F395178

General Info

Members Datasets Scaffolds Average Seq Length
300 235 600 267

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10197005|Ga0070658_101970052
Length 301
Sequence MTDDTIRSGDMAEAATAIGAIELPTSTTDLAPESIAAALPLALKPTPRRVLVTGATRGIGAAIAQALAGAGWHVTLAGRARAALEEVRVTLPITEGLVHDCVELDVTDAASVARAFAQVHARGGALQALVNNAGAVETAPLVKTAQDTWDRMLAVNLTGVFLCTQAALAPMLAARAGRIVNIASTAGQKGYAYCTAYAAAKHGVLGMTRSLALEVAPQGLSVNAVCPGYTDTDIVRDGVARIVAATGRSQGDAMATFSQSSPLKRLVEPAEVAATVLWLCADAPAAFTGQAMSVSGGEVMN

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
213 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
224 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
225 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
226 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
227 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
228 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
229 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
230 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
231 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
232 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
233 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
234 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
235 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.33
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.67
Nodule 0
Rhizoplane 3.33
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10197005 3300005327 Bacteria 1699
2 JGI25156J39149_1000145 3300002705 Bacteria 52488
3 JGI25157J39369_1000150 3300002741 Bacteria 58511
4 JGI25152J39213_1001052 3300002773 Bacteria 13108
5 JGI25153J46596_10000500 3300003215 Bacteria 24942
6 rootH1_10081718 3300003316 Bacteria 1328
7 rootL2_10245500 3300003322 Bacteria 1944
8 Ga0055539_1000489 3300003752 Bacteria 12789
9 Ga0055533_1000016 3300003756 Bacteria 396179
10 Ga0055525_1001034 3300003759 Bacteria 7282
11 Ga0055535_1000309 3300003761 Bacteria 49533
12 Ga0055529_1000363 3300003763 Bacteria 49527
13 Ga0055526_1001517 3300003771 Bacteria 16449
14 Ga0055540_1014999 3300003792 Bacteria 2279
15 Ga0065165_1000923 3300005262 Bacteria 37706
16 Ga0065165_1000977 3300005262 Bacteria 35591
17 Ga0070658_10033369 3300005327 Bacteria 4141
18 Ga0068869_100430833 3300005334 Bacteria 1090
19 Ga0070680_100068122 3300005336 Bacteria 2921
20 Ga0070660_100053740 3300005339 Bacteria 3107
21 Ga0070661_100040013 3300005344 Bacteria 3418
22 Ga0070668_100340524 3300005347 Bacteria 1267
23 Ga0070671_100203769 3300005355 Bacteria 1678
24 Ga0070673_100044792 3300005364 Bacteria 3428
25 Ga0070659_100510253 3300005366 Bacteria 1026
26 Ga0070713_100020170 3300005436 Bacteria 5105
27 Ga0070713_100058685 3300005436 Bacteria 3210
28 Ga0070713_100342359 3300005436 Bacteria 1386
29 Ga0070665_100002471 3300005548 Bacteria 20382
30 Ga0068855_100004393 3300005563 Bacteria 17231
31 Ga0068855_100222951 3300005563 Bacteria 2113
32 Ga0068855_100344111 3300005563 Bacteria 1644
