F395798

General Info

Members Datasets Scaffolds Average Seq Length
301 205 300 74

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101589028|Ga0070664_1015890282
Length 90
Sequence MGSARTQHTDIRPGMDVLTLFGLFAVPAMLVFYMLEDRSPWFILAFASACALGSAYGFLQGAWPFGLVEAIWAGVAVPRWRAKIHGSPLT

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0.33
Rhizoplane 3.65
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10124742 3300003203 Bacteria 756
2 Ga0065165_1008563 3300005262 Bacteria 4757
3 Ga0065704_10209365 3300005289 Unclassified 1114
4 Ga0065707_10090534 3300005295 Bacteria 4122
5 Ga0070658_10049522 3300005327 Bacteria 3403
6 Ga0070658_10349364 3300005327 Bacteria 1266
7 Ga0070670_100000426 3300005331 Bacteria 34748
8 Ga0070670_100523699 3300005331 Bacteria 1056
9 Ga0070666_10177074 3300005335 Bacteria 1495
10 Ga0070680_100135444 3300005336 Bacteria 2063
11 Ga0070682_100755103 3300005337 Bacteria 786
12 Ga0070682_100885292 3300005337 Bacteria 732
13 Ga0070660_100161740 3300005339 Bacteria 1804
14 Ga0070660_100283835 3300005339 Bacteria 1355
15 Ga0070691_10292864 3300005341 Bacteria 887
16 Ga0070668_100000042 3300005347 Bacteria 78694
17 Ga0070669_100023764 3300005353 Bacteria 4392
18 Ga0070669_100669486 3300005353 Bacteria 874
19 Ga0070659_100014194 3300005366 Bacteria 5948
20 Ga0070659_100495672 3300005366 Bacteria 1041
21 Ga0070667_100000168 3300005367 Bacteria 81935
22 Ga0070714_100185155 3300005435 Bacteria 1897
23 Ga0070714_101716030 3300005435 Unclassified 613
24 Ga0070710_10282059 3300005437 Bacteria 1078
25 Ga0070711_100297732 3300005439 Bacteria 1282
26 Ga0070708_100664279 3300005445 Unclassified 982
27 Ga0070663_100508844 3300005455 Bacteria 1001
28 Ga0070678_100164112 3300005456 Bacteria 1803
29 Ga0070678_101262003 3300005456 Bacteria 687
30 Ga0070678_101594394 3300005456 Unclassified 613
31 Ga0070681_11013249 3300005458 Bacteria 750
32 Ga0070706_100498442 3300005467 Bacteria 1133
33 Ga0070698_100329570 3300005471 Bacteria 1458
34 Ga0070699_100003297 3300005518 Bacteria 14269
35 Ga0070679_100055817 3300005530 Bacteria 3934
36 Ga0070679_100221669 3300005530 Bacteria 1852
37 Ga0070684_100784508 3300005535 Bacteria 890
38 Ga0070697_100006576 3300005536 Bacteria 9008
39 Ga0068853_100223909 3300005539 Bacteria 1719
40 Ga0068853_100357949 3300005539 Bacteria 1359
41 Ga0070672_100670356 3300005543 Bacteria 907
42 Ga0070695_100466275 3300005545 Bacteria 971
43 Ga0070696_101740425 3300005546 Unclassified 538
44 Ga0070693_100107414 3300005547 Bacteria 1711
45 Ga0070693_100206306 3300005547 Bacteria 1280
46 Ga0070665_100002287 3300005548 Bacteria 21311
47 Ga0070665_100084240 3300005548 Bacteria 3184
48 Ga0068855_100380722 3300005563 Bacteria 1549
49 Ga0068855_100701351 3300005563 Bacteria 1083
50 Ga0068855_101100849 3300005563 Unclassified 830
51 Ga0068855_102363416 3300005563 Bacteria 531
52 Ga0070664_101589028 3300005564 Unclassified 619
53 Ga0070664_102279807 3300005564 Bacteria 514
54 Ga0068857_100048940 3300005577 Plasmid 3750
55 Ga0068857_100200663 3300005577 Bacteria 1818
56 Ga0068857_100852842 3300005577 Bacteria 872
57 Ga0068856_100046498 3300005614 Bacteria 4275
58 Ga0068856_100048356 3300005614 Bacteria 4191
59 Ga0068856_101599789 3300005614 Unclassified 665
60 Ga0070702_100196611 3300005615 Bacteria 1331
61 Ga0068852_100869034 3300005616 Bacteria 918
62 Ga0068852_101734735 3300005616 Bacteria 647
63 Ga0068859_100019113 3300005617 Bacteria 6881
64 Ga0068864_100000135 3300005618 Bacteria 71759
65 Ga0068870_10724183 3300005840 Bacteria 688
66 Ga0068870_11212797 3300005840 Bacteria 547
67 Ga0068863_100012986 3300005841 Bacteria 8032
68 Ga0068858_100019958 3300005842 Bacteria 6267
69 Ga0068858_100379538 3300005842 Bacteria 1356
70 Ga0068860_100000133 3300005843 Bacteria 120382
71 Ga0068860_100174410 3300005843 Bacteria 2078
72 Ga0068862_100009611 3300005844 Bacteria 7992
73 Ga0068862_100207601 3300005844 Bacteria 1769
74 Ga0068862_101149447 3300005844 Bacteria 773
75 Ga0081455_10018684 3300005937 Bacteria 6584
76 Ga0081455_10071469 3300005937 Bacteria 2877
77 Ga0081539_10006163 3300005985 Bacteria 11667
78 Ga0070717_11544143 3300006028 Bacteria 602
79 Ga0070716_100109451 3300006173 Bacteria 1709
80 Ga0070716_100991686 3300006173 Bacteria 664
81 Ga0070712_100374844 3300006175 Bacteria 1170
