F395798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 205 | 300 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_101589028|Ga0070664_1015890282 |
| Length | 90 |
| Sequence | MGSARTQHTDIRPGMDVLTLFGLFAVPAMLVFYMLEDRSPWFILAFASACALGSAYGFLQGAWPFGLVEAIWAGVAVPRWRAKIHGSPLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 127 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 142 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 174 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 175 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 176 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 202 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 205 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.33 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 0.33 |
| Rhizoplane | 3.65 |
| Rhizosphere | 90.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10124742 | 3300003203 | Bacteria | 756 |
| 2 | Ga0065165_1008563 | 3300005262 | Bacteria | 4757 |
| 3 | Ga0065704_10209365 | 3300005289 | Unclassified | 1114 |
| 4 | Ga0065707_10090534 | 3300005295 | Bacteria | 4122 |
| 5 | Ga0070658_10049522 | 3300005327 | Bacteria | 3403 |
| 6 | Ga0070658_10349364 | 3300005327 | Bacteria | 1266 |
| 7 | Ga0070670_100000426 | 3300005331 | Bacteria | 34748 |
| 8 | Ga0070670_100523699 | 3300005331 | Bacteria | 1056 |
| 9 | Ga0070666_10177074 | 3300005335 | Bacteria | 1495 |
| 10 | Ga0070680_100135444 | 3300005336 | Bacteria | 2063 |
| 11 | Ga0070682_100755103 | 3300005337 | Bacteria | 786 |
| 12 | Ga0070682_100885292 | 3300005337 | Bacteria | 732 |
| 13 | Ga0070660_100161740 | 3300005339 | Bacteria | 1804 |
| 14 | Ga0070660_100283835 | 3300005339 | Bacteria | 1355 |
| 15 | Ga0070691_10292864 | 3300005341 | Bacteria | 887 |
| 16 | Ga0070668_100000042 | 3300005347 | Bacteria | 78694 |
| 17 | Ga0070669_100023764 | 3300005353 | Bacteria | 4392 |
| 18 | Ga0070669_100669486 | 3300005353 | Bacteria | 874 |
| 19 | Ga0070659_100014194 | 3300005366 | Bacteria | 5948 |
| 20 | Ga0070659_100495672 | 3300005366 | Bacteria | 1041 |
| 21 | Ga0070667_100000168 | 3300005367 | Bacteria | 81935 |
| 22 | Ga0070714_100185155 | 3300005435 | Bacteria | 1897 |
| 23 | Ga0070714_101716030 | 3300005435 | Unclassified | 613 |
| 24 | Ga0070710_10282059 | 3300005437 | Bacteria | 1078 |
| 25 | Ga0070711_100297732 | 3300005439 | Bacteria | 1282 |
| 26 | Ga0070708_100664279 | 3300005445 | Unclassified | 982 |
| 27 | Ga0070663_100508844 | 3300005455 | Bacteria | 1001 |
| 28 | Ga0070678_100164112 | 3300005456 | Bacteria | 1803 |
| 29 | Ga0070678_101262003 | 3300005456 | Bacteria | 687 |
| 30 | Ga0070678_101594394 | 3300005456 | Unclassified | 613 |
| 31 | Ga0070681_11013249 | 3300005458 | Bacteria | 750 |
| 32 | Ga0070706_100498442 | 3300005467 | Bacteria | 1133 |
| 33 | Ga0070698_100329570 | 3300005471 | Bacteria | 1458 |
| 34 | Ga0070699_100003297 | 3300005518 | Bacteria | 14269 |
| 35 | Ga0070679_100055817 | 3300005530 | Bacteria | 3934 |
| 36 | Ga0070679_100221669 | 3300005530 | Bacteria | 1852 |
| 37 | Ga0070684_100784508 | 3300005535 | Bacteria | 890 |
| 38 | Ga0070697_100006576 | 3300005536 | Bacteria | 9008 |
| 39 | Ga0068853_100223909 | 3300005539 | Bacteria | 1719 |
| 40 | Ga0068853_100357949 | 3300005539 | Bacteria | 1359 |
| 41 | Ga0070672_100670356 | 3300005543 | Bacteria | 907 |
| 42 | Ga0070695_100466275 | 3300005545 | Bacteria | 971 |
| 43 | Ga0070696_101740425 | 3300005546 | Unclassified | 538 |
| 44 | Ga0070693_100107414 | 3300005547 | Bacteria | 1711 |
| 45 | Ga0070693_100206306 | 3300005547 | Bacteria | 1280 |
| 46 | Ga0070665_100002287 | 3300005548 | Bacteria | 21311 |
| 47 | Ga0070665_100084240 | 3300005548 | Bacteria | 3184 |
| 48 | Ga0068855_100380722 | 3300005563 | Bacteria | 1549 |
| 49 | Ga0068855_100701351 | 3300005563 | Bacteria | 1083 |
| 50 | Ga0068855_101100849 | 3300005563 | Unclassified | 830 |
| 51 | Ga0068855_102363416 | 3300005563 | Bacteria | 531 |
| 52 | Ga0070664_101589028 | 3300005564 | Unclassified | 619 |
| 53 | Ga0070664_102279807 | 3300005564 | Bacteria | 514 |
| 54 | Ga0068857_100048940 | 3300005577 | Plasmid | 3750 |
| 55 | Ga0068857_100200663 | 3300005577 | Bacteria | 1818 |
| 56 | Ga0068857_100852842 | 3300005577 | Bacteria | 872 |
| 57 | Ga0068856_100046498 | 3300005614 | Bacteria | 4275 |
| 58 | Ga0068856_100048356 | 3300005614 | Bacteria | 4191 |
| 59 | Ga0068856_101599789 | 3300005614 | Unclassified | 665 |
| 60 | Ga0070702_100196611 | 3300005615 | Bacteria | 1331 |
| 61 | Ga0068852_100869034 | 3300005616 | Bacteria | 918 |
| 62 | Ga0068852_101734735 | 3300005616 | Bacteria | 647 |
| 63 | Ga0068859_100019113 | 3300005617 | Bacteria | 6881 |
| 64 | Ga0068864_100000135 | 3300005618 | Bacteria | 71759 |
| 65 | Ga0068870_10724183 | 3300005840 | Bacteria | 688 |
| 66 | Ga0068870_11212797 | 3300005840 | Bacteria | 547 |
| 67 | Ga0068863_100012986 | 3300005841 | Bacteria | 8032 |
| 68 | Ga0068858_100019958 | 3300005842 | Bacteria | 6267 |
| 69 | Ga0068858_100379538 | 3300005842 | Bacteria | 1356 |
| 70 | Ga0068860_100000133 | 3300005843 | Bacteria | 120382 |
| 71 | Ga0068860_100174410 | 3300005843 | Bacteria | 2078 |
| 72 | Ga0068862_100009611 | 3300005844 | Bacteria | 7992 |
| 73 | Ga0068862_100207601 | 3300005844 | Bacteria | 1769 |