33 Ga0068857_100037438 3300005577 Bacteria 4297
34 Ga0068854_100008569 3300005578 Bacteria 6580
35 Ga0068856_100000984 3300005614 Bacteria 30419
36 Ga0068852_100604417 3300005616 Bacteria 1101
37 Ga0068859_100760065 3300005617 Bacteria 1058
38 Ga0068866_10050789 3300005718 Bacteria 2108
39 Ga0068862_100456925 3300005844 Bacteria 1205
40 Ga0070717_10142506 3300006028 Bacteria 2068
41 Ga0075364_10055570 3300006051 Bacteria 2590
42 Ga0070712_100096682 3300006175 Bacteria 2175
43 Ga0097620_100760190 3300006931 Bacteria 1058
44 Ga0105240_10022455 3300009093 Bacteria 8363
45 Ga0105240_10025599 3300009093 Bacteria 7749
46 Ga0105240_10053535 3300009093 Bacteria 5065
47 Ga0105243_10196810 3300009148 Bacteria 1765
48 Ga0105242_10120578 3300009176 Bacteria 2250
49 Ga0105248_10137955 3300009177 Bacteria 2751
50 Ga0105237_10032277 3300009545 Bacteria 5302
51 Ga0105239_10082806 3300010375 Bacteria 3533
52 Ga0105246_10056111 3300011119 Bacteria 2721
53 Ga0163162_10059152 3300013306 Bacteria 3863
54 Ga0163162_10381340 3300013306 Bacteria 1543
55 Ga0157372_10394147 3300013307 Bacteria 1614
56 Ga0157375_10662477 3300013308 Bacteria 1199
57 Ga0157379_10040226 3300014968 Bacteria 4172
58 Ga0157376_10524831 3300014969 Bacteria 1168
59 Ga0213872_10019472 3300021361 Bacteria 3126
60 Ga0213872_10080350 3300021361 Bacteria 1465
61 Ga0209674_100041 3300025226 Bacteria 396231
62 Ga0209672_102952 3300025228 Bacteria 3764
63 Ga0209563_100043 3300025230 Bacteria 397271
64 Ga0207427_102470 3300025231 Bacteria 4933
65 Ga0209258_100513 3300025242 Bacteria 37337
66 Ga0209258_101214 3300025242 Bacteria 10080
67 Ga0207425_1000651 3300025245 Bacteria 19210
68 Ga0209646_1000069 3300025246 Bacteria 230340
69 Ga0209026_1000006 3300025250 Bacteria 677225
70 Ga0209677_100098 3300025253 Bacteria 96201
71 Ga0209677_100186 3300025253 Bacteria 50478
72 Ga0209677_103188 3300025253 Bacteria 5504
73 Ga0209148_1004130 3300025254 Bacteria 3665
74 Ga0209759_1000075 3300025256 Bacteria 176235
75 Ga0209759_1000746 3300025256 Bacteria 28241
76 Ga0209759_1001013 3300025256 Bacteria 18917
77 Ga0209759_1010518 3300025256 Bacteria 2707
78 Ga0209759_1013709 3300025256 Bacteria 2178
79 Ga0209759_1029156 3300025256 Bacteria 1110
80 Ga0209129_1000027 3300025258 Bacteria 409587
81 Ga0209455_1000311 3300025272 Bacteria 49589
82 Ga0209673_1023873 3300025273 Bacteria 2069
83 Ga0209564_1000014 3300025295 Bacteria 621501
84 Ga0209758_1000208 3300025297 Bacteria 128596
85 Ga0209050_1000198 3300025298 Bacteria 134820
86 Ga0209256_1015432 3300025299 Bacteria 2671
87 Ga0209051_1002590 3300025303 Bacteria 12732
88 Ga0209051_1009058 3300025303 Bacteria 5178
89 Ga0209051_1011937 3300025303 Bacteria 4243
90 Ga0207705_10035560 3300025909 Bacteria 3564
91 Ga0207705_10144325 3300025909 Bacteria 1780
92 Ga0207705_10177375 3300025909 Bacteria 1607
93 Ga0207695_10027178 3300025913 Bacteria 6374
94 Ga0207695_10068197 3300025913 Bacteria 3645
95 Ga0207695_10080133 3300025913 Bacteria 3308
