F395349

General Info

Members Datasets Scaffolds Average Seq Length
300 232 600 67

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10825833|Ga0105237_108258333
Length 78
Sequence MSARSLASETVMKIKIVVHEAEEGGFWAEVPAIPGCATQGDSMEELMQNLHEAIEGCLSIEVAPPEPGGTERMLELPA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
165 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
185 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
223 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
224 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
230 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
231 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.67
Nodule 0
Rhizoplane 1.33
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10825833 3300009545 Bacteria 934
2 JGI25406J46586_10000161 3300003203 Bacteria 29695
3 Ga0070658_10677142 3300005327 Bacteria 895
4 Ga0070683_100472873 3300005329 Unclassified 1197
5 Ga0070690_101180763 3300005330 Bacteria 610
6 Ga0070690_101284031 3300005330 Bacteria 586
7 Ga0070677_10001873 3300005333 Bacteria 6654
8 Ga0070666_10119055 3300005335 Bacteria 1830
9 Ga0070680_100016055 3300005336 Bacteria 5884
10 Ga0070680_100114225 3300005336 Bacteria 2250
11 Ga0068868_101837372 3300005338 Bacteria 573
12 Ga0070689_102057512 3300005340 Bacteria 523
13 Ga0070691_10883433 3300005341 Bacteria 550
14 Ga0070687_100113297 3300005343 Bacteria 1539
15 Ga0070675_101586754 3300005354 Bacteria 604
16 Ga0070673_100281978 3300005364 Bacteria 1457
17 Ga0070659_101165629 3300005366 Bacteria 681
18 Ga0070714_101553876 3300005435 Bacteria 646
19 Ga0070710_10471273 3300005437 Unclassified 855
20 Ga0070700_100325182 3300005441 Bacteria 1131
21 Ga0070663_101711551 3300005455 Bacteria 562
22 Ga0070663_101853795 3300005455 Bacteria 541
23 Ga0070678_102287397 3300005456 Bacteria 513
24 Ga0070662_101890726 3300005457 Bacteria 516
25 Ga0070681_10052109 3300005458 Bacteria 4081
26 Ga0070681_10097406 3300005458 Bacteria 2889
27 Ga0070685_10243236 3300005466 Bacteria 1189
28 Ga0070699_101062843 3300005518 Bacteria 742
29 Ga0070699_102037648 3300005518 Bacteria 524
30 Ga0070679_100119030 3300005530 Bacteria 2626
31 Ga0070679_100126078 3300005530 Bacteria 2542
32 Ga0070679_100663204 3300005530 Bacteria 986
33 Ga0068853_100009829 3300005539 Bacteria 7719
34 Ga0068853_100321366 3300005539 Bacteria 1435
35 Ga0070686_100341145 3300005544 Bacteria 1123
36 Ga0070695_101033021 3300005545 Bacteria 670
37 Ga0070696_100282159 3300005546 Bacteria 1266
38 Ga0070693_100919286 3300005547 Bacteria 657
39 Ga0070693_101190072 3300005547 Unclassified 585
40 Ga0070665_100016485 3300005548 Bacteria 7408
41 Ga0070665_100467490 3300005548 Bacteria 1271
42 Ga0068855_100080908 3300005563 Bacteria 3766
43 Ga0068855_101192576 3300005563 Bacteria 792
44 Ga0068855_102306907 3300005563 Unclassified 538
45 Ga0068854_100015474 3300005578 Bacteria 5055
46 Ga0068852_100964353 3300005616 Unclassified 871