| 74 | Ga0068862_101149447 | 3300005844 | Bacteria | 773 |
| 75 | Ga0081455_10018684 | 3300005937 | Bacteria | 6584 |
| 76 | Ga0081455_10071469 | 3300005937 | Bacteria | 2877 |
| 77 | Ga0081539_10006163 | 3300005985 | Bacteria | 11667 |
| 78 | Ga0070717_11544143 | 3300006028 | Bacteria | 602 |
| 79 | Ga0070716_100109451 | 3300006173 | Bacteria | 1709 |
| 80 | Ga0070716_100991686 | 3300006173 | Bacteria | 664 |
| 81 | Ga0070712_100374844 | 3300006175 | Bacteria | 1170 |
| 82 | Ga0070712_100912342 | 3300006175 | Unclassified | 758 |
| 83 | Ga0097621_100225459 | 3300006237 | Bacteria | 1634 |
| 84 | Ga0097621_101651857 | 3300006237 | Bacteria | 610 |
| 85 | Ga0068871_100095783 | 3300006358 | Bacteria | 2479 |
| 86 | Ga0068871_100161856 | 3300006358 | Bacteria | 1915 |
| 87 | Ga0075433_11083508 | 3300006852 | Unclassified | 697 |
| 88 | Ga0075434_101376434 | 3300006871 | Unclassified | 716 |
| 89 | Ga0075434_101398337 | 3300006871 | Unclassified | 710 |
| 90 | Ga0075436_100676401 | 3300006914 | Bacteria | 764 |
| 91 | Ga0097620_100019113 | 3300006931 | Bacteria | 6881 |
| 92 | Ga0075435_101412145 | 3300007076 | Unclassified | 610 |
| 93 | Ga0099795_10049687 | 3300007788 | Bacteria | 1523 |
| 94 | Ga0099795_10454782 | 3300007788 | Bacteria | 590 |
| 95 | Ga0105240_10050323 | 3300009093 | Bacteria | 5254 |
| 96 | Ga0105240_10267976 | 3300009093 | Bacteria | 1968 |
| 97 | Ga0105240_10708482 | 3300009093 | Unclassified | 1098 |
| 98 | Ga0105240_11161801 | 3300009093 | Bacteria | 819 |
| 99 | Ga0114129_12650591 | 3300009147 | Unclassified | 598 |
| 100 | Ga0105243_10068691 | 3300009148 | Bacteria | 2856 |
| 101 | Ga0105243_10308771 | 3300009148 | Bacteria | 1436 |
| 102 | Ga0105243_10429809 | 3300009148 | Bacteria | 1234 |
| 103 | Ga0105241_10028379 | 3300009174 | Bacteria | 4170 |
| 104 | Ga0105241_10619439 | 3300009174 | Bacteria | 980 |
| 105 | Ga0105241_11261835 | 3300009174 | Unclassified | 702 |
| 106 | Ga0105248_10969235 | 3300009177 | Bacteria | 960 |
| 107 | Ga0105237_10215289 | 3300009545 | Bacteria | 1921 |
| 108 | Ga0105237_11472698 | 3300009545 | Bacteria | 687 |
| 109 | Ga0105237_12783063 | 3300009545 | Unclassified | 500 |
| 110 | Ga0105238_10127261 | 3300009551 | Bacteria | 2526 |
| 111 | Ga0105238_10199147 | 3300009551 | Bacteria | 1978 |
| 112 | Ga0105238_11065625 | 3300009551 | Bacteria | 830 |
| 113 | Ga0105249_10299299 | 3300009553 | Bacteria | 1613 |
| 114 | Ga0105249_11269907 | 3300009553 | Bacteria | 808 |
| 115 | Ga0105249_11551312 | 3300009553 | Bacteria | 735 |
| 116 | Ga0099796_10006618 | 3300010159 | Bacteria | 2980 |
| 117 | Ga0099796_10012636 | 3300010159 | Bacteria | 2390 |
| 118 | Ga0099796_10013881 | 3300010159 | Bacteria | 2312 |
| 119 | Ga0105239_10960656 | 3300010375 | Bacteria | 982 |
| 120 | Ga0105239_11344343 | 3300010375 | Bacteria | 824 |
| 121 | Ga0105246_10028393 | 3300011119 | Bacteria | 3675 |
| 122 | Ga0157370_10009664 | 3300013104 | Bacteria | 10257 |
| 123 | Ga0157370_10062055 | 3300013104 | Bacteria | 3545 |
| 124 | Ga0157370_10115312 | 3300013104 | Bacteria | 2509 |
| 125 | Ga0157369_10021390 | 3300013105 | Bacteria | 7236 |
| 126 | Ga0157369_10056090 | 3300013105 | Bacteria | 4251 |
| 127 | Ga0157369_10085824 | 3300013105 | Bacteria | 3363 |
| 128 | Ga0157369_10103001 | 3300013105 | Bacteria | 3040 |
| 129 | Ga0157378_10059417 | 3300013297 | Bacteria | 3411 |
| 130 | Ga0157378_10633510 | 3300013297 | Unclassified | 1083 |
| 131 | Ga0157378_11175581 | 3300013297 | Unclassified | 806 |
| 132 | Ga0163162_10012712 | 3300013306 | Bacteria | 8220 |
| 133 | Ga0163162_11907059 | 3300013306 | Bacteria | 680 |
| 134 | Ga0163163_10933081 | 3300014325 | Bacteria | 931 |
| 135 | Ga0157380_10297650 | 3300014326 | Bacteria | 1484 |
| 136 | Ga0157380_11693872 | 3300014326 | Bacteria | 690 |
| 137 | Ga0157376_10062314 | 3300014969 | Bacteria | 3138 |
| 138 | Ga0206356_10530246 | 3300020070 | Bacteria | 920 |
| 139 | Ga0206353_11500474 | 3300020082 | Bacteria | 784 |
| 140 | Ga0213872_10000896 | 3300021361 | Bacteria | 21421 |
| 141 | Ga0213872_10003497 | 3300021361 | Bacteria | 8695 |
| 142 | Ga0213872_10148641 | 3300021361 | Bacteria | 1024 |
| 143 | Ga0213872_10173882 | 3300021361 | Bacteria | 932 |
| 144 | Ga0213872_10219929 | 3300021361 | Bacteria | 808 |
| 145 | Ga0213876_10018490 | 3300021384 | Bacteria | 3680 |
| 146 | Ga0207710_10185149 | 3300025900 | Bacteria | 1023 |
| 147 | Ga0207685_10176011 | 3300025905 | Bacteria | 988 |
| 148 | Ga0207654_10106052 | 3300025911 | Bacteria | 1739 |
| 149 | Ga0207654_10691965 | 3300025911 | Bacteria | 732 |
| 150 | Ga0207707_10873601 | 3300025912 | Bacteria | 745 |
| 151 | Ga0207695_10026212 | 3300025913 | Bacteria | 6507 |
| 152 | Ga0207695_10077803 | 3300025913 | Bacteria | 3368 |
| 153 | Ga0207693_10406532 | 3300025915 | Bacteria | 1064 |
| 154 | Ga0207693_11331274 | 3300025915 | Bacteria | 536 |
| 155 | Ga0207663_10621625 | 3300025916 | Bacteria | 850 |
| 156 | Ga0207660_10870609 | 3300025917 | Bacteria | 735 |
| 157 | Ga0207657_10245408 | 3300025919 | Bacteria | 1429 |
| 158 | Ga0207652_10171886 | 3300025921 | Bacteria | 1945 |
| 159 | Ga0207652_10464511 | 3300025921 | Bacteria | 1140 |
| 160 | Ga0207681_10278451 | 3300025923 | Bacteria | 1316 |
| 161 | Ga0207694_10512930 | 3300025924 | Bacteria | 1004 |