96 Ga0207695_10104017 3300025913 Bacteria 2830
97 Ga0207671_10149938 3300025914 Bacteria 1801
98 Ga0207693_10143311 3300025915 Bacteria 1879
99 Ga0207663_10010962 3300025916 Bacteria 4845
100 Ga0207660_10047087 3300025917 Bacteria 3046
101 Ga0207657_10063261 3300025919 Bacteria 3164
102 Ga0207649_10037475 3300025920 Bacteria 2929
103 Ga0207694_10202043 3300025924 Bacteria 1617
104 Ga0207700_10049790 3300025928 Bacteria 3118
105 Ga0207700_10091038 3300025928 Bacteria 2409
106 Ga0207700_10679703 3300025928 Bacteria 918
107 Ga0207690_10026772 3300025932 Bacteria 3635
108 Ga0207709_10117593 3300025935 Bacteria 1789
109 Ga0207669_10190974 3300025937 Bacteria 1477
110 Ga0207689_10009525 3300025942 Bacteria 8381
111 Ga0207661_10037681 3300025944 Bacteria 3784
112 Ga0207667_10026152 3300025949 Bacteria 6381
113 Ga0207667_10112103 3300025949 Bacteria 2813
114 Ga0207667_10115828 3300025949 Bacteria 2762
115 Ga0207667_10345837 3300025949 Bacteria 1517
116 Ga0207712_10494766 3300025961 Bacteria 1044
117 Ga0207640_10001813 3300025981 Bacteria 11461
118 Ga0207702_10002113 3300026078 Bacteria 19138
119 Ga0207641_10290967 3300026088 Bacteria 1540
120 Ga0207648_10189354 3300026089 Bacteria 1823
121 Ga0207674_10050943 3300026116 Bacteria 4226
122 Ga0207674_10257202 3300026116 Bacteria 1693
123 Ga0207675_100081616 3300026118 Bacteria 3032
124 Ga0207675_100106055 3300026118 Bacteria 2649
125 Ga0207698_10270430 3300026142 Bacteria 1566
126 Ga0209974_10003382 3300027876 Bacteria 5764
127 Ga0268266_10003012 3300028379 Bacteria 17304
128 Ga0268265_10165976 3300028380 Bacteria 1882
129 Ga0265336_10000133 3300028666 Bacteria 53127
130 Ga0307515_10002873 3300028794 Bacteria 36628
131 Ga0307515_10021818 3300028794 Bacteria 11327
132 Ga0265324_10000607 3300029957 Bacteria 24457
133 Ga0307511_10100395 3300030521 Bacteria 1904
134 Ga0265760_10068735 3300031090 Bacteria 1084
135 Ga0265331_10005134 3300031250 Bacteria 7976
136 Ga0307513_10005765 3300031456 Bacteria 16291
137 Ga0307509_10407114 3300031507 Bacteria 1065
138 Ga0307514_10001033 3300031649 Bacteria 40119
139 Ga0307516_10002476 3300031730 Bacteria 24625
140 Ga0307516_10003587 3300031730 Bacteria 19791
141 Ga0307410_10241120 3300031852 Bacteria 1401
142 Ga0307412_10068768 3300031911 Bacteria 2409
143 Ga0373931_0004809 3300035691 Bacteria 6199
144 Ga0316582_0498270 3300036647 Bacteria 839
145 Ga0395899_0175670 3300037312 Bacteria 1506
146 Ga0436364_1315969 3300037853 Bacteria 1618
147 Ga0395901_0000878 3300038443 Bacteria 33132
148 Ga0436361_0387956 3300039447 Bacteria 5681
149 Ga0436361_0635551 3300039447 Bacteria 2986
150 Ga0436362_0931285 3300039453 Bacteria 1203
151 Ga0451791_1653870 3300041451 Bacteria 1314
152 Ga0451793_1692283 3300041452 Bacteria 1468
153 Ga0451795_1182154 3300041456 Bacteria 989
154 Ga0451845_0732888 3300041501 Bacteria 999
155 Ga0451853_1759196 3300041512 Bacteria 1692
156 Ga0451577_0415503 3300042876 Bacteria 1221