47 Ga0068852_102615011 3300005616 Bacteria 524
48 Ga0068859_101532786 3300005617 Bacteria 736
49 Ga0068863_102005812 3300005841 Bacteria 589
50 Ga0081539_10000008 3300005985 Bacteria 525071
51 Ga0081539_10000319 3300005985 Bacteria 106944
52 Ga0070717_11561777 3300006028 Unclassified 598
53 Ga0075428_102613754 3300006844 Bacteria 516
54 Ga0075430_100217392 3300006846 Bacteria 1586
55 Ga0075431_100361957 3300006847 Bacteria 1457
56 Ga0075431_100525643 3300006847 Bacteria 1172
57 Ga0097620_101533168 3300006931 Bacteria 736
58 Ga0099794_10061118 3300007265 Bacteria 1830
59 Ga0099795_10010852 3300007788 Bacteria 2700
60 Ga0099795_10050513 3300007788 Bacteria 1513
61 Ga0099795_10072806 3300007788 Bacteria 1300
62 Ga0105240_10015803 3300009093 Bacteria 10241
63 Ga0105240_12043294 3300009093 Unclassified 595
64 Ga0105240_12422743 3300009093 Bacteria 543
65 Ga0111539_10702424 3300009094 Unclassified 1177
66 Ga0105245_10539489 3300009098 Bacteria 1187
67 Ga0114129_10084834 3300009147 Bacteria 4396
68 Ga0114129_11039366 3300009147 Unclassified 1029
69 Ga0105243_11115318 3300009148 Bacteria 798
70 Ga0105243_12773859 3300009148 Bacteria 530
71 Ga0105241_10452654 3300009174 Bacteria 1136
72 Ga0105242_11314019 3300009176 Bacteria 747
73 Ga0105248_10770531 3300009177 Bacteria 1086
74 Ga0105237_10177143 3300009545 Bacteria 2133
75 Ga0105238_10894698 3300009551 Bacteria 906
76 Ga0099796_10021798 3300010159 Bacteria 1978
77 Ga0099796_10049123 3300010159 Bacteria 1458
78 Ga0105246_11450377 3300011119 Bacteria 642
79 Ga0157373_10165806 3300013100 Bacteria 1555
80 Ga0157370_10033818 3300013104 Bacteria 4983
81 Ga0157370_10452046 3300013104 Bacteria 1181
82 Ga0157369_10418977 3300013105 Bacteria 1388
83 Ga0157374_11659012 3300013296 Bacteria 664
84 Ga0163162_13400040 3300013306 Bacteria 508
85 Ga0157372_10132939 3300013307 Unclassified 2864
86 Ga0157372_10776422 3300013307 Bacteria 1114
87 Ga0157380_10171722 3300014326 Bacteria 1895
88 Ga0157380_11032451 3300014326 Bacteria 857
89 Ga0157377_10907931 3300014745 Bacteria 659
90 Ga0213872_10158439 3300021361 Bacteria 986
91 Ga0213874_10047474 3300021377 Bacteria 1306
92 Ga0213876_10000863 3300021384 Bacteria 20272
93 Ga0213871_10015486 3300021441 Bacteria 1825
94 Ga0207426_1165645 3300025302 Bacteria 502
95 Ga0207692_10400267 3300025898 Unclassified 856
96 Ga0207692_11191628 3300025898 Bacteria 506
97 Ga0207705_10129802 3300025909 Bacteria 1875
98 Ga0207707_10059970 3300025912 Bacteria 3310
99 Ga0207707_10138709 3300025912 Unclassified 2126
100 Ga0207695_10300073 3300025913 Bacteria 1498
101 Ga0207671_10274652 3300025914 Bacteria 1328
102 Ga0207660_10093182 3300025917 Bacteria 2237
103 Ga0207662_10004205 3300025918 Bacteria 7545
104 Ga0207652_10188881 3300025921 Bacteria 1853
105 Ga0207652_10636885 3300025921 Bacteria 954
106 Ga0207687_10173432 3300025927 Bacteria 1665
107 Ga0207664_11187327 3300025929 Bacteria 681