| 162 | Ga0207694_10593431 | 3300025924 | Bacteria | 931 |
| 163 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 164 | Ga0207664_10922556 | 3300025929 | Bacteria | 784 |
| 165 | Ga0207664_11136909 | 3300025929 | Bacteria | 697 |
| 166 | Ga0207690_10082801 | 3300025932 | Bacteria | 2245 |
| 167 | Ga0207686_10159582 | 3300025934 | Bacteria | 1579 |
| 168 | Ga0207670_10117311 | 3300025936 | Bacteria | 1929 |
| 169 | Ga0207661_10566699 | 3300025944 | Bacteria | 1041 |
| 170 | Ga0207679_11687757 | 3300025945 | Bacteria | 580 |
| 171 | Ga0207667_10625205 | 3300025949 | Bacteria | 1084 |
| 172 | Ga0207667_12084201 | 3300025949 | Bacteria | 526 |
| 173 | Ga0207712_10000767 | 3300025961 | Bacteria | 24118 |
| 174 | Ga0207668_10000401 | 3300025972 | Bacteria | 27305 |
| 175 | Ga0207658_10000399 | 3300025986 | Bacteria | 41904 |
| 176 | Ga0207677_11870782 | 3300026023 | Unclassified | 557 |
| 177 | Ga0207703_10005619 | 3300026035 | Bacteria | 10066 |
| 178 | Ga0207703_11682210 | 3300026035 | Unclassified | 610 |
| 179 | Ga0207639_10209010 | 3300026041 | Bacteria | 1679 |
| 180 | Ga0207702_10032449 | 3300026078 | Bacteria | 4358 |
| 181 | Ga0207641_11111760 | 3300026088 | Archaea | 789 |
| 182 | Ga0207641_11666963 | 3300026088 | Bacteria | 639 |
| 183 | Ga0207676_10000618 | 3300026095 | Bacteria | 29046 |
| 184 | Ga0207676_12252137 | 3300026095 | Unclassified | 543 |
| 185 | Ga0207674_10400247 | 3300026116 | Bacteria | 1327 |
| 186 | Ga0207674_10729545 | 3300026116 | Bacteria | 956 |
| 187 | Ga0207674_10793209 | 3300026116 | Bacteria | 914 |
| 188 | Ga0207698_10787071 | 3300026142 | Bacteria | 952 |
| 189 | Ga0268266_10880925 | 3300028379 | Bacteria | 865 |
| 190 | Ga0268265_10000836 | 3300028380 | Bacteria | 28993 |
| 191 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 192 | Ga0268264_10050941 | 3300028381 | Bacteria | 3449 |
| 193 | Ga0265337_1141754 | 3300028556 | Bacteria | 651 |
| 194 | Ga0265319_1004585 | 3300028563 | Bacteria | 6802 |
| 195 | Ga0265318_10017649 | 3300028577 | Bacteria | 2926 |
| 196 | Ga0265338_10147470 | 3300028800 | Bacteria | 1833 |
| 197 | Ga0265338_10270943 | 3300028800 | Bacteria | 1244 |
| 198 | Ga0265765_1043670 | 3300030879 | Bacteria | 600 |
| 199 | Ga0265760_10003264 | 3300031090 | Bacteria | 4752 |
| 200 | Ga0265320_10005624 | 3300031240 | Bacteria | 8008 |
| 201 | Ga0265327_10011516 | 3300031251 | Bacteria | 6077 |
| 202 | Ga0265314_10073415 | 3300031711 | Bacteria | 2281 |
| 203 | Ga0373936_0281785 | 3300035113 | Bacteria | 747 |
| 204 | Ga0373953_0518716 | 3300035117 | Unclassified | 529 |
| 205 | Ga0373956_0023664 | 3300035119 | Bacteria | 2638 |
| 206 | Ga0373942_0120759 | 3300035207 | Bacteria | 819 |
| 207 | Ga0373961_0450267 | 3300035241 | Bacteria | 502 |
| 208 | Ga0373935_0326197 | 3300035692 | Bacteria | 1090 |
| 209 | Ga0373927_0071944 | 3300035695 | Bacteria | 2238 |
| 210 | Ga0373927_0237596 | 3300035695 | Bacteria | 1197 |
| 211 | Ga0373925_0281325 | 3300037068 | Bacteria | 1340 |
| 212 | Ga0373925_0820712 | 3300037068 | Unclassified | 767 |
| 213 | Ga0395899_0191529 | 3300037312 | Bacteria | 1431 |
| 214 | Ga0395900_0014536 | 3300037418 | Bacteria | 8033 |
| 215 | Ga0395900_0367885 | 3300037418 | Bacteria | 1408 |
| 216 | Ga0395898_0042297 | 3300037466 | Bacteria | 4497 |
| 217 | Ga0395905_0571621 | 3300037471 | Bacteria | 1032 |
| 218 | Ga0436364_1435110 | 3300037853 | Bacteria | 7795 |
| 219 | Ga0395901_0029822 | 3300038443 | Bacteria | 5619 |
| 220 | Ga0436365_0147566 | 3300039437 | Bacteria | 24744 |
| 221 | Ga0436360_0261003 | 3300039438 | Unclassified | 682 |
| 222 | Ga0436360_0615061 | 3300039438 | Bacteria | 731 |
| 223 | Ga0436360_0626674 | 3300039438 | Bacteria | 648 |
| 224 | Ga0436361_0031240 | 3300039447 | Bacteria | 6783 |
| 225 | Ga0436361_0068243 | 3300039447 | Bacteria | 13025 |
| 226 | Ga0436361_0188685 | 3300039447 | Bacteria | 701 |
| 227 | Ga0436361_0345421 | 3300039447 | Bacteria | 1168 |
| 228 | Ga0436361_0405347 | 3300039447 | Bacteria | 10228 |
| 229 | Ga0436361_0572948 | 3300039447 | Bacteria | 937 |
| 230 | Ga0436361_0650245 | 3300039447 | Bacteria | 549 |
| 231 | Ga0436361_0822453 | 3300039447 | Bacteria | 5991 |
| 232 | Ga0436363_0840603 | 3300039450 | Bacteria | 3267 |
| 233 | Ga0436363_0890242 | 3300039450 | Unclassified | 908 |
| 234 | Ga0436362_0002917 | 3300039453 | Bacteria | 3687 |
| 235 | Ga0466959_0292719 | 3300045049 | Bacteria | 1116 |
| 236 | Ga0451576_1174075 | 3300045051 | Bacteria | 802 |
| 237 | Ga0466967_0047972 | 3300045976 | Bacteria | 3727 |
| 238 | Ga0495651_0593765 | 3300046462 | Bacteria | 699 |
| 239 | Ga0495580_0001544 | 3300046472 | Bacteria | 20251 |
| 240 | Ga0495594_0058971 | 3300046499 | Unclassified | 2122 |
| 241 | Ga0495628_0502814 | 3300046516 | Bacteria | 875 |
| 242 | Ga0495630_0613464 | 3300046517 | Bacteria | 834 |
| 243 | Ga0495666_0159425 | 3300046526 | Unclassified | 1047 |
| 244 | Ga0495652_0834203 | 3300046529 | Bacteria | 612 |
| 245 | Ga0495599_0037393 | 3300046678 | Bacteria | 3049 |
| 246 | Ga0495646_0363709 | 3300046680 | Unclassified | 756 |
| 247 | Ga0495669_0055555 | 3300046684 | Bacteria | 1783 |
| 248 | Ga0495624_0054071 | 3300046690 | Unclassified | 2533 |
| 249 | Ga0495670_0379351 | 3300046691 | Bacteria | 763 |