157 Ga0451577_0456247 3300042876 Bacteria 1161
158 Ga0466969_0030644 3300044656 Bacteria 2740
159 Ga0466965_0038726 3300044683 Bacteria 2342
160 Ga0466966_0001715 3300044684 Bacteria 14176
161 Ga0466966_0010876 3300044684 Bacteria 6044
162 Ga0466966_0065340 3300044684 Bacteria 2288
163 Ga0466961_0011302 3300044693 Bacteria 5708
164 Ga0466961_0082380 3300044693 Bacteria 2035
165 Ga0466961_0181033 3300044693 Bacteria 1309
166 Ga0466963_0035585 3300044694 Bacteria 3245
167 Ga0466963_0142259 3300044694 Bacteria 1662
168 Ga0453684_0000077 3300044712 Bacteria 435536
169 Ga0453684_0000882 3300044712 Bacteria 100349
170 Ga0466971_0004052 3300044719 Bacteria 6302
171 Ga0466971_0014347 3300044719 Bacteria 3486
172 Ga0466970_0160299 3300044765 Bacteria 1244
173 Ga0466957_0014398 3300044842 Bacteria 4605
174 Ga0466957_0118924 3300044842 Bacteria 1683
175 Ga0466960_0088335 3300044901 Bacteria 1576
176 Ga0466959_0019030 3300045049 Bacteria 5047
177 Ga0466959_0032235 3300045049 Bacteria 3879
178 Ga0466967_0269885 3300045976 Bacteria 1630
179 Ga0495592_0004349 3300046454 Bacteria 10367
180 Ga0495592_0065706 3300046454 Bacteria 2655
181 Ga0495603_0024571 3300046455 Bacteria 3645
182 Ga0495629_0110071 3300046459 Bacteria 1920
183 Ga0495638_0048008 3300046460 Bacteria 2674
184 Ga0495653_0296170 3300046463 Bacteria 1056
185 Ga0495580_0010289 3300046472 Bacteria 7295
186 Ga0495582_0030033 3300046473 Bacteria 2982
187 Ga0495639_0079361 3300046475 Bacteria 1526
188 Ga0495662_0156595 3300046476 Bacteria 1122
189 Ga0495664_0046131 3300046477 Bacteria 2586
190 Ga0495585_0009398 3300046492 Bacteria 5865
191 Ga0495594_0153889 3300046499 Bacteria 1306
192 Ga0495607_0118308 3300046501 Bacteria 1395
193 Ga0495583_0000081 3300046506 Bacteria 168304
194 Ga0495606_0001388 3300046507 Bacteria 32749
195 Ga0495606_0197424 3300046507 Bacteria 1149
196 Ga0495618_0045493 3300046514 Bacteria 2769
197 Ga0495620_0026566 3300046515 Bacteria 2722
198 Ga0495630_0040083 3300046517 Bacteria 3500
199 Ga0495631_0122797 3300046518 Bacteria 1117
200 Ga0495632_0001262 3300046519 Bacteria 21459
201 Ga0495632_0023083 3300046519 Bacteria 3326
202 Ga0495643_0197184 3300046522 Bacteria 968
203 Ga0495666_0030291 3300046526 Bacteria 2656
204 Ga0495652_0088130 3300046529 Bacteria 2544
205 Ga0495652_0089181 3300046529 Bacteria 2525
206 Ga0495665_0017827 3300046531 Bacteria 3816
207 Ga0495640_0012027 3300046533 Bacteria 6631
208 Ga0495640_0130968 3300046533 Bacteria 1623
209 Ga0495586_0094417 3300046535 Bacteria 1654
210 Ga0495609_0004011 3300046538 Bacteria 8217
211 Ga0495597_0000335 3300046542 Bacteria 42105
212 Ga0495668_0202789 3300046616 Bacteria 1086
213 Ga0495634_0037735 3300046642 Bacteria 3299
214 Ga0495634_0218131 3300046642 Bacteria 1178
215 Ga0495625_0001985 3300046660 Bacteria 23083
216 Ga0495625_0008259 3300046660 Bacteria 8900
217 Ga0495661_0247394 3300046665 Bacteria 911
218 Ga0495623_0043357 3300046679 Bacteria 2863
219 Ga0495613_0050922 3300046689 Bacteria 3053
