111_0260106 3300048914 Bacteria 1288
233 Ga0496112_0402521 3300048915 Bacteria 1308
234 Ga0496113_0000118 3300048916 Bacteria 34086
235 Ga0496115_0191281 3300048918 Bacteria 1691
236 Ga0496116_0002314 3300048919 Bacteria 20195
237 Ga0496117_0000146 3300048920 Bacteria 152244
238 Ga0496117_0000501 3300048920 Bacteria 64696
239 Ga0496118_0000503 3300048921 Bacteria 64696
240 Ga0496118_0004051 3300048921 Bacteria 17777
241 Ga0496118_0012866 3300048921 Bacteria 7976
242 Ga0496118_0268304 3300048921 Bacteria 958
243 Ga0496118_0289494 3300048921 Bacteria 906
244 Ga0496119_0000057 3300048922 Bacteria 173746
245 Ga0496120_0022518 3300048923 Bacteria 3961
246 Ga0496121_0000031 3300048924 Bacteria 384119
247 Ga0496121_0000176 3300048924 Bacteria 142585
248 Ga0496121_0000319 3300048924 Bacteria 100692
249 Ga0496121_0005467 3300048924 Bacteria 16277
250 Ga0496121_0013781 3300048924 Bacteria 8654
251 Ga0496121_0125985 3300048924 Bacteria 1925
252 Ga0496122_0000723 3300048925 Bacteria 64694
253 Ga0496122_0019015 3300048925 Bacteria 6302
254 Ga0496123_0001828 3300048926 Bacteria 27963
255 Ga0496123_0064449 3300048926 Bacteria 2335
256 Ga0496124_0000534 3300048927 Bacteria 64668
257 Ga0496124_0003533 3300048927 Bacteria 19028
258 Ga0496125_0016652 3300048928 Bacteria 7048
259 Ga0496125_0137536 3300048928 Bacteria 1705
260 Ga0496126_0000028 3300048929 Bacteria 394082
261 Ga0496126_0014410 3300048929 Bacteria 7994
262 Ga0496126_0156506 3300048929 Bacteria 1950
263 Ga0501073_0026783 3300049589 Bacteria 4128
264 Ga0501075_0057213 3300049591 Bacteria 2936
265 Ga0501075_0308569 3300049591 Bacteria 1206
266 Ga0501045_0214637 3300049824 Bacteria 1433
267 nmdc:mga03n38_116654_c1 3300050490 Bacteria 1307
268 nmdc:mga0k408_196683_c1 3300050493 Bacteria 1203
269 nmdc:mga06z11_124_c1 3300050494 Bacteria 31823
270 nmdc:mga04h51_2327_c1 3300050495 Bacteria 4496
271 nmdc:mga06r32_12663_c1 3300050510 Bacteria 7623
272 nmdc:mga06r32_132992_c1 3300050510 Bacteria 2461
273 nmdc:mga08y16_390165_c1 3300050511 Bacteria 1426
274 nmdc:mga08y16_432278_c1 3300050511 Bacteria 1344
275 nmdc:mga08y16_79433_c1 3300050511 Bacteria 3419
276 Ga0500643_000177 3300053087 Bacteria 63023
277 Ga0500643_001053 3300053087 Bacteria 16728
278 Ga0500643_001105 3300053087 Bacteria 16152
279 Ga0500595_074593 3300053119 Bacteria 1001
280 Ga0500618_002932 3300053125 Bacteria 6101
281 Ga0500658_0038254 3300053134 Bacteria 1911
282 Ga0500559_0075222 3300053136 Bacteria 1527
283 Ga0500559_0152073 3300053136 Bacteria 1086
284 Ga0500622_0056350 3300053156 Bacteria 2012
285 Ga0500634_0153780 3300053161 Bacteria 1071
286 Ga0500636_0011537 3300053177 Bacteria 5173
287 Ga0500596_022173 3300053735 Bacteria 959
288 Ga0500661_000142 3300055283 Bacteria 12130
289 Ga0530510_0128606 3300061734 Bacteria 1863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0337072 Ga0495670_0337072_42_725 222
2 3300046523 Ga0495644_0033601 Ga0495644_0033601_23_718 226
3 3300046517 Ga0495630_0529712 Ga0495630_0529712_17_745 234
4 3300048918 Ga0496115_0191281 Ga0496115_0191281_323_1033 236
5 3300053087 Ga0500643_000177 Ga0500643_000177_46518_47327 239
6 3300037466 Ga0395898_0199566 Ga0395898_0199566_933_1709 240