108 Ga0207664_11469962 3300025929 Unclassified 603
109 Ga0207690_11028411 3300025932 Bacteria 686
110 Ga0207711_10923321 3300025941 Bacteria 811
111 Ga0207689_11799672 3300025942 Bacteria 506
112 Ga0207661_10429555 3300025944 Bacteria 1201
113 Ga0207679_10610988 3300025945 Bacteria 983
114 Ga0207667_10070753 3300025949 Bacteria 3630
115 Ga0207667_10460527 3300025949 Unclassified 1292
116 Ga0207667_10956526 3300025949 Bacteria 846
117 Ga0207668_10080767 3300025972 Bacteria 2356
118 Ga0207640_10364138 3300025981 Bacteria 1166
119 Ga0207640_11813145 3300025981 Bacteria 551
120 Ga0207639_10577409 3300026041 Bacteria 1035
121 Ga0207708_10094566 3300026075 Bacteria 2307
122 Ga0209179_1035255 3300027512 Bacteria 1039
123 Ga0209588_1232504 3300027671 Bacteria 567
124 Ga0268266_10005440 3300028379 Bacteria 11871
125 Ga0268266_10363464 3300028379 Bacteria 1362
126 Ga0268265_12340577 3300028380 Unclassified 541
127 Ga0265338_10066089 3300028800 Bacteria 3132
128 Ga0265338_10451539 3300028800 Bacteria 910
129 Ga0265328_10064912 3300031239 Bacteria 1341
130 Ga0265339_10197663 3300031249 Bacteria 993
131 Ga0265316_10264706 3300031344 Unclassified 1260
132 Ga0265316_11108993 3300031344 Bacteria 549
133 Ga0316578_10264141 3300031728 Bacteria 1032
134 Ga0307405_11799651 3300031731 Bacteria 544
135 Ga0307413_10128426 3300031824 Bacteria 1730
136 Ga0307410_11045053 3300031852 Unclassified 706
137 Ga0307407_11112988 3300031903 Bacteria 614
138 Ga0307409_100726518 3300031995 Bacteria 995
139 Ga0307416_102463977 3300032002 Bacteria 619
140 Ga0307414_10148873 3300032004 Bacteria 1843
141 Ga0307414_12203755 3300032004 Bacteria 514
142 Ga0307411_10912880 3300032005 Bacteria 781
143 Ga0307411_12301776 3300032005 Bacteria 506
144 Ga0316583_10105147 3300032133 Bacteria 984
145 Ga0373923_0097814 3300035111 Bacteria 1291
146 Ga0373936_0129605 3300035113 Bacteria 1083
147 Ga0373954_0670256 3300035118 Unclassified 514
148 Ga0373946_0327538 3300035171 Bacteria 762
149 Ga0316574_0031562 3300035398 Unclassified 3213
150 Ga0373927_0425631 3300035695 Bacteria 876
151 Ga0316582_0058759 3300036647 Unclassified 2460
152 Ga0316582_0821144 3300036647 Bacteria 637
153 Ga0395898_0071713 3300037466 Bacteria 3347
154 Ga0436364_1529721 3300037853 Bacteria 1289
155 Ga0395901_0092390 3300038443 Bacteria 3168
156 Ga0436365_0042429 3300039437 Bacteria 1110
157 Ga0436365_0714193 3300039437 Bacteria 1454
158 Ga0436365_1360649 3300039437 Bacteria 21586
159 Ga0436360_0203248 3300039438 Bacteria 2841
160 Ga0436360_1028615 3300039438 Bacteria 595
161 Ga0436361_0100687 3300039447 Bacteria 1598
162 Ga0436361_0384379 3300039447 Bacteria 1906
163 Ga0436361_1146483 3300039447 Bacteria 4388
164 Ga0436363_1636268 3300039450 Bacteria 1442
165 Ga0436362_0723235 3300039453 Bacteria 523
166 Ga0439465_0051423 3300041413 Bacteria 1350
167 Ga0451807_1779671 3300041486 Bacteria 1030
168 Ga0451835_0018235 3300041492 Bacteria 615