220 Ga0495624_0026762 3300046690 Bacteria 3779
221 Ga0495624_0129767 3300046690 Bacteria 1546
222 Ga0495670_0053826 3300046691 Bacteria 2015
223 Ga0495649_0000579 3300046694 Bacteria 30684
224 Ga0495649_0046127 3300046694 Bacteria 2374
225 Ga0495589_0086288 3300046794 Bacteria 1524
226 Ga0495600_0226948 3300046809 Bacteria 1193
227 Ga0495604_0047380 3300047317 Bacteria 3347
228 Ga0495604_0244779 3300047317 Bacteria 1224
229 Ga0495604_0362664 3300047317 Bacteria 961
230 Ga0495676_0114169 3300047321 Bacteria 1976
231 Ga0495680_0466660 3300047322 Bacteria 862
232 Ga0495683_0038531 3300047323 Bacteria 2420
233 Ga0495683_0068560 3300047323 Bacteria 1744
234 Ga0495675_0031143 3300047444 Bacteria 3405
235 Ga0495675_0053497 3300047444 Bacteria 2563
236 Ga0495686_0000135 3300047472 Bacteria 148920
237 Ga0495686_0004725 3300047472 Bacteria 11027
238 Ga0495626_0176151 3300048091 Bacteria 889
239 Ga0496104_0121108 3300048907 Bacteria 2512
240 Ga0496105_0073429 3300048908 Bacteria 2826
241 Ga0496107_0056714 3300048910 Bacteria 2831
242 Ga0496107_0297039 3300048910 Bacteria 1202
243 Ga0496108_0239624 3300048911 Bacteria 1578
244 Ga0496110_0000001 3300048913 Bacteria 232652
245 Ga0496111_0128140 3300048914 Bacteria 1877
246 Ga0496124_0127228 3300048927 Bacteria 2028
247 Ga0496124_0216086 3300048927 Bacteria 1446
248 Ga0496124_0376514 3300048927 Bacteria 994
249 Ga0496126_0037046 3300048929 Bacteria 4555
250 Ga0495682_0002798 3300049460 Bacteria 8058
251 Ga0501033_0096431 3300049570 Bacteria 2161
252 Ga0501036_0614004 3300049572 Bacteria 901
253 Ga0501038_0077255 3300049574 Bacteria 2811
254 Ga0501041_0175229 3300049577 Bacteria 1342
255 Ga0501043_0488040 3300049579 Bacteria 922
256 Ga0501046_0092460 3300049580 Bacteria 2326
257 Ga0501047_0327433 3300049581 Bacteria 1371
258 Ga0501075_0224166 3300049591 Bacteria 1434
259 Ga0501257_024491 3300049686 Bacteria 1434
260 Ga0501262_017231 3300049759 Bacteria 962
261 Ga0501035_0232346 3300049822 Bacteria 1571
262 Ga0501044_0067492 3300049823 Bacteria 3644
263 nmdc:mga00v17_40512_c1 3300050491 Bacteria 2795
264 Ga0495601_0011173 3300053077 Bacteria 5363
265 Ga0495601_0013588 3300053077 Bacteria 4898
266 Ga0500635_0000345 3300053080 Bacteria 15206
267 Ga0495619_0099072 3300053085 Bacteria 1982
268 Ga0500578_0000006 3300053086 Bacteria 234598
269 Ga0500646_0035483 3300053090 Bacteria 1386
270 Ga0500651_0041402 3300053093 Bacteria 2903
271 Ga0500650_0223898 3300053098 Bacteria 850
272 Ga0500556_0015086 3300053104 Bacteria 2375
273 Ga0500562_045634 3300053108 Bacteria 1168
274 Ga0500569_066616 3300053109 Bacteria 1124
275 Ga0500617_018076 3300053124 Bacteria 3066
276 Ga0500623_083231 3300053127 Bacteria 1516
277 Ga0500642_0007656 3300053130 Bacteria 3644
278 Ga0500652_010152 3300053131 Bacteria 3213
279 Ga0500655_020436 3300053133 Bacteria 1237
280 Ga0500658_0029306 3300053134 Bacteria 2140
281 Ga0500577_0092291 3300053142 Bacteria 1225