7 3300061734 Ga0530510_0128606 Ga0530510_0128606_458_1255 241
8 3300005981 Ga0081538_10007791 Ga0081538_100077912 247
9 3300026041 Ga0207639_10282554 Ga0207639_102825541 247
10 3300031548 Ga0307408_100075506 Ga0307408_1000755062 252
11 3300031731 Ga0307405_10005702 Ga0307405_100057022 252
12 3300031824 Ga0307413_10011743 Ga0307413_100117432 252
13 3300031852 Ga0307410_10020242 Ga0307410_100202423 252
14 3300031901 Ga0307406_10021068 Ga0307406_100210683 252
15 3300031911 Ga0307412_10605184 Ga0307412_106051842 252
16 3300031995 Ga0307409_100003772 Ga0307409_1000037724 252
17 3300032002 Ga0307416_100310436 Ga0307416_1003104362 252
18 3300032005 Ga0307411_10012700 Ga0307411_100127002 252
19 3300032126 Ga0307415_100043264 Ga0307415_1000432642 252
20 3300050493 nmdc:mga0k408_196683_c1 nmdc:mga0k408_196683_c1_272_1078 253
21 3300053087 Ga0500643_001053 Ga0500643_001053_3424_4218 253
22 3300053087 Ga0500643_001105 Ga0500643_001105_12229_13023 253
23 3300002075 JGI24738J21930_10014604 JGI24738J21930_100146042 255
24 3300005937 Ga0081455_10033261 Ga0081455_100332613 255
25 3300035089 Ga0373944_0002416 Ga0373944_0002416_1006_1803 255
26 3300035171 Ga0373946_0006756 Ga0373946_0006756_2790_3587 255
27 3300049591 Ga0501075_0308569 Ga0501075_0308569_244_1041 255
28 iso_pu_bacteria 2512564014 2512642209 257
29 3300005842 Ga0068858_100000122 Ga0068858_10000012269 258
30 3300026035 Ga0207703_10000159 Ga0207703_1000015910 258
31 3300046460 Ga0495638_0000470 Ga0495638_0000470_5725_6534 258
32 3300046660 Ga0495625_0154343 Ga0495625_0154343_520_1329 258
33 3300053134 Ga0500658_0038254 Ga0500658_0038254_166_975 258
34 3300001904 JGI24736J21556_1000045 JGI24736J21556_100004523 259
35 3300001979 JGI24740J21852_10037585 JGI24740J21852_100375852 259
36 3300002067 JGI24735J21928_10014211 JGI24735J21928_100142112 259
37 3300002075 JGI24738J21930_10005873 JGI24738J21930_100058732 259
38 3300002076 JGI24749J21850_1000691 JGI24749J21850_10006912 259
39 3300002459 JGI24751J29686_10001242 JGI24751J29686_100012424 259
40 3300003214 JGI25165J46597_1000065 JGI25165J46597_1000065175 259
41 3300005295 Ga0065707_10162279 Ga0065707_101622792 259
42 3300005327 Ga0070658_10024113 Ga0070658_100241137 259
43 3300005331 Ga0070670_100000005 Ga0070670_100000005231 259
44 3300005347 Ga0070668_100000099 Ga0070668_10000009913 259
45 3300005347 Ga0070668_100026386 Ga0070668_1000263864 259
46 3300005353 Ga0070669_100000057 Ga0070669_10000005785 259
47 3300005353 Ga0070669_100008072 Ga0070669_1000080724 259
48 3300005367 Ga0070667_100000038 Ga0070667_100000038140 259
49 3300005367 Ga0070667_100000672 Ga0070667_10000067212 259
50 3300005455 Ga0070663_100041826 Ga0070663_1000418262 259
51 3300005457 Ga0070662_100212041 Ga0070662_1002120412 259
52 3300005539 Ga0068853_100492864 Ga0068853_1004928642 259
53 3300005563 Ga0068855_100487908 Ga0068855_1004879082 259
54 3300005577 Ga0068857_100110888 Ga0068857_1001108882 259
55 3300005577 Ga0068857_100370040 Ga0068857_1003700402 259
56 3300005578 Ga0068854_100003006 Ga0068854_1000030069 259
57 3300005578 Ga0068854_100188392 Ga0068854_1001883922 259
58 3300005616 Ga0068852_100390221 Ga0068852_1003902212 259
59 3300005617 Ga0068859_100233384 Ga0068859_1002333842 259