169 Ga0451843_1551270 3300041509 Unclassified 649
170 Ga0439460_0219929 3300042461 Bacteria 651
171 Ga0451577_0008204 3300042876 Bacteria 10183
172 Ga0453683_0407889 3300044673 Unclassified 876
173 Ga0466961_0976888 3300044693 Bacteria 503
174 Ga0466963_0271695 3300044694 Bacteria 1191
175 Ga0466963_0999035 3300044694 Unclassified 589
176 Ga0466964_0806501 3300044706 Bacteria 531
177 Ga0453684_0005067 3300044712 Bacteria 26658
178 Ga0453684_1080249 3300044712 Bacteria 849
179 Ga0466971_0031340 3300044719 Bacteria 2381
180 Ga0466968_0297759 3300044735 Bacteria 775
181 Ga0466970_0504143 3300044765 Bacteria 697
182 Ga0466957_0027500 3300044842 Bacteria 3381
183 Ga0466959_0011018 3300045049 Bacteria 6489
184 Ga0466967_0097884 3300045976 Bacteria 2678
185 Ga0495592_0764740 3300046454 Bacteria 576
186 Ga0495639_0316599 3300046475 Bacteria 780
187 Ga0495664_0018687 3300046477 Bacteria 3976
188 Ga0495664_0885051 3300046477 Bacteria 523
189 Ga0495606_0014573 3300046507 Bacteria 6119
190 Ga0495610_0162886 3300046512 Bacteria 941
191 Ga0495628_1211577 3300046516 Bacteria 512
192 Ga0495630_0272949 3300046517 Bacteria 1292
193 Ga0495645_0190285 3300046543 Bacteria 1399
194 Ga0495611_0088958 3300046648 Bacteria 1426
195 Ga0495599_0121975 3300046678 Bacteria 1620
196 Ga0495658_0641385 3300046683 Bacteria 680
197 Ga0495658_1122666 3300046683 Bacteria 501
198 Ga0495624_0274993 3300046690 Bacteria 1017
199 Ga0495604_0935262 3300047317 Bacteria 540
200 Ga0495674_0590179 3300047319 Bacteria 881
201 Ga0495674_0874281 3300047319 Bacteria 695
202 Ga0495593_0521750 3300047673 Bacteria 596
203 Ga0496102_0418392 3300048905 Bacteria 1259
204 Ga0496108_0312310 3300048911 Bacteria 1370
205 Ga0496110_0345022 3300048913 Bacteria 1356
206 Ga0496119_0311901 3300048922 Bacteria 772
207 Ga0496120_0193103 3300048923 Bacteria 991
208 Ga0496121_0195903 3300048924 Bacteria 1444
209 Ga0501306_003053 3300049127 Bacteria 1773
210 Ga0501310_017317 3300049130 Bacteria 871
211 Ga0501304_008193 3300049160 Bacteria 877
212 Ga0501305_026982 3300049161 Bacteria 879
213 Ga0501295_051447 3300049518 Bacteria 883
214 Ga0501311_016730 3300049527 Bacteria 958
215 Ga0501312_020496 3300049528 Bacteria 978
216 Ga0501321_015260 3300049537 Bacteria 903
217 Ga0501325_029193 3300049541 Bacteria 623
218 Ga0501032_0039547 3300049569 Bacteria 3208
219 Ga0501033_0044539 3300049570 Bacteria 3303
220 Ga0501034_0000551 3300049571 Bacteria 59419
221 Ga0501037_0174664 3300049573 Bacteria 1526
222 Ga0501038_0751605 3300049574 Bacteria 727
223 Ga0501041_0391903 3300049577 Bacteria 879
224 Ga0501043_0062313 3300049579 Bacteria 2928
225 Ga0501043_0224875 3300049579 Bacteria 1451
226 Ga0501047_0038832 3300049581 Bacteria 4605
227 Ga0501048_0409880 3300049582 Bacteria 969
228 Ga0501048_0982180 3300049582 Unclassified 607
229 Ga0501070_0034000 3300049586 Bacteria 4264
230 Ga0501071_0852466 3300049587 Bacteria 703