82 Ga0070712_100912342 3300006175 Unclassified 758
83 Ga0097621_100225459 3300006237 Bacteria 1634
84 Ga0097621_101651857 3300006237 Bacteria 610
85 Ga0068871_100095783 3300006358 Bacteria 2479
86 Ga0068871_100161856 3300006358 Bacteria 1915
87 Ga0075433_11083508 3300006852 Unclassified 697
88 Ga0075434_101376434 3300006871 Unclassified 716
89 Ga0075434_101398337 3300006871 Unclassified 710
90 Ga0075436_100676401 3300006914 Bacteria 764
91 Ga0097620_100019113 3300006931 Bacteria 6881
92 Ga0075435_101412145 3300007076 Unclassified 610
93 Ga0099795_10049687 3300007788 Bacteria 1523
94 Ga0099795_10454782 3300007788 Bacteria 590
95 Ga0105240_10050323 3300009093 Bacteria 5254
96 Ga0105240_10267976 3300009093 Bacteria 1968
97 Ga0105240_10708482 3300009093 Unclassified 1098
98 Ga0105240_11161801 3300009093 Bacteria 819
99 Ga0114129_12650591 3300009147 Unclassified 598
100 Ga0105243_10068691 3300009148 Bacteria 2856
101 Ga0105243_10308771 3300009148 Bacteria 1436
102 Ga0105243_10429809 3300009148 Bacteria 1234
103 Ga0105241_10028379 3300009174 Bacteria 4170
104 Ga0105241_10619439 3300009174 Bacteria 980
105 Ga0105241_11261835 3300009174 Unclassified 702
106 Ga0105248_10969235 3300009177 Bacteria 960
107 Ga0105237_10215289 3300009545 Bacteria 1921
108 Ga0105237_11472698 3300009545 Bacteria 687
109 Ga0105237_12783063 3300009545 Unclassified 500
110 Ga0105238_10127261 3300009551 Bacteria 2526
111 Ga0105238_10199147 3300009551 Bacteria 1978
112 Ga0105238_11065625 3300009551 Bacteria 830
113 Ga0105249_10299299 3300009553 Bacteria 1613
114 Ga0105249_11269907 3300009553 Bacteria 808
115 Ga0105249_11551312 3300009553 Bacteria 735
116 Ga0099796_10006618 3300010159 Bacteria 2980
117 Ga0099796_10012636 3300010159 Bacteria 2390
118 Ga0099796_10013881 3300010159 Bacteria 2312
119 Ga0105239_10960656 3300010375 Bacteria 982
120 Ga0105239_11344343 3300010375 Bacteria 824
121 Ga0105246_10028393 3300011119 Bacteria 3675
122 Ga0157370_10009664 3300013104 Bacteria 10257
123 Ga0157370_10062055 3300013104 Bacteria 3545
124 Ga0157370_10115312 3300013104 Bacteria 2509
125 Ga0157369_10021390 3300013105 Bacteria 7236
126 Ga0157369_10056090 3300013105 Bacteria 4251
127 Ga0157369_10085824 3300013105 Bacteria 3363
128 Ga0157369_10103001 3300013105 Bacteria 3040
129 Ga0157378_10059417 3300013297 Bacteria 3411
130 Ga0157378_10633510 3300013297 Unclassified 1083
131 Ga0157378_11175581 3300013297 Unclassified 806
132 Ga0163162_10012712 3300013306 Bacteria 8220
133 Ga0163162_11907059 3300013306 Bacteria 680
134 Ga0163163_10933081 3300014325 Bacteria 931
135 Ga0157380_10297650 3300014326 Bacteria 1484
136 Ga0157380_11693872 3300014326 Bacteria 690
137 Ga0157376_10062314 3300014969 Bacteria 3138
138 Ga0206356_10530246 3300020070 Bacteria 920
139 Ga0206353_11500474 3300020082 Bacteria 784
140 Ga0213872_10000896 3300021361 Bacteria 21421
141 Ga0213872_10003497 3300021361 Bacteria 8695
142 Ga0213872_10148641 3300021361 Bacteria 1024
143 Ga0213872_10173882 3300021361 Bacteria 932
144 Ga0213872_10219929 3300021361 Bacteria 808
145 Ga0213876_10018490 3300021384 Bacteria 3680
146 Ga0207710_10185149 3300025900 Bacteria 1023
147 Ga0207685_10176011 3300025905 Bacteria 988
148 Ga0207654_10106052 3300025911 Bacteria 1739
149 Ga0207654_10691965 3300025911 Bacteria 732
150 Ga0207707_10873601 3300025912 Bacteria 745
151 Ga0207695_10026212 3300025913 Bacteria 6507
152 Ga0207695_10077803 3300025913 Bacteria 3368
153 Ga0207693_10406532 3300025915 Bacteria 1064
154 Ga0207693_11331274 3300025915 Bacteria 536
155 Ga0207663_10621625 3300025916 Bacteria 850
156 Ga0207660_10870609 3300025917 Bacteria 735
157 Ga0207657_10245408 3300025919 Bacteria 1429
158 Ga0207652_10171886 3300025921 Bacteria 1945
159 Ga0207652_10464511 3300025921 Bacteria 1140
160 Ga0207681_10278451 3300025923 Bacteria 1316
161 Ga0207694_10512930 3300025924 Bacteria 1004
162 Ga0207694_10593431 3300025924 Bacteria 931
163 Ga0207650_10000016 3300025925 Bacteria 361958
164 Ga0207664_10922556 3300025929 Bacteria 784
165 Ga0207664_11136909 3300025929 Bacteria 697
166 Ga0207690_10082801 3300025932 Bacteria 2245
167 Ga0207686_10159582 3300025934 Bacteria 1579
168 Ga0207670_10117311 3300025936 Bacteria 1929
169 Ga0207661_10566699 3300025944 Bacteria 1041
170 Ga0207679_11687757 3300025945 Bacteria 580