60 3300005618 Ga0068864_100000011 Ga0068864_100000011229 259
61 3300005719 Ga0068861_100012010 Ga0068861_1000120102 259
62 3300005841 Ga0068863_100000255 Ga0068863_10000025514 259
63 3300005843 Ga0068860_100042324 Ga0068860_1000423244 259
64 3300005844 Ga0068862_100000011 Ga0068862_1000000113 259
65 3300006931 Ga0097620_100233386 Ga0097620_1002333862 259
66 3300009093 Ga0105240_10009191 Ga0105240_1000919117 259
67 3300009093 Ga0105240_10095094 Ga0105240_100950942 259
68 3300009177 Ga0105248_10008804 Ga0105248_100088048 259
69 3300009545 Ga0105237_10154817 Ga0105237_101548172 259
70 3300009545 Ga0105237_10186498 Ga0105237_101864982 259
71 3300009551 Ga0105238_10002228 Ga0105238_100022282 259
72 3300009551 Ga0105238_10452727 Ga0105238_104527272 259
73 3300010375 Ga0105239_10000105 Ga0105239_1000010567 259
74 3300010375 Ga0105239_10294333 Ga0105239_102943332 259
75 3300013104 Ga0157370_10100112 Ga0157370_101001122 259
76 3300014325 Ga0163163_10112299 Ga0163163_101122992 259
77 3300014326 Ga0157380_10000031 Ga0157380_1000003188 259
78 3300017792 Ga0163161_10022840 Ga0163161_100228404 259
79 3300025261 Ga0209233_1000107 Ga0209233_100010733 259
80 3300025321 Ga0207656_10014395 Ga0207656_100143953 259
81 3300025904 Ga0207647_10010878 Ga0207647_100108782 259
82 3300025911 Ga0207654_10064238 Ga0207654_100642382 259
83 3300025911 Ga0207654_10104016 Ga0207654_101040162 259
84 3300025913 Ga0207695_10003675 Ga0207695_1000367515 259
85 3300025913 Ga0207695_10089228 Ga0207695_100892282 259
86 3300025913 Ga0207695_10220732 Ga0207695_102207322 259
87 3300025914 Ga0207671_10002439 Ga0207671_100024397 259
88 3300025914 Ga0207671_10007797 Ga0207671_100077976 259
89 3300025919 Ga0207657_10073085 Ga0207657_100730852 259
90 3300025923 Ga0207681_10000001 Ga0207681_10000001428 259
91 3300025923 Ga0207681_10004295 Ga0207681_100042957 259
92 3300025924 Ga0207694_10001388 Ga0207694_1000138815 259
93 3300025924 Ga0207694_10062726 Ga0207694_100627262 259
94 3300025924 Ga0207694_10165174 Ga0207694_101651742 259
95 3300025924 Ga0207694_10349764 Ga0207694_103497642 259
96 3300025925 Ga0207650_10000018 Ga0207650_10000018229 259
97 3300025933 Ga0207706_10027684 Ga0207706_100276844 259
98 3300025933 Ga0207706_10052699 Ga0207706_100526992 259
99 3300025941 Ga0207711_10002975 Ga0207711_1000297511 259
100 3300025972 Ga0207668_10000589 Ga0207668_1000058913 259
101 3300025972 Ga0207668_10330818 Ga0207668_103308182 259
102 3300025981 Ga0207640_10164864 Ga0207640_101648642 259
103 3300025986 Ga0207658_10000029 Ga0207658_10000029139 259
104 3300025986 Ga0207658_10001923 Ga0207658_1000192312 259
105 3300026041 Ga0207639_10027129 Ga0207639_100271293 259
106 3300026067 Ga0207678_10021236 Ga0207678_100212364 259
107 3300026078 Ga0207702_10020163 Ga0207702_100201635 259
108 3300026088 Ga0207641_10000343 Ga0207641_1000034314 259
109 3300026095 Ga0207676_10000004 Ga0207676_10000004622 259
110 3300026116 Ga0207674_10071257 Ga0207674_100712572 259
111 3300026116 Ga0207674_10153221 Ga0207674_101532212 259
112 3300026116 Ga0207674_10179545 Ga0207674_101795452 259
113 3300026142 Ga0207698_10255955 Ga0207698_102559552 259
114 3300026142 Ga0207698_10431493 Ga0207698_104314931 259