231 Ga0501073_0226611 3300049589 Bacteria 1291
232 Ga0501075_1052760 3300049591 Unclassified 618
233 Ga0501080_0070841 3300049742 Bacteria 3243
234 Ga0501083_0047988 3300049744 Bacteria 2883
235 Ga0501270_056828 3300049767 Bacteria 724
236 Ga0501273_029741 3300049770 Bacteria 773
237 Ga0501035_0092296 3300049822 Bacteria 2664
238 Ga0501044_0021784 3300049823 Bacteria 6834
239 Ga0501044_0029160 3300049823 Bacteria 5820
240 nmdc:mga09592_790087_c1 3300050508 Unclassified 803
241 nmdc:mga0qj67_200343_c1 3300050509 Bacteria 1622
242 nmdc:mga06r32_1015090_c1 3300050510 Bacteria 782
243 nmdc:mga06r32_547150_c1 3300050510 Bacteria 1132
244 Ga0495612_0180065 3300053078 Bacteria 928
245 Ga0500635_0021146 3300053080 Bacteria 2001
246 Ga0500643_000019 3300053087 Bacteria 294301
247 Ga0500647_0421995 3300053091 Bacteria 535
248 Ga0500583_0125136 3300053092 Bacteria 1273
249 Ga0500651_0149765 3300053093 Bacteria 1402
250 Ga0500651_0228395 3300053093 Bacteria 1089
251 Ga0500651_0589444 3300053093 Bacteria 604
252 Ga0500566_0036182 3300053094 Bacteria 2866
253 Ga0500566_0367414 3300053094 Bacteria 654
254 Ga0500640_018555 3300053095 Bacteria 2968
255 Ga0500641_0040978 3300053096 Bacteria 1872
256 Ga0500648_224675 3300053097 Bacteria 915
257 Ga0500650_0201282 3300053098 Bacteria 907
258 Ga0500650_0267028 3300053098 Bacteria 764
259 Ga0500554_254829 3300053102 Bacteria 577
260 Ga0500555_003272 3300053103 Bacteria 4613
261 Ga0500562_120135 3300053108 Bacteria 716
262 Ga0500569_057209 3300053109 Bacteria 1194
263 Ga0500572_006656 3300053111 Bacteria 2653
264 Ga0500594_0155079 3300053118 Bacteria 737
265 Ga0500607_057549 3300053121 Bacteria 2048
266 Ga0500608_058712 3300053122 Bacteria 1841
267 Ga0500614_070523 3300053123 Bacteria 958
268 Ga0500642_0310568 3300053130 Bacteria 709
269 Ga0500658_0471486 3300053134 Bacteria 570
270 Ga0500559_0033710 3300053136 Bacteria 2205
271 Ga0500559_0117529 3300053136 Bacteria 1235
272 Ga0500559_0521177 3300053136 Bacteria 544
273 Ga0500564_071952 3300053138 Bacteria 1558
274 Ga0500564_111399 3300053138 Bacteria 1201
275 Ga0500568_0071901 3300053139 Bacteria 1323
276 Ga0500573_0035475 3300053140 Bacteria 2878
277 Ga0500577_0180274 3300053142 Bacteria 906
278 Ga0500588_0292307 3300053146 Bacteria 616
279 Ga0500590_120117 3300053148 Bacteria 1232
280 Ga0500590_221150 3300053148 Bacteria 781
281 Ga0500604_0122219 3300053151 Bacteria 871
282 Ga0500616_0001490 3300053153 Bacteria 22209
283 Ga0500619_191517 3300053154 Bacteria 688
284 Ga0500627_0242194 3300053158 Bacteria 800
285 Ga0500638_007043 3300053162 Bacteria 4665
286 Ga0500638_036610 3300053162 Bacteria 2380
287 Ga0500639_156072 3300053163 Bacteria 1045
288 Ga0500636_0000346 3300053177 Bacteria 25557
289 Ga0500636_0045924 3300053177 Bacteria 2575
290 Ga0500636_0059953 3300053177 Bacteria 2223
291 Ga0500636_0229994 3300053177 Bacteria 960
292 Ga0500636_0345628 3300053177 Bacteria 712