| 250 | Ga0495674_0013600 | 3300047319 | Bacteria | 7645 |
| 251 | Ga0495686_0064366 | 3300047472 | Bacteria | 2270 |
| 252 | Ga0495602_0004862 | 3300048088 | Bacteria | 14069 |
| 253 | Ga0496100_0606799 | 3300048903 | Bacteria | 850 |
| 254 | Ga0496103_0434630 | 3300048906 | Bacteria | 842 |
| 255 | Ga0496104_1083759 | 3300048907 | Bacteria | 705 |
| 256 | Ga0496107_0390647 | 3300048910 | Bacteria | 1035 |
| 257 | Ga0496108_1008332 | 3300048911 | Unclassified | 711 |
| 258 | Ga0496111_0408465 | 3300048914 | Bacteria | 1003 |
| 259 | Ga0496112_0273270 | 3300048915 | Bacteria | 1638 |
| 260 | Ga0496113_0852647 | 3300048916 | Unclassified | 722 |
| 261 | Ga0496113_0907277 | 3300048916 | Bacteria | 697 |
| 262 | Ga0496114_0426042 | 3300048917 | Bacteria | 1175 |
| 263 | Ga0496115_0299838 | 3300048918 | Unclassified | 1317 |
| 264 | Ga0496119_0451689 | 3300048922 | Unclassified | 605 |
| 265 | Ga0496120_0076785 | 3300048923 | Bacteria | 1819 |
| 266 | Ga0496124_0000204 | 3300048927 | Bacteria | 116976 |
| 267 | Ga0496126_0298441 | 3300048929 | Bacteria | 1330 |
| 268 | Ga0496126_0878384 | 3300048929 | Bacteria | 682 |
| 269 | Ga0501036_0225512 | 3300049572 | Unclassified | 1573 |
| 270 | Ga0501039_0095101 | 3300049575 | Unclassified | 2323 |
| 271 | Ga0501040_0029214 | 3300049576 | Unclassified | 3721 |
| 272 | Ga0501041_0065912 | 3300049577 | Bacteria | 2219 |
| 273 | Ga0501042_0941323 | 3300049578 | Unclassified | 629 |
| 274 | Ga0501068_0612322 | 3300049584 | Unclassified | 710 |
| 275 | Ga0501068_0860319 | 3300049584 | Bacteria | 596 |
| 276 | Ga0501068_1132833 | 3300049584 | Unclassified | 518 |
| 277 | Ga0501069_0644567 | 3300049585 | Bacteria | 637 |
| 278 | Ga0501071_0054711 | 3300049587 | Bacteria | 2880 |
| 279 | Ga0501072_1212746 | 3300049588 | Unclassified | 586 |
| 280 | Ga0501075_0020403 | 3300049591 | Bacteria | 4821 |
| 281 | Ga0501075_0238563 | 3300049591 | Bacteria | 1386 |
| 282 | Ga0501076_0021704 | 3300049592 | Bacteria | 4929 |
| 283 | Ga0501076_1032485 | 3300049592 | Unclassified | 677 |
| 284 | Ga0501079_1009879 | 3300049741 | Unclassified | 655 |
| 285 | Ga0501080_0396607 | 3300049742 | Bacteria | 1242 |
| 286 | Ga0501081_0014992 | 3300049743 | Bacteria | 5115 |
| 287 | Ga0501035_1173809 | 3300049822 | Unclassified | 597 |
| 288 | nmdc:mga08y16_1230446_c1 | 3300050511 | Bacteria | 718 |
| 289 | nmdc:mga0n895_1227154_c1 | 3300050512 | Unclassified | 723 |
| 290 | nmdc:mga08x19_100890_c1 | 3300050514 | Unclassified | 1915 |
| 291 | nmdc:mga0a205_861015_c1 | 3300050515 | Unclassified | 753 |
| 292 | Ga0500641_0036101 | 3300053096 | Bacteria | 1976 |
| 293 | Ga0500556_0068125 | 3300053104 | Bacteria | 1325 |
| 294 | Ga0500595_001391 | 3300053119 | Bacteria | 12967 |
| 295 | Ga0500577_0000243 | 3300053142 | Bacteria | 14211 |
| 296 | Ga0500616_0089029 | 3300053153 | Bacteria | 1533 |
| 297 | Ga0500639_339300 | 3300053163 | Bacteria | 539 |
| 298 | Ga0501084_0144271 | 3300054114 | Bacteria | 2005 |
| 299 | Ga0501082_0076465 | 3300060353 | Unclassified | 2886 |
| 300 | Ga0530510_0173701 | 3300061734 | Unclassified | 1596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100523699 | Ga0070670_1005236992 | 69 |
| 2 | 3300005341 | Ga0070691_10292864 | Ga0070691_102928641 | 69 |
| 3 | 3300005456 | Ga0070678_101262003 | Ga0070678_1012620031 | 69 |
| 4 | 3300005547 | Ga0070693_100206306 | Ga0070693_1002063062 | 69 |
| 5 | 3300005548 | Ga0070665_100084240 | Ga0070665_1000842404 | 69 |
| 6 | 3300005564 | Ga0070664_102279807 | Ga0070664_1022798071 | 69 |
| 7 | 3300005615 | Ga0070702_100196611 | Ga0070702_1001966112 | 69 |
| 8 | 3300005840 | Ga0068870_10724183 | Ga0068870_107241832 | 69 |
| 9 | 3300005840 | Ga0068870_11212797 | Ga0068870_112127972 | 69 |
| 10 | 3300005844 | Ga0068862_100207601 | Ga0068862_1002076011 | 69 |
| 11 | 3300009148 | Ga0105243_10429809 | Ga0105243_104298092 | 69 |
| 12 | 3300009553 | Ga0105249_11551312 | Ga0105249_115513121 | 69 |
| 13 | 3300010375 | Ga0105239_10960656 | Ga0105239_109606562 | 69 |
| 14 | 3300010375 | Ga0105239_11344343 | Ga0105239_113443432 | 69 |
| 15 | 3300011119 | Ga0105246_10028393 | Ga0105246_100283934 | 69 |
| 16 | 3300014326 | Ga0157380_11693872 | Ga0157380_116938722 | 69 |
| 17 | 3300025936 | Ga0207670_10117311 | Ga0207670_101173113 | 69 |
| 18 | 3300026095 | Ga0207676_12252137 | Ga0207676_122521372 | 69 |
| 19 | 3300028800 | Ga0265338_10270943 | Ga0265338_102709432 | 69 |
| 20 | 3300035241 | Ga0373961_0450267 | Ga0373961_0450267_241_462 | 69 |
| 21 | 3300048903 | Ga0496100_0606799 | Ga0496100_0606799_559_780 | 69 |
| 22 | 3300048906 | Ga0496103_0434630 | Ga0496103_0434630_438_659 | 69 |
| 23 | 3300048910 | Ga0496107_0390647 | Ga0496107_0390647_437_658 | 69 |
| 24 | 3300048917 | Ga0496114_0426042 | Ga0496114_0426042_711_932 | 69 |
| 25 | 3300053096 | Ga0500641_0036101 | Ga0500641_0036101_269_490 | 69 |
| 26 | 3300005289 | Ga0065704_10209365 | Ga0065704_102093652 | 70 |
| 27 | 3300005295 | Ga0065707_10090534 | Ga0065707_100905342 | 70 |
| 28 | 3300005353 | Ga0070669_100023764 | Ga0070669_1000237642 | 70 |
| 29 | 3300005439 | Ga0070711_100297732 | Ga0070711_1002977323 | 70 |
| 30 | 3300005456 | Ga0070678_101594394 | Ga0070678_1015943942 | 70 |
| 31 | 3300005543 | Ga0070672_100670356 | Ga0070672_1006703562 | 70 |