115 3300028380 Ga0268265_10000002 Ga0268265_10000002444 259
116 3300028381 Ga0268264_10040763 Ga0268264_100407633 259
117 3300031507 Ga0307509_10275103 Ga0307509_102751032 259
118 3300031731 Ga0307405_10003711 Ga0307405_100037113 259
119 3300033180 Ga0307510_10234522 Ga0307510_102345222 259
120 3300044712 Ga0453684_0245064 Ga0453684_0245064_1210_2016 259
121 3300046471 Ga0495650_0004372 Ga0495650_0004372_8512_9315 259
122 3300047472 Ga0495686_0000278 Ga0495686_0000278_37335_38144 259
123 3300048905 Ga0496102_0000284 Ga0496102_0000284_47299_48108 259
124 3300048906 Ga0496103_0000176 Ga0496103_0000176_16568_17377 259
125 3300048908 Ga0496105_0391265 Ga0496105_0391265_176_985 259
126 3300048919 Ga0496116_0002314 Ga0496116_0002314_13538_14347 259
127 3300048920 Ga0496117_0000501 Ga0496117_0000501_16589_17398 259
128 3300048921 Ga0496118_0000503 Ga0496118_0000503_47299_48108 259
129 3300048921 Ga0496118_0012866 Ga0496118_0012866_5759_6568 259
130 3300048921 Ga0496118_0268304 Ga0496118_0268304_35_844 259
131 3300048921 Ga0496118_0289494 Ga0496118_0289494_59_865 259
132 3300048924 Ga0496121_0000031 Ga0496121_0000031_346408_347217 259
133 3300048924 Ga0496121_0000176 Ga0496121_0000176_85552_86361 259
134 3300048924 Ga0496121_0000319 Ga0496121_0000319_30738_31547 259
135 3300048924 Ga0496121_0013781 Ga0496121_0013781_6114_6923 259
136 3300048925 Ga0496122_0019015 Ga0496122_0019015_2687_3493 259
137 3300048926 Ga0496123_0064449 Ga0496123_0064449_1420_2226 259
138 3300048927 Ga0496124_0000534 Ga0496124_0000534_47299_48108 259
139 3300048928 Ga0496125_0016652 Ga0496125_0016652_2139_2945 259
140 3300048929 Ga0496126_0014410 Ga0496126_0014410_1016_1825 259
141 3300048929 Ga0496126_0156506 Ga0496126_0156506_272_1078 259
142 3300053119 Ga0500595_074593 Ga0500595_074593_179_991 259
143 3300053177 Ga0500636_0011537 Ga0500636_0011537_2955_3794 259
144 3300053735 Ga0500596_022173 Ga0500596_022173_54_863 259
145 3300055283 Ga0500661_000142 Ga0500661_000142_5846_6664 259
146 iso_pu_bacteria 2585428106 2587918571 259
147 iso_pu_bacteria 2643221605 2644038294 259
148 iso_pu_bacteria 2643221640 2644224864 259
149 iso_pu_bacteria 2643221642 2644234202 259
150 3300013105 Ga0157369_10365569 Ga0157369_103655692 260
151 3300037471 Ga0395905_0008862 Ga0395905_0008862_4809_5618 260
152 3300048924 Ga0496121_0125985 Ga0496121_0125985_581_1390 260
153 3300053136 Ga0500559_0075222 Ga0500559_0075222_447_1268 260
154 iso_pu_bacteria 2738541275 2738709588 260
155 iso_pu_bacteria 2738541301 2738848013 260
156 iso_pu_bacteria 2738541304 2738863742 260
157 iso_pu_bacteria 2738543022 2739296260 260
158 iso_pu_bacteria 2738543033 2739357938 260
159 iso_pu_bacteria 2928100450 2928101143 260
160 iso_pu_bacteria 2928959182 2928960446 260
161 3300005617 Ga0068859_100358515 Ga0068859_1003585151 261
162 3300006042 Ga0075368_10001106 Ga0075368_100011064 261
163 3300006048 Ga0075363_100064893 Ga0075363_1000648932 261
164 3300006178 Ga0075367_10000203 Ga0075367_100002036 261
165 3300006931 Ga0097620_100358506 Ga0097620_1003585062 261
166 3300009098 Ga0105245_10016967 Ga0105245_100169672 261
167 3300013306 Ga0163162_10291567 Ga0163162_102915672 261
168 3300025927 Ga0207687_10043911 Ga0207687_100439112 261