293 Ga0500637_0044270 3300053178 Bacteria 2521
294 Ga0500645_050738 3300053730 Bacteria 1210
295 Ga0500645_068565 3300053730 Bacteria 1020
296 Ga0500609_004513 3300053731 Bacteria 1922
297 Ga0500596_000877 3300053735 Bacteria 5990
298 Ga0500596_064459 3300053735 Bacteria 618
299 Ga0500661_104263 3300055283 Bacteria 540
300 Ga0530510_0930696 3300061734 Unclassified 664
301 Ga0105237_10825833
302 JGI25406J46586_10000161
303 Ga0070658_10677142
304 Ga0070683_100472873
305 Ga0070690_101180763
306 Ga0070690_101284031
307 Ga0070677_10001873
308 Ga0070666_10119055
309 Ga0070680_100016055
310 Ga0070680_100114225
311 Ga0068868_101837372
312 Ga0070689_102057512
313 Ga0070691_10883433
314 Ga0070687_100113297
315 Ga0070675_101586754
316 Ga0070673_100281978
317 Ga0070659_101165629
318 Ga0070714_101553876
319 Ga0070710_10471273
320 Ga0070700_100325182
321 Ga0070663_101711551
322 Ga0070663_101853795
323 Ga0070678_102287397
324 Ga0070662_101890726
325 Ga0070681_10052109
326 Ga0070681_10097406
327 Ga0070685_10243236
328 Ga0070699_101062843
329 Ga0070699_102037648
330 Ga0070679_100119030
331 Ga0070679_100126078
332 Ga0070679_100663204
333 Ga0068853_100009829
334 Ga0068853_100321366
335 Ga0070686_100341145
336 Ga0070695_101033021
337 Ga0070696_100282159
338 Ga0070693_100919286
339 Ga0070693_101190072
340 Ga0070665_100016485
341 Ga0070665_100467490
342 Ga0068855_100080908
343 Ga0068855_101192576
344 Ga0068855_102306907
345 Ga0068854_100015474
346 Ga0068852_100964353
347 Ga0068852_102615011
348 Ga0068859_101532786
349 Ga0068863_102005812
350 Ga0081539_10000008
351 Ga0081539_10000319
352 Ga0070717_11561777
353 Ga0075428_102613754
354 Ga0075430_100217392
355 Ga0075431_100361957
356 Ga0075431_100525643
357 Ga0097620_101533168
358 Ga0099794_10061118
359 Ga0099795_10010852
360 Ga0099795_10050513
361 Ga0099795_10072806
362 Ga0105240_10015803
363 Ga0105240_12043294
364 Ga0105240_12422743
365 Ga0111539_10702424
366 Ga0105245_10539489
367 Ga0114129_10084834
368 Ga0114129_11039366
369 Ga0105243_11115318
370 Ga0105243_12773859
371 Ga0105241_10452654
372 Ga0105242_11314019
373 Ga0105248_10770531
374 Ga0105237_10177143
375 Ga0105238_10894698
376 Ga0099796_10021798
377 Ga0099796_10049123
378 Ga0105246_11450377
379 Ga0157373_10165806
380 Ga0157370_10033818
381 Ga0157370_10452046
382 Ga0157369_10418977
383 Ga0157374_11659012
384 Ga0163162_13400040
385 Ga0157372_10132939
386 Ga0157372_10776422
387 Ga0157380_10171722
388 Ga0157380_11032451
389 Ga0157377_10907931
390 Ga0213872_10158439
391 Ga0213874_10047474
392 Ga0213876_10000863
393 Ga0213871_10015486
394 Ga0207426_1165645
395 Ga0207692_10400267
396 Ga0207692_11191628
397 Ga0207705_10129802
398 Ga0207707_10059970
399 Ga0207707_10138709
400 Ga0207695_10300073
401 Ga0207671_10274652
402 Ga0207660_10093182
403 Ga0207662_10004205
404 Ga0207652_10188881
405 Ga0207652_10636885
406 Ga0207687_10173432
407 Ga0207664_11187327
408 Ga0207664_11469962
409 Ga0207690_11028411