171 Ga0207667_10625205 3300025949 Bacteria 1084
172 Ga0207667_12084201 3300025949 Bacteria 526
173 Ga0207712_10000767 3300025961 Bacteria 24118
174 Ga0207668_10000401 3300025972 Bacteria 27305
175 Ga0207658_10000399 3300025986 Bacteria 41904
176 Ga0207677_11870782 3300026023 Unclassified 557
177 Ga0207703_10005619 3300026035 Bacteria 10066
178 Ga0207703_11682210 3300026035 Unclassified 610
179 Ga0207639_10209010 3300026041 Bacteria 1679
180 Ga0207702_10032449 3300026078 Bacteria 4358
181 Ga0207641_11111760 3300026088 Archaea 789
182 Ga0207641_11666963 3300026088 Bacteria 639
183 Ga0207676_10000618 3300026095 Bacteria 29046
184 Ga0207676_12252137 3300026095 Unclassified 543
185 Ga0207674_10400247 3300026116 Bacteria 1327
186 Ga0207674_10729545 3300026116 Bacteria 956
187 Ga0207674_10793209 3300026116 Bacteria 914
188 Ga0207698_10787071 3300026142 Bacteria 952
189 Ga0268266_10880925 3300028379 Bacteria 865
190 Ga0268265_10000836 3300028380 Bacteria 28993
191 Ga0268264_10000207 3300028381 Bacteria 120086
192 Ga0268264_10050941 3300028381 Bacteria 3449
193 Ga0265337_1141754 3300028556 Bacteria 651
194 Ga0265319_1004585 3300028563 Bacteria 6802
195 Ga0265318_10017649 3300028577 Bacteria 2926
196 Ga0265338_10147470 3300028800 Bacteria 1833
197 Ga0265338_10270943 3300028800 Bacteria 1244
198 Ga0265765_1043670 3300030879 Bacteria 600
199 Ga0265760_10003264 3300031090 Bacteria 4752
200 Ga0265320_10005624 3300031240 Bacteria 8008
201 Ga0265327_10011516 3300031251 Bacteria 6077
202 Ga0265314_10073415 3300031711 Bacteria 2281
203 Ga0373936_0281785 3300035113 Bacteria 747
204 Ga0373953_0518716 3300035117 Unclassified 529
205 Ga0373956_0023664 3300035119 Bacteria 2638
206 Ga0373942_0120759 3300035207 Bacteria 819
207 Ga0373961_0450267 3300035241 Bacteria 502
208 Ga0373935_0326197 3300035692 Bacteria 1090
209 Ga0373927_0071944 3300035695 Bacteria 2238
210 Ga0373927_0237596 3300035695 Bacteria 1197
211 Ga0373925_0281325 3300037068 Bacteria 1340
212 Ga0373925_0820712 3300037068 Unclassified 767
213 Ga0395899_0191529 3300037312 Bacteria 1431
214 Ga0395900_0014536 3300037418 Bacteria 8033
215 Ga0395900_0367885 3300037418 Bacteria 1408
216 Ga0395898_0042297 3300037466 Bacteria 4497
217 Ga0395905_0571621 3300037471 Bacteria 1032
218 Ga0436364_1435110 3300037853 Bacteria 7795
219 Ga0395901_0029822 3300038443 Bacteria 5619
220 Ga0436365_0147566 3300039437 Bacteria 24744
221 Ga0436360_0261003 3300039438 Unclassified 682
222 Ga0436360_0615061 3300039438 Bacteria 731
223 Ga0436360_0626674 3300039438 Bacteria 648
224 Ga0436361_0031240 3300039447 Bacteria 6783
225 Ga0436361_0068243 3300039447 Bacteria 13025
226 Ga0436361_0188685 3300039447 Bacteria 701
227 Ga0436361_0345421 3300039447 Bacteria 1168
228 Ga0436361_0405347 3300039447 Bacteria 10228
229 Ga0436361_0572948 3300039447 Bacteria 937
230 Ga0436361_0650245 3300039447 Bacteria 549
231 Ga0436361_0822453 3300039447 Bacteria 5991
232 Ga0436363_0840603 3300039450 Bacteria 3267
233 Ga0436363_0890242 3300039450 Unclassified 908
234 Ga0436362_0002917 3300039453 Bacteria 3687
235 Ga0466959_0292719 3300045049 Bacteria 1116
236 Ga0451576_1174075 3300045051 Bacteria 802
237 Ga0466967_0047972 3300045976 Bacteria 3727
238 Ga0495651_0593765 3300046462 Bacteria 699
239 Ga0495580_0001544 3300046472 Bacteria 20251
240 Ga0495594_0058971 3300046499 Unclassified 2122
241 Ga0495628_0502814 3300046516 Bacteria 875
242 Ga0495630_0613464 3300046517 Bacteria 834
243 Ga0495666_0159425 3300046526 Unclassified 1047
244 Ga0495652_0834203 3300046529 Bacteria 612
245 Ga0495599_0037393 3300046678 Bacteria 3049
246 Ga0495646_0363709 3300046680 Unclassified 756
247 Ga0495669_0055555 3300046684 Bacteria 1783
248 Ga0495624_0054071 3300046690 Unclassified 2533
249 Ga0495670_0379351 3300046691 Bacteria 763
250 Ga0495674_0013600 3300047319 Bacteria 7645
251 Ga0495686_0064366 3300047472 Bacteria 2270
252 Ga0495602_0004862 3300048088 Bacteria 14069
253 Ga0496100_0606799 3300048903 Bacteria 850
254 Ga0496103_0434630 3300048906 Bacteria 842
255 Ga0496104_1083759 3300048907 Bacteria 705
256 Ga0496107_0390647 3300048910 Bacteria 1035
257 Ga0496108_1008332 3300048911 Unclassified 711
258 Ga0496111_0408465 3300048914 Bacteria 1003
259 Ga0496112_0273270 3300048915 Bacteria 1638
260 Ga0496113_0852647 3300048916 Unclassified 722