169 3300027866 Ga0209813_10000045 Ga0209813_100000454 261
170 3300032004 Ga0307414_10004890 Ga0307414_100048906 261
171 3300049589 Ga0501073_0026783 Ga0501073_0026783_13_840 261
172 3300050490 nmdc:mga03n38_116654_c1 nmdc:mga03n38_116654_c1_50_862 261
173 3300050494 nmdc:mga06z11_124_c1 nmdc:mga06z11_124_c1_10027_10839 261
174 3300050495 nmdc:mga04h51_2327_c1 nmdc:mga04h51_2327_c1_492_1304 261
175 3300053125 Ga0500618_002932 Ga0500618_002932_5113_5922 261
176 3300053136 Ga0500559_0152073 Ga0500559_0152073_109_927 261
177 3300003323 rootH1_10084969 rootH1_100849692 262
178 3300005337 Ga0070682_100071946 Ga0070682_1000719462 262
179 3300005466 Ga0070685_10202880 Ga0070685_102028802 262
180 3300005548 Ga0070665_100001751 Ga0070665_1000017518 262
181 3300005548 Ga0070665_100016355 Ga0070665_1000163552 262
182 3300005577 Ga0068857_100252573 Ga0068857_1002525732 262
183 3300005614 Ga0068856_100590816 Ga0068856_1005908162 262
184 3300005841 Ga0068863_100013085 Ga0068863_1000130857 262
185 3300005841 Ga0068863_100360209 Ga0068863_1003602092 262
186 3300005843 Ga0068860_100010442 Ga0068860_1000104424 262
187 3300005844 Ga0068862_100000044 Ga0068862_10000004497 262
188 3300005844 Ga0068862_100002235 Ga0068862_10000223513 262
189 3300005844 Ga0068862_100050740 Ga0068862_1000507402 262
190 3300009093 Ga0105240_10030107 Ga0105240_100301076 262
191 3300009094 Ga0111539_10483946 Ga0111539_104839462 262
192 3300009174 Ga0105241_10254582 Ga0105241_102545821 262
193 3300009177 Ga0105248_10412416 Ga0105248_104124162 262
194 3300009551 Ga0105238_10081923 Ga0105238_100819232 262
195 3300009553 Ga0105249_10000045 Ga0105249_1000004593 262
196 3300013307 Ga0157372_10153437 Ga0157372_101534372 262
197 3300014326 Ga0157380_10050264 Ga0157380_100502642 262
198 3300014969 Ga0157376_10329141 Ga0157376_103291412 262
199 3300025900 Ga0207710_10026144 Ga0207710_100261442 262
200 3300025909 Ga0207705_10174942 Ga0207705_101749422 262
201 3300025913 Ga0207695_10031618 Ga0207695_100316184 262
202 3300025914 Ga0207671_10008621 Ga0207671_100086212 262
203 3300025924 Ga0207694_10063438 Ga0207694_100634383 262
204 3300025924 Ga0207694_10112367 Ga0207694_101123672 262
205 3300025940 Ga0207691_10002479 Ga0207691_100024796 262
206 3300025941 Ga0207711_10459845 Ga0207711_104598452 262
207 3300025961 Ga0207712_10000078 Ga0207712_1000007829 262
208 3300025972 Ga0207668_10403016 Ga0207668_104030162 262
209 3300026088 Ga0207641_10029832 Ga0207641_100298324 262
210 3300026088 Ga0207641_10314990 Ga0207641_103149902 262
211 3300026116 Ga0207674_10342773 Ga0207674_103427732 262
212 3300028379 Ga0268266_10000127 Ga0268266_100001274 262
213 3300028379 Ga0268266_10031090 Ga0268266_100310902 262
214 3300028380 Ga0268265_10000045 Ga0268265_1000004588 262
215 3300028380 Ga0268265_10003980 Ga0268265_100039803 262
216 3300028381 Ga0268264_10000440 Ga0268264_1000044047 262
217 3300031456 Ga0307513_10084536 Ga0307513_100845363 262
218 3300031995 Ga0307409_100118672 Ga0307409_1001186722 262
219 3300037068 Ga0373925_0370891 Ga0373925_0370891_211_1056 262
220 3300037466 Ga0395898_0002683 Ga0395898_0002683_4548_5393 262
221 3300041441 Ga0451787_560951 Ga0451787_560951_419_1261 262