282 Ga0500604_0029826 3300053151 Bacteria 1592
283 Ga0500622_0000311 3300053156 Bacteria 49557
284 Ga0500637_0007943 3300053178 Bacteria 5327
285 Ga0500637_0038654 3300053178 Bacteria 2690
286 Ga0466962_0008903 3300061719 Bacteria 4812
287 Ga0466962_0092613 3300061719 Bacteria 1449
288 2587725037 2585428057 Bacteria 6737412
289 2587731604 2585428058 Bacteria 6853932
290 2587755413 2585428062 Bacteria 6842168
291 2588292543 2588253510 Bacteria 6901809
292 2643968083 2643221592 Bacteria 6608788
293 2644142561 2643221625 Bacteria 6512927
294 2644276940 2643221648 Bacteria 6521465
295 2644463068 2643221682 Bacteria 6743283
296 2834645016 2834641062 Bacteria 5559922
297 2861695232 2861691609 Bacteria 5628931
298 2867351174 2867346516 Bacteria 7608576
299 3006325355 3006321560 Bacteria 8247479
300 8003401402 8003400568 Bacteria 5535898
301 Ga0070658_10197005
302 JGI25156J39149_1000145
303 JGI25157J39369_1000150
304 JGI25152J39213_1001052
305 JGI25153J46596_10000500
306 rootH1_10081718
307 rootL2_10245500
308 Ga0055539_1000489
309 Ga0055533_1000016
310 Ga0055525_1001034
311 Ga0055535_1000309
312 Ga0055529_1000363
313 Ga0055526_1001517
314 Ga0055540_1014999
315 Ga0065165_1000923
316 Ga0065165_1000977
317 Ga0070658_10033369
318 Ga0068869_100430833
319 Ga0070680_100068122
320 Ga0070660_100053740
321 Ga0070661_100040013
322 Ga0070668_100340524
323 Ga0070671_100203769
324 Ga0070673_100044792
325 Ga0070659_100510253
326 Ga0070713_100020170
327 Ga0070713_100058685
328 Ga0070713_100342359
329 Ga0070665_100002471
330 Ga0068855_100004393
331 Ga0068855_100222951
332 Ga0068855_100344111
333 Ga0068857_100037438
334 Ga0068854_100008569
335 Ga0068856_100000984
336 Ga0068852_100604417
337 Ga0068859_100760065
338 Ga0068866_10050789
339 Ga0068862_100456925
340 Ga0070717_10142506
341 Ga0075364_10055570
342 Ga0070712_100096682
343 Ga0097620_100760190
344 Ga0105240_10022455
345 Ga0105240_10025599
346 Ga0105240_10053535
347 Ga0105243_10196810
348 Ga0105242_10120578
349 Ga0105248_10137955
350 Ga0105237_10032277
351 Ga0105239_10082806
352 Ga0105246_10056111
353 Ga0163162_10059152
354 Ga0163162_10381340
355 Ga0157372_10394147
356 Ga0157375_10662477
357 Ga0157379_10040226
358 Ga0157376_10524831
359 Ga0213872_10019472
360 Ga0213872_10080350
361 Ga0209674_100041
362 Ga0209672_102952
363 Ga0209563_100043
364 Ga0207427_102470
365 Ga0209258_100513
366 Ga0209258_101214
367 Ga0207425_1000651
368 Ga0209646_1000069
369 Ga0209026_1000006
370 Ga0209677_100098
371 Ga0209677_100186
372 Ga0209677_103188
373 Ga0209148_1004130
374 Ga0209759_1000075
375 Ga0209759_1000746
376 Ga0209759_1001013
377 Ga0209759_1010518
378 Ga0209759_1013709
379 Ga0209759_1029156
380 Ga0209129_1000027
381 Ga0209455_1000311
382 Ga0209673_1023873
383 Ga0209564_1000014
384 Ga0209758_1000208
385 Ga0209050_1000198
386 Ga0209256_1015432
387 Ga0209051_1002590
388 Ga0209051_1009058
389 Ga0209051_1011937
390 Ga0207705_10035560
391 Ga0207705_10144325
392 Ga0207705_10177375