261 Ga0496113_0907277 3300048916 Bacteria 697
262 Ga0496114_0426042 3300048917 Bacteria 1175
263 Ga0496115_0299838 3300048918 Unclassified 1317
264 Ga0496119_0451689 3300048922 Unclassified 605
265 Ga0496120_0076785 3300048923 Bacteria 1819
266 Ga0496124_0000204 3300048927 Bacteria 116976
267 Ga0496126_0298441 3300048929 Bacteria 1330
268 Ga0496126_0878384 3300048929 Bacteria 682
269 Ga0501036_0225512 3300049572 Unclassified 1573
270 Ga0501039_0095101 3300049575 Unclassified 2323
271 Ga0501040_0029214 3300049576 Unclassified 3721
272 Ga0501041_0065912 3300049577 Bacteria 2219
273 Ga0501042_0941323 3300049578 Unclassified 629
274 Ga0501068_0612322 3300049584 Unclassified 710
275 Ga0501068_0860319 3300049584 Bacteria 596
276 Ga0501068_1132833 3300049584 Unclassified 518
277 Ga0501069_0644567 3300049585 Bacteria 637
278 Ga0501071_0054711 3300049587 Bacteria 2880
279 Ga0501072_1212746 3300049588 Unclassified 586
280 Ga0501075_0020403 3300049591 Bacteria 4821
281 Ga0501075_0238563 3300049591 Bacteria 1386
282 Ga0501076_0021704 3300049592 Bacteria 4929
283 Ga0501076_1032485 3300049592 Unclassified 677
284 Ga0501079_1009879 3300049741 Unclassified 655
285 Ga0501080_0396607 3300049742 Bacteria 1242
286 Ga0501081_0014992 3300049743 Bacteria 5115
287 Ga0501035_1173809 3300049822 Unclassified 597
288 nmdc:mga08y16_1230446_c1 3300050511 Bacteria 718
289 nmdc:mga0n895_1227154_c1 3300050512 Unclassified 723
290 nmdc:mga08x19_100890_c1 3300050514 Unclassified 1915
291 nmdc:mga0a205_861015_c1 3300050515 Unclassified 753
292 Ga0500641_0036101 3300053096 Bacteria 1976
293 Ga0500556_0068125 3300053104 Bacteria 1325
294 Ga0500595_001391 3300053119 Bacteria 12967
295 Ga0500577_0000243 3300053142 Bacteria 14211
296 Ga0500616_0089029 3300053153 Bacteria 1533
297 Ga0500639_339300 3300053163 Bacteria 539
298 Ga0501084_0144271 3300054114 Bacteria 2005
299 Ga0501082_0076465 3300060353 Unclassified 2886
300 Ga0530510_0173701 3300061734 Unclassified 1596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100523699 Ga0070670_1005236992 69
2 3300005341 Ga0070691_10292864 Ga0070691_102928641 69
3 3300005456 Ga0070678_101262003 Ga0070678_1012620031 69
4 3300005547 Ga0070693_100206306 Ga0070693_1002063062 69
5 3300005548 Ga0070665_100084240 Ga0070665_1000842404 69
6 3300005564 Ga0070664_102279807 Ga0070664_1022798071 69
7 3300005615 Ga0070702_100196611 Ga0070702_1001966112 69
8 3300005840 Ga0068870_10724183 Ga0068870_107241832 69
9 3300005840 Ga0068870_11212797 Ga0068870_112127972 69
10 3300005844 Ga0068862_100207601 Ga0068862_1002076011 69
11 3300009148 Ga0105243_10429809 Ga0105243_104298092 69
12 3300009553 Ga0105249_11551312 Ga0105249_115513121 69
13 3300010375 Ga0105239_10960656 Ga0105239_109606562 69
14 3300010375 Ga0105239_11344343 Ga0105239_113443432 69
15 3300011119 Ga0105246_10028393 Ga0105246_100283934 69
16 3300014326 Ga0157380_11693872 Ga0157380_116938722 69
17 3300025936 Ga0207670_10117311 Ga0207670_101173113 69
18 3300026095 Ga0207676_12252137 Ga0207676_122521372 69
19 3300028800 Ga0265338_10270943 Ga0265338_102709432 69
20 3300035241 Ga0373961_0450267 Ga0373961_0450267_241_462 69
21 3300048903 Ga0496100_0606799 Ga0496100_0606799_559_780 69
22 3300048906 Ga0496103_0434630 Ga0496103_0434630_438_659 69
23 3300048910 Ga0496107_0390647 Ga0496107_0390647_437_658 69
24 3300048917 Ga0496114_0426042 Ga0496114_0426042_711_932 69
25 3300053096 Ga0500641_0036101 Ga0500641_0036101_269_490 69
26 3300005289 Ga0065704_10209365 Ga0065704_102093652 70
27 3300005295 Ga0065707_10090534 Ga0065707_100905342 70
28 3300005353 Ga0070669_100023764 Ga0070669_1000237642 70
29 3300005439 Ga0070711_100297732 Ga0070711_1002977323 70
30 3300005456 Ga0070678_101594394 Ga0070678_1015943942 70
31 3300005543 Ga0070672_100670356 Ga0070672_1006703562 70
32 3300005546 Ga0070696_101740425 Ga0070696_1017404252 70
33 3300005843 Ga0068860_100174410 Ga0068860_1001744103 70
34 3300006237 Ga0097621_101651857 Ga0097621_1016518572 70
35 3300006358 Ga0068871_100095783 Ga0068871_1000957831 70
36 3300006871 Ga0075434_101376434 Ga0075434_1013764342 70
37 3300009147 Ga0114129_12650591 Ga0114129_126505912 70
38 3300009148 Ga0105243_10068691 Ga0105243_100686914 70
39 3300009148 Ga0105243_10308771 Ga0105243_103087712 70
40 3300009174 Ga0105241_10028379 Ga0105241_100283796 70