222 3300041486 Ga0451807_1383667 Ga0451807_1383667_330_1172 262
223 3300046453 Ga0495627_000248 Ga0495627_000248_9777_10595 262
224 3300046519 Ga0495632_0078338 Ga0495632_0078338_744_1565 262
225 3300046524 Ga0495648_0008692 Ga0495648_0008692_1279_2097 262
226 3300046536 Ga0495587_0048005 Ga0495587_0048005_181_999 262
227 3300047319 Ga0495674_0046474 Ga0495674_0046474_729_1547 262
228 3300049591 Ga0501075_0057213 Ga0501075_0057213_1404_2270 262
229 3300049824 Ga0501045_0214637 Ga0501045_0214637_329_1195 262
230 3300050511 nmdc:mga08y16_390165_c1 nmdc:mga08y16_390165_c1_440_1285 262
231 3300053156 Ga0500622_0056350 Ga0500622_0056350_742_1566 262
232 3300053161 Ga0500634_0153780 Ga0500634_0153780_35_856 262
233 3300005356 Ga0070674_100035121 Ga0070674_1000351214 263
234 3300005459 Ga0068867_100082662 Ga0068867_1000826623 263
235 3300005543 Ga0070672_100004419 Ga0070672_10000441912 263
236 3300005719 Ga0068861_100169056 Ga0068861_1001690562 263
237 3300005844 Ga0068862_100341179 Ga0068862_1003411792 263
238 3300006846 Ga0075430_100025807 Ga0075430_1000258073 263
239 3300006847 Ga0075431_100028315 Ga0075431_1000283154 263
240 3300006847 Ga0075431_100049592 Ga0075431_1000495925 263
241 3300006881 Ga0068865_100132860 Ga0068865_1001328603 263
242 3300009176 Ga0105242_10261377 Ga0105242_102613772 263
243 3300009553 Ga0105249_10402266 Ga0105249_104022663 263
244 3300013308 Ga0157375_10508587 Ga0157375_105085871 263
245 3300025907 Ga0207645_10008093 Ga0207645_100080933 263
246 3300025933 Ga0207706_10003176 Ga0207706_100031763 263
247 3300025940 Ga0207691_10016487 Ga0207691_100164879 263
248 3300026089 Ga0207648_10003167 Ga0207648_1000316719 263
249 3300026118 Ga0207675_100004907 Ga0207675_1000049073 263
250 3300027552 Ga0209982_1006709 Ga0209982_10067093 263
251 3300027682 Ga0209971_1004557 Ga0209971_10045575 263
252 3300027876 Ga0209974_10021065 Ga0209974_100210653 263
253 3300028380 Ga0268265_10047990 Ga0268265_100479901 263
254 3300031616 Ga0307508_10000302 Ga0307508_100003027 263
255 3300032004 Ga0307414_10065414 Ga0307414_100654142 263
256 3300050510 nmdc:mga06r32_132992_c1 nmdc:mga06r32_132992_c1_1155_2027 263
257 3300050511 nmdc:mga08y16_79433_c1 nmdc:mga08y16_79433_c1_2456_3328 263
258 2162886007 SwRhRL2b_contig_2017366 SwRhRL2b_0436.00001840 264
259 3300005289 Ga0065704_10070693 Ga0065704_100706934 264
260 3300005335 Ga0070666_10146284 Ga0070666_101462841 264
261 3300005353 Ga0070669_100000082 Ga0070669_10000008239 264
262 3300005355 Ga0070671_100013142 Ga0070671_1000131423 264
263 3300005367 Ga0070667_100007515 Ga0070667_1000075156 264
264 3300005843 Ga0068860_100049413 Ga0068860_1000494132 264
265 3300006844 Ga0075428_100002982 Ga0075428_1000029829 264
266 3300006847 Ga0075431_100065306 Ga0075431_1000653063 264
267 3300009011 Ga0105251_10082890 Ga0105251_100828902 264
268 3300009011 Ga0105251_10082891 Ga0105251_100828912 264
269 3300009094 Ga0111539_10234914 Ga0111539_102349142 264
270 3300009177 Ga0105248_10291605 Ga0105248_102916052 264
271 3300009553 Ga0105249_10028451 Ga0105249_100284512 264
272 3300025711 Ga0207696_1037198 Ga0207696_10371982 264
273 3300025735 Ga0207713_1006742 Ga0207713_10067423 264
274 3300025735 Ga0207713_1068530 Ga0207713_10685302 264