| 32 | 3300005546 | Ga0070696_101740425 | Ga0070696_1017404252 | 70 |
| 33 | 3300005843 | Ga0068860_100174410 | Ga0068860_1001744103 | 70 |
| 34 | 3300006237 | Ga0097621_101651857 | Ga0097621_1016518572 | 70 |
| 35 | 3300006358 | Ga0068871_100095783 | Ga0068871_1000957831 | 70 |
| 36 | 3300006871 | Ga0075434_101376434 | Ga0075434_1013764342 | 70 |
| 37 | 3300009147 | Ga0114129_12650591 | Ga0114129_126505912 | 70 |
| 38 | 3300009148 | Ga0105243_10068691 | Ga0105243_100686914 | 70 |
| 39 | 3300009148 | Ga0105243_10308771 | Ga0105243_103087712 | 70 |
| 40 | 3300009174 | Ga0105241_10028379 | Ga0105241_100283796 | 70 |
| 41 | 3300009174 | Ga0105241_10619439 | Ga0105241_106194392 | 70 |
| 42 | 3300009174 | Ga0105241_11261835 | Ga0105241_112618352 | 70 |
| 43 | 3300009177 | Ga0105248_10969235 | Ga0105248_109692352 | 70 |
| 44 | 3300009545 | Ga0105237_12783063 | Ga0105237_127830632 | 70 |
| 45 | 3300009553 | Ga0105249_10299299 | Ga0105249_102992992 | 70 |
| 46 | 3300013297 | Ga0157378_10633510 | Ga0157378_106335102 | 70 |
| 47 | 3300013297 | Ga0157378_11175581 | Ga0157378_111755813 | 70 |
| 48 | 3300013306 | Ga0163162_10012712 | Ga0163162_100127121 | 70 |
| 49 | 3300014326 | Ga0157380_10297650 | Ga0157380_102976503 | 70 |
| 50 | 3300025911 | Ga0207654_10106052 | Ga0207654_101060522 | 70 |
| 51 | 3300025934 | Ga0207686_10159582 | Ga0207686_101595823 | 70 |
| 52 | 3300026088 | Ga0207641_11111760 | Ga0207641_111117601 | 70 |
| 53 | 3300028381 | Ga0268264_10050941 | Ga0268264_100509412 | 70 |
| 54 | 3300046684 | Ga0495669_0055555 | Ga0495669_0055555_76_297 | 70 |
| 55 | 3300046691 | Ga0495670_0379351 | Ga0495670_0379351_160_381 | 70 |
| 56 | 3300049572 | Ga0501036_0225512 | Ga0501036_0225512_1062_1289 | 70 |
| 57 | 3300049575 | Ga0501039_0095101 | Ga0501039_0095101_613_840 | 70 |
| 58 | 3300049576 | Ga0501040_0029214 | Ga0501040_0029214_1431_1658 | 70 |
| 59 | 3300049577 | Ga0501041_0065912 | Ga0501041_0065912_1026_1253 | 70 |
| 60 | 3300049578 | Ga0501042_0941323 | Ga0501042_0941323_281_508 | 70 |
| 61 | 3300049584 | Ga0501068_1132833 | Ga0501068_1132833_238_465 | 70 |
| 62 | 3300049587 | Ga0501071_0054711 | Ga0501071_0054711_546_773 | 70 |
| 63 | 3300049588 | Ga0501072_1212746 | Ga0501072_1212746_271_498 | 70 |
| 64 | 3300049591 | Ga0501075_0020403 | Ga0501075_0020403_600_827 | 70 |
| 65 | 3300049592 | Ga0501076_0021704 | Ga0501076_0021704_3415_3642 | 70 |
| 66 | 3300049741 | Ga0501079_1009879 | Ga0501079_1009879_231_458 | 70 |
| 67 | 3300049742 | Ga0501080_0396607 | Ga0501080_0396607_171_398 | 70 |
| 68 | 3300049743 | Ga0501081_0014992 | Ga0501081_0014992_3702_3929 | 70 |
| 69 | 3300049822 | Ga0501035_1173809 | Ga0501035_1173809_80_307 | 70 |
| 70 | 3300054114 | Ga0501084_0144271 | Ga0501084_0144271_235_462 | 70 |
| 71 | 3300060353 | Ga0501082_0076465 | Ga0501082_0076465_1193_1420 | 70 |
| 72 | 3300061734 | Ga0530510_0173701 | Ga0530510_0173701_164_391 | 70 |
| 73 | iso_pu_bacteria | 8056689827 | 8056694290 | 70 |
| 74 | 3300005262 | Ga0065165_1008563 | Ga0065165_10085631 | 71 |
| 75 | 3300005331 | Ga0070670_100000426 | Ga0070670_10000042633 | 71 |
| 76 | 3300005335 | Ga0070666_10177074 | Ga0070666_101770742 | 71 |
| 77 | 3300005336 | Ga0070680_100135444 | Ga0070680_1001354442 | 71 |
| 78 | 3300005337 | Ga0070682_100755103 | Ga0070682_1007551032 | 71 |
| 79 | 3300005337 | Ga0070682_100885292 | Ga0070682_1008852921 | 71 |
| 80 | 3300005339 | Ga0070660_100283835 | Ga0070660_1002838352 | 71 |
| 81 | 3300005347 | Ga0070668_100000042 | Ga0070668_10000004249 | 71 |
| 82 | 3300005353 | Ga0070669_100669486 | Ga0070669_1006694862 | 71 |
| 83 | 3300005366 | Ga0070659_100014194 | Ga0070659_1000141947 | 71 |
| 84 | 3300005367 | Ga0070667_100000168 | Ga0070667_1000001687 | 71 |
| 85 | 3300005445 | Ga0070708_100664279 | Ga0070708_1006642791 | 71 |
| 86 | 3300005456 | Ga0070678_100164112 | Ga0070678_1001641121 | 71 |
| 87 | 3300005530 | Ga0070679_100055817 | Ga0070679_1000558175 | 71 |
| 88 | 3300005548 | Ga0070665_100002287 | Ga0070665_10000228725 | 71 |
| 89 | 3300005563 | Ga0068855_102363416 | Ga0068855_1023634161 | 71 |
| 90 | 3300005577 | Ga0068857_100048940 | Ga0068857_1000489402 | 71 |
| 91 | 3300005577 | Ga0068857_100852842 | Ga0068857_1008528421 | 71 |
| 92 | 3300005617 | Ga0068859_100019113 | Ga0068859_1000191134 | 71 |
| 93 | 3300005618 | Ga0068864_100000135 | Ga0068864_10000013523 | 71 |
| 94 | 3300005841 | Ga0068863_100012986 | Ga0068863_1000129863 | 71 |
| 95 | 3300005842 | Ga0068858_100019958 | Ga0068858_1000199589 | 71 |
| 96 | 3300005842 | Ga0068858_100379538 | Ga0068858_1003795382 | 71 |
| 97 | 3300005843 | Ga0068860_100000133 | Ga0068860_10000013370 | 71 |
| 98 | 3300005844 | Ga0068862_100009611 | Ga0068862_1000096111 | 71 |
| 99 | 3300005844 | Ga0068862_101149447 | Ga0068862_1011494471 | 71 |
| 100 | 3300006931 | Ga0097620_100019113 | Ga0097620_1000191138 | 71 |
| 101 | 3300007076 | Ga0075435_101412145 | Ga0075435_1014121451 | 71 |
| 102 | 3300013104 | Ga0157370_10009664 | Ga0157370_1000966415 | 71 |
| 103 | 3300013105 | Ga0157369_10085824 | Ga0157369_100858245 | 71 |
| 104 | 3300014969 | Ga0157376_10062314 | Ga0157376_100623144 | 71 |
| 105 | 3300021361 | Ga0213872_10000896 | Ga0213872_100008962 | 71 |