41 3300009174 Ga0105241_10619439 Ga0105241_106194392 70
42 3300009174 Ga0105241_11261835 Ga0105241_112618352 70
43 3300009177 Ga0105248_10969235 Ga0105248_109692352 70
44 3300009545 Ga0105237_12783063 Ga0105237_127830632 70
45 3300009553 Ga0105249_10299299 Ga0105249_102992992 70
46 3300013297 Ga0157378_10633510 Ga0157378_106335102 70
47 3300013297 Ga0157378_11175581 Ga0157378_111755813 70
48 3300013306 Ga0163162_10012712 Ga0163162_100127121 70
49 3300014326 Ga0157380_10297650 Ga0157380_102976503 70
50 3300025911 Ga0207654_10106052 Ga0207654_101060522 70
51 3300025934 Ga0207686_10159582 Ga0207686_101595823 70
52 3300026088 Ga0207641_11111760 Ga0207641_111117601 70
53 3300028381 Ga0268264_10050941 Ga0268264_100509412 70
54 3300046684 Ga0495669_0055555 Ga0495669_0055555_76_297 70
55 3300046691 Ga0495670_0379351 Ga0495670_0379351_160_381 70
56 3300049572 Ga0501036_0225512 Ga0501036_0225512_1062_1289 70
57 3300049575 Ga0501039_0095101 Ga0501039_0095101_613_840 70
58 3300049576 Ga0501040_0029214 Ga0501040_0029214_1431_1658 70
59 3300049577 Ga0501041_0065912 Ga0501041_0065912_1026_1253 70
60 3300049578 Ga0501042_0941323 Ga0501042_0941323_281_508 70
61 3300049584 Ga0501068_1132833 Ga0501068_1132833_238_465 70
62 3300049587 Ga0501071_0054711 Ga0501071_0054711_546_773 70
63 3300049588 Ga0501072_1212746 Ga0501072_1212746_271_498 70
64 3300049591 Ga0501075_0020403 Ga0501075_0020403_600_827 70
65 3300049592 Ga0501076_0021704 Ga0501076_0021704_3415_3642 70
66 3300049741 Ga0501079_1009879 Ga0501079_1009879_231_458 70
67 3300049742 Ga0501080_0396607 Ga0501080_0396607_171_398 70
68 3300049743 Ga0501081_0014992 Ga0501081_0014992_3702_3929 70
69 3300049822 Ga0501035_1173809 Ga0501035_1173809_80_307 70
70 3300054114 Ga0501084_0144271 Ga0501084_0144271_235_462 70
71 3300060353 Ga0501082_0076465 Ga0501082_0076465_1193_1420 70
72 3300061734 Ga0530510_0173701 Ga0530510_0173701_164_391 70
73 iso_pu_bacteria 8056689827 8056694290 70
74 3300005262 Ga0065165_1008563 Ga0065165_10085631 71
75 3300005331 Ga0070670_100000426 Ga0070670_10000042633 71
76 3300005335 Ga0070666_10177074 Ga0070666_101770742 71
77 3300005336 Ga0070680_100135444 Ga0070680_1001354442 71
78 3300005337 Ga0070682_100755103 Ga0070682_1007551032 71
79 3300005337 Ga0070682_100885292 Ga0070682_1008852921 71
80 3300005339 Ga0070660_100283835 Ga0070660_1002838352 71
81 3300005347 Ga0070668_100000042 Ga0070668_10000004249 71
82 3300005353 Ga0070669_100669486 Ga0070669_1006694862 71
83 3300005366 Ga0070659_100014194 Ga0070659_1000141947 71
84 3300005367 Ga0070667_100000168 Ga0070667_1000001687 71
85 3300005445 Ga0070708_100664279 Ga0070708_1006642791 71
86 3300005456 Ga0070678_100164112 Ga0070678_1001641121 71
87 3300005530 Ga0070679_100055817 Ga0070679_1000558175 71
88 3300005548 Ga0070665_100002287 Ga0070665_10000228725 71
89 3300005563 Ga0068855_102363416 Ga0068855_1023634161 71
90 3300005577 Ga0068857_100048940 Ga0068857_1000489402 71
91 3300005577 Ga0068857_100852842 Ga0068857_1008528421 71
92 3300005617 Ga0068859_100019113 Ga0068859_1000191134 71
93 3300005618 Ga0068864_100000135 Ga0068864_10000013523 71
94 3300005841 Ga0068863_100012986 Ga0068863_1000129863 71
95 3300005842 Ga0068858_100019958 Ga0068858_1000199589 71
96 3300005842 Ga0068858_100379538 Ga0068858_1003795382 71
97 3300005843 Ga0068860_100000133 Ga0068860_10000013370 71
98 3300005844 Ga0068862_100009611 Ga0068862_1000096111 71
99 3300005844 Ga0068862_101149447 Ga0068862_1011494471 71
100 3300006931 Ga0097620_100019113 Ga0097620_1000191138 71
101 3300007076 Ga0075435_101412145 Ga0075435_1014121451 71
102 3300013104 Ga0157370_10009664 Ga0157370_1000966415 71
103 3300013105 Ga0157369_10085824 Ga0157369_100858245 71
104 3300014969 Ga0157376_10062314 Ga0157376_100623144 71
105 3300021361 Ga0213872_10000896 Ga0213872_100008962 71
106 3300021361 Ga0213872_10003497 Ga0213872_100034972 71
107 3300021361 Ga0213872_10148641 Ga0213872_101486412 71
108 3300021361 Ga0213872_10173882 Ga0213872_101738822 71
109 3300021361 Ga0213872_10219929 Ga0213872_102199292 71
110 3300025900 Ga0207710_10185149 Ga0207710_101851492 71
111 3300025912 Ga0207707_10873601 Ga0207707_108736012 71
112 3300025915 Ga0207693_11331274 Ga0207693_113312741 71
113 3300025917 Ga0207660_10870609 Ga0207660_108706092 71