275 3300025903 Ga0207680_10272878 Ga0207680_102728781 264
276 3300025923 Ga0207681_10000139 Ga0207681_1000013939 264
277 3300025961 Ga0207712_10027984 Ga0207712_100279843 264
278 3300025986 Ga0207658_10006268 Ga0207658_100062684 264
279 3300028379 Ga0268266_10005633 Ga0268266_100056335 264
280 3300028380 Ga0268265_10293080 Ga0268265_102930801 264
281 3300028381 Ga0268264_10072287 Ga0268264_100722872 264
282 3300042437 Ga0439444_0013155 Ga0439444_0013155_214_1083 264
283 3300048904 Ga0496101_0081021 Ga0496101_0081021_1372_2166 264
284 3300048906 Ga0496103_0000081 Ga0496103_0000081_79484_80278 264
285 3300048907 Ga0496104_0000081 Ga0496104_0000081_36773_37567 264
286 3300048908 Ga0496105_0000034 Ga0496105_0000034_70115_70909 264
287 3300048914 Ga0496111_0260106 Ga0496111_0260106_112_906 264
288 3300048915 Ga0496112_0402521 Ga0496112_0402521_394_1188 264
289 3300048916 Ga0496113_0000118 Ga0496113_0000118_565_1359 264
290 3300048920 Ga0496117_0000146 Ga0496117_0000146_115270_116064 264
291 3300048921 Ga0496118_0004051 Ga0496118_0004051_10784_11578 264
292 3300048922 Ga0496119_0000057 Ga0496119_0000057_102838_103632 264
293 3300048923 Ga0496120_0022518 Ga0496120_0022518_290_1084 264
294 3300048924 Ga0496121_0005467 Ga0496121_0005467_14559_15353 264
295 3300048925 Ga0496122_0000723 Ga0496122_0000723_62220_63014 264
296 3300048926 Ga0496123_0001828 Ga0496123_0001828_2606_3400 264
297 3300048927 Ga0496124_0003533 Ga0496124_0003533_6318_7112 264
298 3300048928 Ga0496125_0137536 Ga0496125_0137536_214_1008 264
299 3300048929 Ga0496126_0000028 Ga0496126_0000028_121197_121991 264
300 3300050510 nmdc:mga06r32_12663_c1 nmdc:mga06r32_12663_c1_238_1107 264
301 3300050511 nmdc:mga08y16_432278_c1 nmdc:mga08y16_432278_c1_336_1205 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

43

260

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8005 1 263
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7949 1 263
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7923 1 263
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7868 1 263
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.7731 3 261
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7725 4 261 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.766 1 263 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7608 4 261 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.758 1 263 3.40.630.40
af_P46941_603_826_1.10.555.10 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.5602 225 263 1.10.555.10
ID Description Score Start End GO Terms
AF-A0A183CGZ3-F1-model_v4 Histidine ammonia-lyase (EC 3.5.2.7) (EC 4.3.1.3) (Probable imidazolonepropionase) 0.9886 6 264 GO:0004397
GO:0005737
GO:0019556
GO:0019557
GO:0046872
GO:0050480
AF-A0A7V8FH00-F1-model_v4 Histidine ammonia-lyase (EC 4.3.1.3) 0.9864 1 262 GO:0004397
GO:0005737
GO:0019556
GO:0019557
AF-A0A528XDZ9-F1-model_v4 N-formylglutamate deformylase (EC 3.5.1.68) 0.9861 1 264 GO:0050129
AF-A0A2W4MA33-F1-model_v4 N-formylglutamate deformylase 0.9853 1 264
AF-A0A3S3J4E7-F1-model_v4 N-formylglutamate deformylase 0.9848 102 264

Feature Viewer

pLDDT pTM Quality
96.2 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map