| 106 | 3300021361 | Ga0213872_10003497 | Ga0213872_100034972 | 71 |
| 107 | 3300021361 | Ga0213872_10148641 | Ga0213872_101486412 | 71 |
| 108 | 3300021361 | Ga0213872_10173882 | Ga0213872_101738822 | 71 |
| 109 | 3300021361 | Ga0213872_10219929 | Ga0213872_102199292 | 71 |
| 110 | 3300025900 | Ga0207710_10185149 | Ga0207710_101851492 | 71 |
| 111 | 3300025912 | Ga0207707_10873601 | Ga0207707_108736012 | 71 |
| 112 | 3300025915 | Ga0207693_11331274 | Ga0207693_113312741 | 71 |
| 113 | 3300025917 | Ga0207660_10870609 | Ga0207660_108706092 | 71 |
| 114 | 3300025919 | Ga0207657_10245408 | Ga0207657_102454083 | 71 |
| 115 | 3300025921 | Ga0207652_10464511 | Ga0207652_104645113 | 71 |
| 116 | 3300025923 | Ga0207681_10278451 | Ga0207681_102784512 | 71 |
| 117 | 3300025925 | Ga0207650_10000016 | Ga0207650_10000016181 | 71 |
| 118 | 3300025929 | Ga0207664_10922556 | Ga0207664_109225562 | 71 |
| 119 | 3300025929 | Ga0207664_11136909 | Ga0207664_111369092 | 71 |
| 120 | 3300025932 | Ga0207690_10082801 | Ga0207690_100828012 | 71 |
| 121 | 3300025949 | Ga0207667_12084201 | Ga0207667_120842011 | 71 |
| 122 | 3300025961 | Ga0207712_10000767 | Ga0207712_100007673 | 71 |
| 123 | 3300025972 | Ga0207668_10000401 | Ga0207668_1000040131 | 71 |
| 124 | 3300025986 | Ga0207658_10000399 | Ga0207658_100003991 | 71 |
| 125 | 3300026035 | Ga0207703_10005619 | Ga0207703_100056195 | 71 |
| 126 | 3300026035 | Ga0207703_11682210 | Ga0207703_116822101 | 71 |
| 127 | 3300026088 | Ga0207641_11666963 | Ga0207641_116669631 | 71 |
| 128 | 3300026095 | Ga0207676_10000618 | Ga0207676_1000061828 | 71 |
| 129 | 3300026116 | Ga0207674_10400247 | Ga0207674_104002472 | 71 |
| 130 | 3300026116 | Ga0207674_10729545 | Ga0207674_107295452 | 71 |
| 131 | 3300026116 | Ga0207674_10793209 | Ga0207674_107932092 | 71 |
| 132 | 3300028379 | Ga0268266_10880925 | Ga0268266_108809252 | 71 |
| 133 | 3300028380 | Ga0268265_10000836 | Ga0268265_100008366 | 71 |
| 134 | 3300028381 | Ga0268264_10000207 | Ga0268264_10000207101 | 71 |
| 135 | 3300028556 | Ga0265337_1141754 | Ga0265337_11417542 | 71 |
| 136 | 3300028800 | Ga0265338_10147470 | Ga0265338_101474702 | 71 |
| 137 | 3300030879 | Ga0265765_1043670 | Ga0265765_10436702 | 71 |
| 138 | 3300031090 | Ga0265760_10003264 | Ga0265760_100032644 | 71 |
| 139 | 3300035117 | Ga0373953_0518716 | Ga0373953_0518716_38_259 | 71 |
| 140 | 3300035207 | Ga0373942_0120759 | Ga0373942_0120759_285_506 | 71 |
| 141 | 3300039438 | Ga0436360_0261003 | Ga0436360_0261003_305_526 | 71 |
| 142 | 3300039447 | Ga0436361_0031240 | Ga0436361_0031240_5209_5430 | 71 |
| 143 | 3300039447 | Ga0436361_0068243 | Ga0436361_0068243_9814_10035 | 71 |
| 144 | 3300039447 | Ga0436361_0188685 | Ga0436361_0188685_43_264 | 71 |
| 145 | 3300039447 | Ga0436361_0345421 | Ga0436361_0345421_222_443 | 71 |
| 146 | 3300039447 | Ga0436361_0405347 | Ga0436361_0405347_2281_2502 | 71 |
| 147 | 3300039447 | Ga0436361_0572948 | Ga0436361_0572948_220_441 | 71 |
| 148 | 3300039447 | Ga0436361_0822453 | Ga0436361_0822453_1800_2021 | 71 |
| 149 | 3300039450 | Ga0436363_0890242 | Ga0436363_0890242_159_380 | 71 |
| 150 | 3300046462 | Ga0495651_0593765 | Ga0495651_0593765_290_511 | 71 |
| 151 | 3300046516 | Ga0495628_0502814 | Ga0495628_0502814_423_644 | 71 |
| 152 | 3300046529 | Ga0495652_0834203 | Ga0495652_0834203_169_390 | 71 |
| 153 | 3300048918 | Ga0496115_0299838 | Ga0496115_0299838_779_1000 | 71 |
| 154 | 3300005327 | Ga0070658_10349364 | Ga0070658_103493642 | 72 |
| 155 | 3300005435 | Ga0070714_101716030 | Ga0070714_1017160301 | 72 |
| 156 | 3300005437 | Ga0070710_10282059 | Ga0070710_102820592 | 72 |
| 157 | 3300005471 | Ga0070698_100329570 | Ga0070698_1003295703 | 72 |
| 158 | 3300005563 | Ga0068855_101100849 | Ga0068855_1011008492 | 72 |
| 159 | 3300005614 | Ga0068856_101599789 | Ga0068856_1015997892 | 72 |
| 160 | 3300005937 | Ga0081455_10018684 | Ga0081455_100186841 | 72 |
| 161 | 3300005937 | Ga0081455_10071469 | Ga0081455_100714692 | 72 |
| 162 | 3300006173 | Ga0070716_100109451 | Ga0070716_1001094512 | 72 |
| 163 | 3300006175 | Ga0070712_100374844 | Ga0070712_1003748442 | 72 |
| 164 | 3300006175 | Ga0070712_100912342 | Ga0070712_1009123421 | 72 |
| 165 | 3300006237 | Ga0097621_100225459 | Ga0097621_1002254595 | 72 |
| 166 | 3300006358 | Ga0068871_100161856 | Ga0068871_1001618562 | 72 |
| 167 | 3300007788 | Ga0099795_10049687 | Ga0099795_100496873 | 72 |
| 168 | 3300007788 | Ga0099795_10454782 | Ga0099795_104547822 | 72 |
| 169 | 3300009093 | Ga0105240_10708482 | Ga0105240_107084821 | 72 |
| 170 | 3300009551 | Ga0105238_11065625 | Ga0105238_110656252 | 72 |
| 171 | 3300010159 | Ga0099796_10012636 | Ga0099796_100126362 | 72 |
| 172 | 3300010159 | Ga0099796_10013881 | Ga0099796_100138811 | 72 |
| 173 | 3300013297 | Ga0157378_10059417 | Ga0157378_100594174 | 72 |
| 174 | 3300021384 | Ga0213876_10018490 | Ga0213876_100184904 | 72 |
| 175 | 3300025911 | Ga0207654_10691965 | Ga0207654_106919652 | 72 |
| 176 | 3300025913 | Ga0207695_10026212 | Ga0207695_100262128 | 72 |
| 177 | 3300025915 | Ga0207693_10406532 | Ga0207693_104065322 | 72 |
| 178 | 3300025916 | Ga0207663_10621625 | Ga0207663_106216251 | 72 |
| 179 | 3300037418 | Ga0395900_0367885 | Ga0395900_0367885_560_784 | 72 |
| 180 | 3300037471 | Ga0395905_0571621 | Ga0395905_0571621_551_775 | 72 |