114 3300025919 Ga0207657_10245408 Ga0207657_102454083 71
115 3300025921 Ga0207652_10464511 Ga0207652_104645113 71
116 3300025923 Ga0207681_10278451 Ga0207681_102784512 71
117 3300025925 Ga0207650_10000016 Ga0207650_10000016181 71
118 3300025929 Ga0207664_10922556 Ga0207664_109225562 71
119 3300025929 Ga0207664_11136909 Ga0207664_111369092 71
120 3300025932 Ga0207690_10082801 Ga0207690_100828012 71
121 3300025949 Ga0207667_12084201 Ga0207667_120842011 71
122 3300025961 Ga0207712_10000767 Ga0207712_100007673 71
123 3300025972 Ga0207668_10000401 Ga0207668_1000040131 71
124 3300025986 Ga0207658_10000399 Ga0207658_100003991 71
125 3300026035 Ga0207703_10005619 Ga0207703_100056195 71
126 3300026035 Ga0207703_11682210 Ga0207703_116822101 71
127 3300026088 Ga0207641_11666963 Ga0207641_116669631 71
128 3300026095 Ga0207676_10000618 Ga0207676_1000061828 71
129 3300026116 Ga0207674_10400247 Ga0207674_104002472 71
130 3300026116 Ga0207674_10729545 Ga0207674_107295452 71
131 3300026116 Ga0207674_10793209 Ga0207674_107932092 71
132 3300028379 Ga0268266_10880925 Ga0268266_108809252 71
133 3300028380 Ga0268265_10000836 Ga0268265_100008366 71
134 3300028381 Ga0268264_10000207 Ga0268264_10000207101 71
135 3300028556 Ga0265337_1141754 Ga0265337_11417542 71
136 3300028800 Ga0265338_10147470 Ga0265338_101474702 71
137 3300030879 Ga0265765_1043670 Ga0265765_10436702 71
138 3300031090 Ga0265760_10003264 Ga0265760_100032644 71
139 3300035117 Ga0373953_0518716 Ga0373953_0518716_38_259 71
140 3300035207 Ga0373942_0120759 Ga0373942_0120759_285_506 71
141 3300039438 Ga0436360_0261003 Ga0436360_0261003_305_526 71
142 3300039447 Ga0436361_0031240 Ga0436361_0031240_5209_5430 71
143 3300039447 Ga0436361_0068243 Ga0436361_0068243_9814_10035 71
144 3300039447 Ga0436361_0188685 Ga0436361_0188685_43_264 71
145 3300039447 Ga0436361_0345421 Ga0436361_0345421_222_443 71
146 3300039447 Ga0436361_0405347 Ga0436361_0405347_2281_2502 71
147 3300039447 Ga0436361_0572948 Ga0436361_0572948_220_441 71
148 3300039447 Ga0436361_0822453 Ga0436361_0822453_1800_2021 71
149 3300039450 Ga0436363_0890242 Ga0436363_0890242_159_380 71
150 3300046462 Ga0495651_0593765 Ga0495651_0593765_290_511 71
151 3300046516 Ga0495628_0502814 Ga0495628_0502814_423_644 71
152 3300046529 Ga0495652_0834203 Ga0495652_0834203_169_390 71
153 3300048918 Ga0496115_0299838 Ga0496115_0299838_779_1000 71
154 3300005327 Ga0070658_10349364 Ga0070658_103493642 72
155 3300005435 Ga0070714_101716030 Ga0070714_1017160301 72
156 3300005437 Ga0070710_10282059 Ga0070710_102820592 72
157 3300005471 Ga0070698_100329570 Ga0070698_1003295703 72
158 3300005563 Ga0068855_101100849 Ga0068855_1011008492 72
159 3300005614 Ga0068856_101599789 Ga0068856_1015997892 72
160 3300005937 Ga0081455_10018684 Ga0081455_100186841 72
161 3300005937 Ga0081455_10071469 Ga0081455_100714692 72
162 3300006173 Ga0070716_100109451 Ga0070716_1001094512 72
163 3300006175 Ga0070712_100374844 Ga0070712_1003748442 72
164 3300006175 Ga0070712_100912342 Ga0070712_1009123421 72
165 3300006237 Ga0097621_100225459 Ga0097621_1002254595 72
166 3300006358 Ga0068871_100161856 Ga0068871_1001618562 72
167 3300007788 Ga0099795_10049687 Ga0099795_100496873 72
168 3300007788 Ga0099795_10454782 Ga0099795_104547822 72
169 3300009093 Ga0105240_10708482 Ga0105240_107084821 72
170 3300009551 Ga0105238_11065625 Ga0105238_110656252 72
171 3300010159 Ga0099796_10012636 Ga0099796_100126362 72
172 3300010159 Ga0099796_10013881 Ga0099796_100138811 72
173 3300013297 Ga0157378_10059417 Ga0157378_100594174 72
174 3300021384 Ga0213876_10018490 Ga0213876_100184904 72
175 3300025911 Ga0207654_10691965 Ga0207654_106919652 72
176 3300025913 Ga0207695_10026212 Ga0207695_100262128 72
177 3300025915 Ga0207693_10406532 Ga0207693_104065322 72
178 3300025916 Ga0207663_10621625 Ga0207663_106216251 72
179 3300037418 Ga0395900_0367885 Ga0395900_0367885_560_784 72
180 3300037471 Ga0395905_0571621 Ga0395905_0571621_551_775 72
181 3300039437 Ga0436365_0147566 Ga0436365_0147566_23484_23708 72
182 3300039438 Ga0436360_0626674 Ga0436360_0626674_82_306 72
183 3300039450 Ga0436363_0840603 Ga0436363_0840603_35_259 72
184 3300039453 Ga0436362_0002917 Ga0436362_0002917_1601_1825 72
185 3300046680 Ga0495646_0363709 Ga0495646_0363709_428_652 72
186 3300046690 Ga0495624_0054071 Ga0495624_0054071_1865_2089 72