393 Ga0207695_10027178
394 Ga0207695_10068197
395 Ga0207695_10080133
396 Ga0207695_10104017
397 Ga0207671_10149938
398 Ga0207693_10143311
399 Ga0207663_10010962
400 Ga0207660_10047087
401 Ga0207657_10063261
402 Ga0207649_10037475
403 Ga0207694_10202043
404 Ga0207700_10049790
405 Ga0207700_10091038
406 Ga0207700_10679703
407 Ga0207690_10026772
408 Ga0207709_10117593
409 Ga0207669_10190974
410 Ga0207689_10009525
411 Ga0207661_10037681
412 Ga0207667_10026152
413 Ga0207667_10112103
414 Ga0207667_10115828
415 Ga0207667_10345837
416 Ga0207712_10494766
417 Ga0207640_10001813
418 Ga0207702_10002113
419 Ga0207641_10290967
420 Ga0207648_10189354
421 Ga0207674_10050943
422 Ga0207674_10257202
423 Ga0207675_100081616
424 Ga0207675_100106055
425 Ga0207698_10270430
426 Ga0209974_10003382
427 Ga0268266_10003012
428 Ga0268265_10165976
429 Ga0265336_10000133
430 Ga0307515_10002873
431 Ga0307515_10021818
432 Ga0265324_10000607
433 Ga0307511_10100395
434 Ga0265760_10068735
435 Ga0265331_10005134
436 Ga0307513_10005765
437 Ga0307509_10407114
438 Ga0307514_10001033
439 Ga0307516_10002476
440 Ga0307516_10003587
441 Ga0307410_10241120
442 Ga0307412_10068768
443 Ga0373931_0004809
444 Ga0316582_0498270
445 Ga0395899_0175670
446 Ga0436364_1315969
447 Ga0395901_0000878
448 Ga0436361_0387956
449 Ga0436361_0635551
450 Ga0436362_0931285
451 Ga0451791_1653870
452 Ga0451793_1692283
453 Ga0451795_1182154
454 Ga0451845_0732888
455 Ga0451853_1759196
456 Ga0451577_0415503
457 Ga0451577_0456247
458 Ga0466969_0030644
459 Ga0466965_0038726
460 Ga0466966_0001715
461 Ga0466966_0010876
462 Ga0466966_0065340
463 Ga0466961_0011302
464 Ga0466961_0082380
465 Ga0466961_0181033
466 Ga0466963_0035585
467 Ga0466963_0142259
468 Ga0453684_0000077
469 Ga0453684_0000882
470 Ga0466971_0004052
471 Ga0466971_0014347
472 Ga0466970_0160299
473 Ga0466957_0014398
474 Ga0466957_0118924
475 Ga0466960_0088335
476 Ga0466959_0019030
477 Ga0466959_0032235
478 Ga0466967_0269885
479 Ga0495592_0004349
480 Ga0495592_0065706
481 Ga0495603_0024571
482 Ga0495629_0110071
483 Ga0495638_0048008
484 Ga0495653_0296170
485 Ga0495580_0010289
486 Ga0495582_0030033
487 Ga0495639_0079361
488 Ga0495662_0156595
489 Ga0495664_0046131
490 Ga0495585_0009398
491 Ga0495594_0153889
492 Ga0495607_0118308
493 Ga0495583_0000081
494 Ga0495606_0001388
495 Ga0495606_0197424
496 Ga0495618_0045493
497 Ga0495620_0026566
498 Ga0495630_0040083
499 Ga0495631_0122797
500 Ga0495632_0001262
501 Ga0495632_0023083
502 Ga0495643_0197184
503 Ga0495666_0030291
504 Ga0495652_0088130
505 Ga0495652_0089181
506 Ga0495665_0017827
507 Ga0495640_0012027
508 Ga0495640_0130968
509 Ga0495586_0094417
510 Ga0495609_0004011
511 Ga0495597_0000335
512 Ga0495668_0202789
513 Ga0495634_0037735
514 Ga0495634_0218131
515 Ga0495625_0001985
516 Ga0495625_0008259
517 Ga0495661_0247394
518 Ga0495623_0043357
519 Ga0495613_0050922
520 Ga0495624_0026762
521 Ga0495624_0129767
522 Ga0495670_0053826
523 Ga0495649_0000579
524 Ga0495649_0046127