410 Ga0207711_10923321
411 Ga0207689_11799672
412 Ga0207661_10429555
413 Ga0207679_10610988
414 Ga0207667_10070753
415 Ga0207667_10460527
416 Ga0207667_10956526
417 Ga0207668_10080767
418 Ga0207640_10364138
419 Ga0207640_11813145
420 Ga0207639_10577409
421 Ga0207708_10094566
422 Ga0209179_1035255
423 Ga0209588_1232504
424 Ga0268266_10005440
425 Ga0268266_10363464
426 Ga0268265_12340577
427 Ga0265338_10066089
428 Ga0265338_10451539
429 Ga0265328_10064912
430 Ga0265339_10197663
431 Ga0265316_10264706
432 Ga0265316_11108993
433 Ga0316578_10264141
434 Ga0307405_11799651
435 Ga0307413_10128426
436 Ga0307410_11045053
437 Ga0307407_11112988
438 Ga0307409_100726518
439 Ga0307416_102463977
440 Ga0307414_10148873
441 Ga0307414_12203755
442 Ga0307411_10912880
443 Ga0307411_12301776
444 Ga0316583_10105147
445 Ga0373923_0097814
446 Ga0373936_0129605
447 Ga0373954_0670256
448 Ga0373946_0327538
449 Ga0316574_0031562
450 Ga0373927_0425631
451 Ga0316582_0058759
452 Ga0316582_0821144
453 Ga0395898_0071713
454 Ga0436364_1529721
455 Ga0395901_0092390
456 Ga0436365_0042429
457 Ga0436365_0714193
458 Ga0436365_1360649
459 Ga0436360_0203248
460 Ga0436360_1028615
461 Ga0436361_0100687
462 Ga0436361_0384379
463 Ga0436361_1146483
464 Ga0436363_1636268
465 Ga0436362_0723235
466 Ga0439465_0051423
467 Ga0451807_1779671
468 Ga0451835_0018235
469 Ga0451843_1551270
470 Ga0439460_0219929
471 Ga0451577_0008204
472 Ga0453683_0407889
473 Ga0466961_0976888
474 Ga0466963_0271695
475 Ga0466963_0999035
476 Ga0466964_0806501
477 Ga0453684_0005067
478 Ga0453684_1080249
479 Ga0466971_0031340
480 Ga0466968_0297759
481 Ga0466970_0504143
482 Ga0466957_0027500
483 Ga0466959_0011018
484 Ga0466967_0097884
485 Ga0495592_0764740
486 Ga0495639_0316599
487 Ga0495664_0018687
488 Ga0495664_0885051
489 Ga0495606_0014573
490 Ga0495610_0162886
491 Ga0495628_1211577
492 Ga0495630_0272949
493 Ga0495645_0190285
494 Ga0495611_0088958
495 Ga0495599_0121975
496 Ga0495658_0641385
497 Ga0495658_1122666
498 Ga0495624_0274993
499 Ga0495604_0935262
500 Ga0495674_0590179
501 Ga0495674_0874281
502 Ga0495593_0521750
503 Ga0496102_0418392
504 Ga0496108_0312310
505 Ga0496110_0345022
506 Ga0496119_0311901
507 Ga0496120_0193103
508 Ga0496121_0195903
509 Ga0501306_003053
510 Ga0501310_017317
511 Ga0501304_008193
512 Ga0501305_026982
513 Ga0501295_051447
514 Ga0501311_016730
515 Ga0501312_020496
516 Ga0501321_015260
517 Ga0501325_029193
518 Ga0501032_0039547
519 Ga0501033_0044539
520 Ga0501034_0000551
521 Ga0501037_0174664
522 Ga0501038_0751605
523 Ga0501041_0391903
524 Ga0501043_0062313
525 Ga0501043_0224875
526 Ga0501047_0038832
527 Ga0501048_0409880
528 Ga0501048_0982180
529 Ga0501070_0034000
530 Ga0501071_0852466
531 Ga0501073_0226611
532 Ga0501075_1052760
533 Ga0501080_0070841
534 Ga0501083_0047988
535 Ga0501270_056828
536 Ga0501273_029741
537 Ga0501035_0092296
538 Ga0501044_0021784
539 Ga0501044_0029160
540 nmdc:mga09592_790087_c1