187 3300047319 Ga0495674_0013600 Ga0495674_0013600_4358_4582 72
188 3300047472 Ga0495686_0064366 Ga0495686_0064366_906_1130 72
189 3300048088 Ga0495602_0004862 Ga0495602_0004862_8458_8682 72
190 3300049584 Ga0501068_0860319 Ga0501068_0860319_251_475 72
191 3300053104 Ga0500556_0068125 Ga0500556_0068125_816_1040 72
192 3300053119 Ga0500595_001391 Ga0500595_001391_12242_12466 72
193 3300053142 Ga0500577_0000243 Ga0500577_0000243_12819_13043 72
194 3300053153 Ga0500616_0089029 Ga0500616_0089029_577_801 72
195 3300005366 Ga0070659_100495672 Ga0070659_1004956721 73
196 3300005435 Ga0070714_100185155 Ga0070714_1001851552 73
197 3300005455 Ga0070663_100508844 Ga0070663_1005088442 73
198 3300005458 Ga0070681_11013249 Ga0070681_110132492 73
199 3300005467 Ga0070706_100498442 Ga0070706_1004984422 73
200 3300005518 Ga0070699_100003297 Ga0070699_1000032979 73
201 3300005530 Ga0070679_100221669 Ga0070679_1002216692 73
202 3300005535 Ga0070684_100784508 Ga0070684_1007845081 73
203 3300005536 Ga0070697_100006576 Ga0070697_1000065762 73
204 3300005539 Ga0068853_100357949 Ga0068853_1003579492 73
205 3300005545 Ga0070695_100466275 Ga0070695_1004662751 73
206 3300005547 Ga0070693_100107414 Ga0070693_1001074142 73
207 3300005563 Ga0068855_100701351 Ga0068855_1007013512 73
208 3300005577 Ga0068857_100200663 Ga0068857_1002006633 73
209 3300005614 Ga0068856_100048356 Ga0068856_1000483562 73
210 3300005616 Ga0068852_101734735 Ga0068852_1017347352 73
211 3300006028 Ga0070717_11544143 Ga0070717_115441432 73
212 3300006173 Ga0070716_100991686 Ga0070716_1009916861 73
213 3300006852 Ga0075433_11083508 Ga0075433_110835083 73
214 3300006871 Ga0075434_101398337 Ga0075434_1013983371 73
215 3300006914 Ga0075436_100676401 Ga0075436_1006764012 73
216 3300009093 Ga0105240_10267976 Ga0105240_102679764 73
217 3300009545 Ga0105237_10215289 Ga0105237_102152894 73
218 3300013104 Ga0157370_10062055 Ga0157370_100620554 73
219 3300013105 Ga0157369_10021390 Ga0157369_100213904 73
220 3300013306 Ga0163162_11907059 Ga0163162_119070592 73
221 3300020070 Ga0206356_10530246 Ga0206356_105302462 73
222 3300020082 Ga0206353_11500474 Ga0206353_115004742 73
223 3300025905 Ga0207685_10176011 Ga0207685_101760112 73
224 3300025913 Ga0207695_10077803 Ga0207695_100778032 73
225 3300025921 Ga0207652_10171886 Ga0207652_101718863 73
226 3300025924 Ga0207694_10512930 Ga0207694_105129302 73
227 3300025944 Ga0207661_10566699 Ga0207661_105666992 73
228 3300025949 Ga0207667_10625205 Ga0207667_106252052 73
229 3300026023 Ga0207677_11870782 Ga0207677_118707822 73
230 3300026041 Ga0207639_10209010 Ga0207639_102090102 73
231 3300026078 Ga0207702_10032449 Ga0207702_100324495 73
232 3300026142 Ga0207698_10787071 Ga0207698_107870712 73
233 3300031251 Ga0265327_10011516 Ga0265327_100115161 73
234 3300035119 Ga0373956_0023664 Ga0373956_0023664_139_360 73
235 3300035692 Ga0373935_0326197 Ga0373935_0326197_838_1059 73
236 3300035695 Ga0373927_0071944 Ga0373927_0071944_774_1001 73
237 3300035695 Ga0373927_0237596 Ga0373927_0237596_640_867 73
238 3300037068 Ga0373925_0281325 Ga0373925_0281325_479_706 73
239 3300037068 Ga0373925_0820712 Ga0373925_0820712_113_340 73
240 3300037312 Ga0395899_0191529 Ga0395899_0191529_931_1155 73
241 3300037418 Ga0395900_0014536 Ga0395900_0014536_7333_7557 73
242 3300037466 Ga0395898_0042297 Ga0395898_0042297_2104_2328 73
243 3300038443 Ga0395901_0029822 Ga0395901_0029822_447_671 73
244 3300039438 Ga0436360_0615061 Ga0436360_0615061_95_319 73
245 3300039447 Ga0436361_0650245 Ga0436361_0650245_78_302 73
246 3300046472 Ga0495580_0001544 Ga0495580_0001544_18181_18408 73
247 3300046499 Ga0495594_0058971 Ga0495594_0058971_1470_1697 73
248 3300046517 Ga0495630_0613464 Ga0495630_0613464_428_655 73
249 3300046526 Ga0495666_0159425 Ga0495666_0159425_256_483 73
250 3300046678 Ga0495599_0037393 Ga0495599_0037393_207_428 73
251 3300048907 Ga0496104_1083759 Ga0496104_1083759_26_247 73
252 3300048911 Ga0496108_1008332 Ga0496108_1008332_476_697 73
253 3300048915 Ga0496112_0273270 Ga0496112_0273270_1014_1235 73
254 3300048916 Ga0496113_0852647 Ga0496113_0852647_46_267 73
255 3300048916 Ga0496113_0907277 Ga0496113_0907277_390_611 73
256 3300048922 Ga0496119_0451689 Ga0496119_0451689_201_422 73
257 3300048923 Ga0496120_0076785 Ga0496120_0076785_1413_1640 73