525 Ga0495589_0086288
526 Ga0495600_0226948
527 Ga0495604_0047380
528 Ga0495604_0244779
529 Ga0495604_0362664
530 Ga0495676_0114169
531 Ga0495680_0466660
532 Ga0495683_0038531
533 Ga0495683_0068560
534 Ga0495675_0031143
535 Ga0495675_0053497
536 Ga0495686_0000135
537 Ga0495686_0004725
538 Ga0495626_0176151
539 Ga0496104_0121108
540 Ga0496105_0073429
541 Ga0496107_0056714
542 Ga0496107_0297039
543 Ga0496108_0239624
544 Ga0496110_0000001
545 Ga0496111_0128140
546 Ga0496124_0127228
547 Ga0496124_0216086
548 Ga0496124_0376514
549 Ga0496126_0037046
550 Ga0495682_0002798
551 Ga0501033_0096431
552 Ga0501036_0614004
553 Ga0501038_0077255
554 Ga0501041_0175229
555 Ga0501043_0488040
556 Ga0501046_0092460
557 Ga0501047_0327433
558 Ga0501075_0224166
559 Ga0501257_024491
560 Ga0501262_017231
561 Ga0501035_0232346
562 Ga0501044_0067492
563 nmdc:mga00v17_40512_c1
564 Ga0495601_0011173
565 Ga0495601_0013588
566 Ga0500635_0000345
567 Ga0495619_0099072
568 Ga0500578_0000006
569 Ga0500646_0035483
570 Ga0500651_0041402
571 Ga0500650_0223898
572 Ga0500556_0015086
573 Ga0500562_045634
574 Ga0500569_066616
575 Ga0500617_018076
576 Ga0500623_083231
577 Ga0500642_0007656
578 Ga0500652_010152
579 Ga0500655_020436
580 Ga0500658_0029306
581 Ga0500577_0092291
582 Ga0500604_0029826
583 Ga0500622_0000311
584 Ga0500637_0007943
585 Ga0500637_0038654
586 Ga0466962_0008903
587 Ga0466962_0092613
588 2587725037
589 2587731604
590 2587755413
591 2588292543
592 2643968083
593 2644142561
594 2644276940
595 2644463068
596 2834645016
597 2861695232
598 2867351174
599 3006325355
600 8003401402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

48

241

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

298

0.9

PF08659

KR

KR domain

49

226

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

50

225

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.971 46 300
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9703 47 299
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9673 46 300
4i08-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph 0.9662 47 297
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9655 46 296
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 46 300 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 43 223 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 46 300 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 47 300 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9599 45 299 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A540WHA0-F1-model_v4 SDR family oxidoreductase 0.9827 200 299
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.9781 45 226 GO:0006633
GO:0016616
GO:0048038
AF-A0A529ZG08-F1-model_v4 SDR family oxidoreductase 0.9725 170 297 GO:0016491
AF-A0A537VFX7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9684 47 297 GO:0016491
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9679 126 223 GO:0004745
GO:0005829
GO:0016020
GO:0042572

Map