| 181 | 3300039437 | Ga0436365_0147566 | Ga0436365_0147566_23484_23708 | 72 |
| 182 | 3300039438 | Ga0436360_0626674 | Ga0436360_0626674_82_306 | 72 |
| 183 | 3300039450 | Ga0436363_0840603 | Ga0436363_0840603_35_259 | 72 |
| 184 | 3300039453 | Ga0436362_0002917 | Ga0436362_0002917_1601_1825 | 72 |
| 185 | 3300046680 | Ga0495646_0363709 | Ga0495646_0363709_428_652 | 72 |
| 186 | 3300046690 | Ga0495624_0054071 | Ga0495624_0054071_1865_2089 | 72 |
| 187 | 3300047319 | Ga0495674_0013600 | Ga0495674_0013600_4358_4582 | 72 |
| 188 | 3300047472 | Ga0495686_0064366 | Ga0495686_0064366_906_1130 | 72 |
| 189 | 3300048088 | Ga0495602_0004862 | Ga0495602_0004862_8458_8682 | 72 |
| 190 | 3300049584 | Ga0501068_0860319 | Ga0501068_0860319_251_475 | 72 |
| 191 | 3300053104 | Ga0500556_0068125 | Ga0500556_0068125_816_1040 | 72 |
| 192 | 3300053119 | Ga0500595_001391 | Ga0500595_001391_12242_12466 | 72 |
| 193 | 3300053142 | Ga0500577_0000243 | Ga0500577_0000243_12819_13043 | 72 |
| 194 | 3300053153 | Ga0500616_0089029 | Ga0500616_0089029_577_801 | 72 |
| 195 | 3300005366 | Ga0070659_100495672 | Ga0070659_1004956721 | 73 |
| 196 | 3300005435 | Ga0070714_100185155 | Ga0070714_1001851552 | 73 |
| 197 | 3300005455 | Ga0070663_100508844 | Ga0070663_1005088442 | 73 |
| 198 | 3300005458 | Ga0070681_11013249 | Ga0070681_110132492 | 73 |
| 199 | 3300005467 | Ga0070706_100498442 | Ga0070706_1004984422 | 73 |
| 200 | 3300005518 | Ga0070699_100003297 | Ga0070699_1000032979 | 73 |
| 201 | 3300005530 | Ga0070679_100221669 | Ga0070679_1002216692 | 73 |
| 202 | 3300005535 | Ga0070684_100784508 | Ga0070684_1007845081 | 73 |
| 203 | 3300005536 | Ga0070697_100006576 | Ga0070697_1000065762 | 73 |
| 204 | 3300005539 | Ga0068853_100357949 | Ga0068853_1003579492 | 73 |
| 205 | 3300005545 | Ga0070695_100466275 | Ga0070695_1004662751 | 73 |
| 206 | 3300005547 | Ga0070693_100107414 | Ga0070693_1001074142 | 73 |
| 207 | 3300005563 | Ga0068855_100701351 | Ga0068855_1007013512 | 73 |
| 208 | 3300005577 | Ga0068857_100200663 | Ga0068857_1002006633 | 73 |
| 209 | 3300005614 | Ga0068856_100048356 | Ga0068856_1000483562 | 73 |
| 210 | 3300005616 | Ga0068852_101734735 | Ga0068852_1017347352 | 73 |
| 211 | 3300006028 | Ga0070717_11544143 | Ga0070717_115441432 | 73 |
| 212 | 3300006173 | Ga0070716_100991686 | Ga0070716_1009916861 | 73 |
| 213 | 3300006852 | Ga0075433_11083508 | Ga0075433_110835083 | 73 |
| 214 | 3300006871 | Ga0075434_101398337 | Ga0075434_1013983371 | 73 |
| 215 | 3300006914 | Ga0075436_100676401 | Ga0075436_1006764012 | 73 |
| 216 | 3300009093 | Ga0105240_10267976 | Ga0105240_102679764 | 73 |
| 217 | 3300009545 | Ga0105237_10215289 | Ga0105237_102152894 | 73 |
| 218 | 3300013104 | Ga0157370_10062055 | Ga0157370_100620554 | 73 |
| 219 | 3300013105 | Ga0157369_10021390 | Ga0157369_100213904 | 73 |
| 220 | 3300013306 | Ga0163162_11907059 | Ga0163162_119070592 | 73 |
| 221 | 3300020070 | Ga0206356_10530246 | Ga0206356_105302462 | 73 |
| 222 | 3300020082 | Ga0206353_11500474 | Ga0206353_115004742 | 73 |
| 223 | 3300025905 | Ga0207685_10176011 | Ga0207685_101760112 | 73 |
| 224 | 3300025913 | Ga0207695_10077803 | Ga0207695_100778032 | 73 |
| 225 | 3300025921 | Ga0207652_10171886 | Ga0207652_101718863 | 73 |
| 226 | 3300025924 | Ga0207694_10512930 | Ga0207694_105129302 | 73 |
| 227 | 3300025944 | Ga0207661_10566699 | Ga0207661_105666992 | 73 |
| 228 | 3300025949 | Ga0207667_10625205 | Ga0207667_106252052 | 73 |
| 229 | 3300026023 | Ga0207677_11870782 | Ga0207677_118707822 | 73 |
| 230 | 3300026041 | Ga0207639_10209010 | Ga0207639_102090102 | 73 |
| 231 | 3300026078 | Ga0207702_10032449 | Ga0207702_100324495 | 73 |
| 232 | 3300026142 | Ga0207698_10787071 | Ga0207698_107870712 | 73 |
| 233 | 3300031251 | Ga0265327_10011516 | Ga0265327_100115161 | 73 |
| 234 | 3300035119 | Ga0373956_0023664 | Ga0373956_0023664_139_360 | 73 |
| 235 | 3300035692 | Ga0373935_0326197 | Ga0373935_0326197_838_1059 | 73 |
| 236 | 3300035695 | Ga0373927_0071944 | Ga0373927_0071944_774_1001 | 73 |
| 237 | 3300035695 | Ga0373927_0237596 | Ga0373927_0237596_640_867 | 73 |
| 238 | 3300037068 | Ga0373925_0281325 | Ga0373925_0281325_479_706 | 73 |
| 239 | 3300037068 | Ga0373925_0820712 | Ga0373925_0820712_113_340 | 73 |
| 240 | 3300037312 | Ga0395899_0191529 | Ga0395899_0191529_931_1155 | 73 |
| 241 | 3300037418 | Ga0395900_0014536 | Ga0395900_0014536_7333_7557 | 73 |
| 242 | 3300037466 | Ga0395898_0042297 | Ga0395898_0042297_2104_2328 | 73 |
| 243 | 3300038443 | Ga0395901_0029822 | Ga0395901_0029822_447_671 | 73 |
| 244 | 3300039438 | Ga0436360_0615061 | Ga0436360_0615061_95_319 | 73 |
| 245 | 3300039447 | Ga0436361_0650245 | Ga0436361_0650245_78_302 | 73 |
| 246 | 3300046472 | Ga0495580_0001544 | Ga0495580_0001544_18181_18408 | 73 |
| 247 | 3300046499 | Ga0495594_0058971 | Ga0495594_0058971_1470_1697 | 73 |
| 248 | 3300046517 | Ga0495630_0613464 | Ga0495630_0613464_428_655 | 73 |
| 249 | 3300046526 | Ga0495666_0159425 | Ga0495666_0159425_256_483 | 73 |
| 250 | 3300046678 | Ga0495599_0037393 | Ga0495599_0037393_207_428 | 73 |
| 251 | 3300048907 | Ga0496104_1083759 | Ga0496104_1083759_26_247 | 73 |
| 252 | 3300048911 | Ga0496108_1008332 | Ga0496108_1008332_476_697 | 73 |
| 253 | 3300048915 | Ga0496112_0273270 | Ga0496112_0273270_1014_1235 | 73 |