258 3300048927 Ga0496124_0000204 Ga0496124_0000204_9476_9703 73
259 3300048929 Ga0496126_0298441 Ga0496126_0298441_928_1155 73
260 3300048929 Ga0496126_0878384 Ga0496126_0878384_39_266 73
261 3300049585 Ga0501069_0644567 Ga0501069_0644567_116_337 73
262 3300050512 nmdc:mga0n895_1227154_c1 nmdc:mga0n895_1227154_c1_478_699 73
263 3300050514 nmdc:mga08x19_100890_c1 nmdc:mga08x19_100890_c1_1327_1548 73
264 3300050515 nmdc:mga0a205_861015_c1 nmdc:mga0a205_861015_c1_49_270 73
265 3300005327 Ga0070658_10049522 Ga0070658_100495222 74
266 3300005339 Ga0070660_100161740 Ga0070660_1001617402 74
267 3300005539 Ga0068853_100223909 Ga0068853_1002239093 74
268 3300005563 Ga0068855_100380722 Ga0068855_1003807222 74
269 3300005564 Ga0070664_101589028 Ga0070664_1015890282 74
270 3300005614 Ga0068856_100046498 Ga0068856_1000464987 74
271 3300005616 Ga0068852_100869034 Ga0068852_1008690342 74
272 3300009093 Ga0105240_10050323 Ga0105240_100503236 74
273 3300009093 Ga0105240_11161801 Ga0105240_111618012 74
274 3300009545 Ga0105237_11472698 Ga0105237_114726982 74
275 3300009551 Ga0105238_10127261 Ga0105238_101272615 74
276 3300009551 Ga0105238_10199147 Ga0105238_101991472 74
277 3300009553 Ga0105249_11269907 Ga0105249_112699071 74
278 3300010159 Ga0099796_10006618 Ga0099796_100066183 74
279 3300013104 Ga0157370_10115312 Ga0157370_101153122 74
280 3300013105 Ga0157369_10056090 Ga0157369_100560901 74
281 3300013105 Ga0157369_10103001 Ga0157369_101030014 74
282 3300025924 Ga0207694_10593431 Ga0207694_105934312 74
283 3300025945 Ga0207679_11687757 Ga0207679_116877572 74
284 3300028563 Ga0265319_1004585 Ga0265319_10045854 74
285 3300028577 Ga0265318_10017649 Ga0265318_100176494 74
286 3300031240 Ga0265320_10005624 Ga0265320_100056243 74
287 3300031711 Ga0265314_10073415 Ga0265314_100734152 74
288 3300035113 Ga0373936_0281785 Ga0373936_0281785_416_649 74
289 3300037853 Ga0436364_1435110 Ga0436364_1435110_6386_6622 74
290 3300045049 Ga0466959_0292719 Ga0466959_0292719_93_329 74
291 3300045051 Ga0451576_1174075 Ga0451576_1174075_222_452 74
292 3300048914 Ga0496111_0408465 Ga0496111_0408465_434_664 74
293 3300049584 Ga0501068_0612322 Ga0501068_0612322_42_284 74
294 3300049591 Ga0501075_0238563 Ga0501075_0238563_629_871 74
295 3300049592 Ga0501076_1032485 Ga0501076_1032485_388_630 74
296 3300050511 nmdc:mga08y16_1230446_c1 nmdc:mga08y16_1230446_c1_192_449 74
297 3300053163 Ga0500639_339300 Ga0500639_339300_262_495 74
298 3300014325 Ga0163163_10933081 Ga0163163_109330812 75
299 3300045976 Ga0466967_0047972 Ga0466967_0047972_1463_1696 75
300 3300003203 JGI25406J46586_10124742 JGI25406J46586_101247421 77
301 3300005985 Ga0081539_10006163 Ga0081539_100061639 77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wyn-assembly2.cif.gz_A structure of family 37 trehalase from escherichia coli in complex with a casuarine-6-o-a-d-glucoside analogue 0.9547 28 62
5z6h-assembly1.cif.gz_A structure of periplasmic trehalase from diamondback moth gut bacteria in the apo form 0.9255 28 62
1lf9-assembly2.cif.gz_B crystal structure of bacterial glucoamylase complexed with acarbose 0.9242 25 62
6pwi-assembly2.cif.gz_B structure of cpgh84d 0.9019 26 66
7eaw-assembly1.cif.gz_A trehalase of arabidopsis thaliana acid mutant -d380a trehalose complex 0.8896 28 64
ID Description Score Start End Superfamily
af_I1LYJ0_192_318_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9671 30 62 1.25.40.10
af_A0A1D8PQM5_331_505_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9546 33 65 1.25.40.10
af_A0A0R0HNZ6_194_319_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9411 30 64 1.25.40.10
af_A4IBU6_124_199_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9386 33 64 1.25.40.10
af_Q8TE82_738_940_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9311 8 65 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2H0DYU6-F1-model_v4 Uncharacterized protein 0.9532 1 66 GO:0016020
AF-A0A2H0BCD9-F1-model_v4 PPM-type phosphatase domain-containing protein 0.9421 2 65 GO:0016020
AF-A0A7S1Z1U5-F1-model_v4 Kinesin light chain 0.9382 8 70
AF-A0A2W1KFH3-F1-model_v4 Uncharacterized protein 0.9358 1 66 GO:0016020
AF-A0A7U6QKB8-F1-model_v4 Tetratricopeptide repeat protein 0.9316 8 66

Feature Viewer

pLDDT pTM Quality
75.91 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map