541 nmdc:mga0qj67_200343_c1
542 nmdc:mga06r32_1015090_c1
543 nmdc:mga06r32_547150_c1
544 Ga0495612_0180065
545 Ga0500635_0021146
546 Ga0500643_000019
547 Ga0500647_0421995
548 Ga0500583_0125136
549 Ga0500651_0149765
550 Ga0500651_0228395
551 Ga0500651_0589444
552 Ga0500566_0036182
553 Ga0500566_0367414
554 Ga0500640_018555
555 Ga0500641_0040978
556 Ga0500648_224675
557 Ga0500650_0201282
558 Ga0500650_0267028
559 Ga0500554_254829
560 Ga0500555_003272
561 Ga0500562_120135
562 Ga0500569_057209
563 Ga0500572_006656
564 Ga0500594_0155079
565 Ga0500607_057549
566 Ga0500608_058712
567 Ga0500614_070523
568 Ga0500642_0310568
569 Ga0500658_0471486
570 Ga0500559_0033710
571 Ga0500559_0117529
572 Ga0500559_0521177
573 Ga0500564_071952
574 Ga0500564_111399
575 Ga0500568_0071901
576 Ga0500573_0035475
577 Ga0500577_0180274
578 Ga0500588_0292307
579 Ga0500590_120117
580 Ga0500590_221150
581 Ga0500604_0122219
582 Ga0500616_0001490
583 Ga0500619_191517
584 Ga0500627_0242194
585 Ga0500638_007043
586 Ga0500638_036610
587 Ga0500639_156072
588 Ga0500636_0000346
589 Ga0500636_0045924
590 Ga0500636_0059953
591 Ga0500636_0229994
592 Ga0500636_0345628
593 Ga0500637_0044270
594 Ga0500645_050738
595 Ga0500645_068565
596 Ga0500609_004513
597 Ga0500596_000877
598 Ga0500596_064459
599 Ga0500661_104263
600 Ga0530510_0930696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15919

HicB_lk_antitox

HicB_like antitoxin of bacterial toxin-antitoxin system

14

73

0.91

PF21748

UPF0150

UPF0150-like

10

66

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1c-assembly1.cif.gz_V crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.9363 5 47
6g1n-assembly1.cif.gz_B crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8996 1 47
6g1n-assembly1.cif.gz_D crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8973 5 47
6g1c-assembly1.cif.gz_C crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.8768 1 47
6g26-assembly1.cif.gz_D the crystal structure of the burkholderia pseudomallei hicab complex 0.8761 5 47
ID Description Score Start End Superfamily
af_K7LBL5_48_252_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7777 1 32 2.130.10.10
af_O49624_59_318_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7639 1 28 2.115.10.20
af_K7N3K0_1500_1659_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7607 2 33 2.130.10.10
1lqlJ01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7605 1 31 2.20.25.10
1lqlA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7508 2 29 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A7J4JWC1-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9804 3 47
AF-A0A1Z4LKQ4-F1-model_v4 Uncharacterized protein 0.9767 1 49
AF-A0A551ZK81-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9749 1 50
AF-A0A7C1ZYS9-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 0.9744 1 48
AF-A0A424YXN4-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.9716 1 49

Map