| 254 | 3300048916 | Ga0496113_0852647 | Ga0496113_0852647_46_267 | 73 |
| 255 | 3300048916 | Ga0496113_0907277 | Ga0496113_0907277_390_611 | 73 |
| 256 | 3300048922 | Ga0496119_0451689 | Ga0496119_0451689_201_422 | 73 |
| 257 | 3300048923 | Ga0496120_0076785 | Ga0496120_0076785_1413_1640 | 73 |
| 258 | 3300048927 | Ga0496124_0000204 | Ga0496124_0000204_9476_9703 | 73 |
| 259 | 3300048929 | Ga0496126_0298441 | Ga0496126_0298441_928_1155 | 73 |
| 260 | 3300048929 | Ga0496126_0878384 | Ga0496126_0878384_39_266 | 73 |
| 261 | 3300049585 | Ga0501069_0644567 | Ga0501069_0644567_116_337 | 73 |
| 262 | 3300050512 | nmdc:mga0n895_1227154_c1 | nmdc:mga0n895_1227154_c1_478_699 | 73 |
| 263 | 3300050514 | nmdc:mga08x19_100890_c1 | nmdc:mga08x19_100890_c1_1327_1548 | 73 |
| 264 | 3300050515 | nmdc:mga0a205_861015_c1 | nmdc:mga0a205_861015_c1_49_270 | 73 |
| 265 | 3300005327 | Ga0070658_10049522 | Ga0070658_100495222 | 74 |
| 266 | 3300005339 | Ga0070660_100161740 | Ga0070660_1001617402 | 74 |
| 267 | 3300005539 | Ga0068853_100223909 | Ga0068853_1002239093 | 74 |
| 268 | 3300005563 | Ga0068855_100380722 | Ga0068855_1003807222 | 74 |
| 269 | 3300005564 | Ga0070664_101589028 | Ga0070664_1015890282 | 74 |
| 270 | 3300005614 | Ga0068856_100046498 | Ga0068856_1000464987 | 74 |
| 271 | 3300005616 | Ga0068852_100869034 | Ga0068852_1008690342 | 74 |
| 272 | 3300009093 | Ga0105240_10050323 | Ga0105240_100503236 | 74 |
| 273 | 3300009093 | Ga0105240_11161801 | Ga0105240_111618012 | 74 |
| 274 | 3300009545 | Ga0105237_11472698 | Ga0105237_114726982 | 74 |
| 275 | 3300009551 | Ga0105238_10127261 | Ga0105238_101272615 | 74 |
| 276 | 3300009551 | Ga0105238_10199147 | Ga0105238_101991472 | 74 |
| 277 | 3300009553 | Ga0105249_11269907 | Ga0105249_112699071 | 74 |
| 278 | 3300010159 | Ga0099796_10006618 | Ga0099796_100066183 | 74 |
| 279 | 3300013104 | Ga0157370_10115312 | Ga0157370_101153122 | 74 |
| 280 | 3300013105 | Ga0157369_10056090 | Ga0157369_100560901 | 74 |
| 281 | 3300013105 | Ga0157369_10103001 | Ga0157369_101030014 | 74 |
| 282 | 3300025924 | Ga0207694_10593431 | Ga0207694_105934312 | 74 |
| 283 | 3300025945 | Ga0207679_11687757 | Ga0207679_116877572 | 74 |
| 284 | 3300028563 | Ga0265319_1004585 | Ga0265319_10045854 | 74 |
| 285 | 3300028577 | Ga0265318_10017649 | Ga0265318_100176494 | 74 |
| 286 | 3300031240 | Ga0265320_10005624 | Ga0265320_100056243 | 74 |
| 287 | 3300031711 | Ga0265314_10073415 | Ga0265314_100734152 | 74 |
| 288 | 3300035113 | Ga0373936_0281785 | Ga0373936_0281785_416_649 | 74 |
| 289 | 3300037853 | Ga0436364_1435110 | Ga0436364_1435110_6386_6622 | 74 |
| 290 | 3300045049 | Ga0466959_0292719 | Ga0466959_0292719_93_329 | 74 |
| 291 | 3300045051 | Ga0451576_1174075 | Ga0451576_1174075_222_452 | 74 |
| 292 | 3300048914 | Ga0496111_0408465 | Ga0496111_0408465_434_664 | 74 |
| 293 | 3300049584 | Ga0501068_0612322 | Ga0501068_0612322_42_284 | 74 |
| 294 | 3300049591 | Ga0501075_0238563 | Ga0501075_0238563_629_871 | 74 |
| 295 | 3300049592 | Ga0501076_1032485 | Ga0501076_1032485_388_630 | 74 |
| 296 | 3300050511 | nmdc:mga08y16_1230446_c1 | nmdc:mga08y16_1230446_c1_192_449 | 74 |
| 297 | 3300053163 | Ga0500639_339300 | Ga0500639_339300_262_495 | 74 |
| 298 | 3300014325 | Ga0163163_10933081 | Ga0163163_109330812 | 75 |
| 299 | 3300045976 | Ga0466967_0047972 | Ga0466967_0047972_1463_1696 | 75 |
| 300 | 3300003203 | JGI25406J46586_10124742 | JGI25406J46586_101247421 | 77 |
| 301 | 3300005985 | Ga0081539_10006163 | Ga0081539_100061639 | 77 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wyn-assembly2.cif.gz_A | structure of family 37 trehalase from escherichia coli in complex with a casuarine-6-o-a-d-glucoside analogue | 0.9547 | 28 | 62 |
| 5z6h-assembly1.cif.gz_A | structure of periplasmic trehalase from diamondback moth gut bacteria in the apo form | 0.9255 | 28 | 62 |
| 1lf9-assembly2.cif.gz_B | crystal structure of bacterial glucoamylase complexed with acarbose | 0.9242 | 25 | 62 |
| 6pwi-assembly2.cif.gz_B | structure of cpgh84d | 0.9019 | 26 | 66 |
| 7eaw-assembly1.cif.gz_A | trehalase of arabidopsis thaliana acid mutant -d380a trehalose complex | 0.8896 | 28 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LYJ0_192_318_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9671 | 30 | 62 | 1.25.40.10 |
| af_A0A1D8PQM5_331_505_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9546 | 33 | 65 | 1.25.40.10 |
| af_A0A0R0HNZ6_194_319_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9411 | 30 | 64 | 1.25.40.10 |
| af_A4IBU6_124_199_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9386 | 33 | 64 | 1.25.40.10 |
| af_Q8TE82_738_940_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9311 | 8 | 65 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0DYU6-F1-model_v4 | Uncharacterized protein | 0.9532 | 1 | 66 |
GO:0016020
|
| AF-A0A2H0BCD9-F1-model_v4 | PPM-type phosphatase domain-containing protein | 0.9421 | 2 | 65 |
GO:0016020
|
| AF-A0A7S1Z1U5-F1-model_v4 | Kinesin light chain | 0.9382 | 8 | 70 |
|
| AF-A0A2W1KFH3-F1-model_v4 | Uncharacterized protein | 0.9358 | 1 | 66 |
GO:0016020
|
| AF-A0A7U6QKB8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9316 | 8 | 66 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar