F395178

General Info

Members Datasets Scaffolds Average Seq Length
300 235 287 267

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10197005|Ga0070658_101970052
Length 301
Sequence MTDDTIRSGDMAEAATAIGAIELPTSTTDLAPESIAAALPLALKPTPRRVLVTGATRGIGAAIAQALAGAGWHVTLAGRARAALEEVRVTLPITEGLVHDCVELDVTDAASVARAFAQVHARGGALQALVNNAGAVETAPLVKTAQDTWDRMLAVNLTGVFLCTQAALAPMLAARAGRIVNIASTAGQKGYAYCTAYAAAKHGVLGMTRSLALEVAPQGLSVNAVCPGYTDTDIVRDGVARIVAATGRSQGDAMATFSQSSPLKRLVEPAEVAATVLWLCADAPAAFTGQAMSVSGGEVMN

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
9 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
10 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
11 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
12 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
225 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.33
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.67
Nodule 0
Rhizoplane 3.33
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 11.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000145 3300002705 Bacteria 52488
2 JGI25157J39369_1000150 3300002741 Bacteria 58511
3 JGI25152J39213_1001052 3300002773 Bacteria 13108
4 JGI25153J46596_10000500 3300003215 Bacteria 24942
5 rootH1_10081718 3300003316 Bacteria 1328
6 rootL2_10245500 3300003322 Bacteria 1944
7 Ga0055539_1000489 3300003752 Bacteria 12789
8 Ga0055533_1000016 3300003756 Bacteria 396179
9 Ga0055525_1001034 3300003759 Bacteria 7282
10 Ga0055535_1000309 3300003761 Bacteria 49533
11 Ga0055529_1000363 3300003763 Bacteria 49527
12 Ga0055526_1001517 3300003771 Bacteria 16449
13 Ga0055540_1014999 3300003792 Bacteria 2279
14 Ga0065165_1000923 3300005262 Bacteria 37706
15 Ga0065165_1000977 3300005262 Bacteria 35591
16 Ga0070658_10033369 3300005327 Bacteria 4141
17 Ga0070658_10197005 3300005327 Bacteria 1699
18 Ga0068869_100430833 3300005334 Bacteria 1090
19 Ga0070680_100068122 3300005336 Bacteria 2921
20 Ga0070660_100053740 3300005339 Bacteria 3107
21 Ga0070661_100040013 3300005344 Bacteria 3418
22 Ga0070668_100340524 3300005347 Bacteria 1267
23 Ga0070671_100203769 3300005355 Bacteria 1678
24 Ga0070673_100044792 3300005364 Bacteria 3428
25 Ga0070659_100510253 3300005366 Bacteria 1026
26 Ga0070713_100020170 3300005436 Bacteria 5105
27 Ga0070713_100058685 3300005436 Bacteria 3210
28 Ga0070713_100342359 3300005436 Bacteria 1386
29 Ga0070665_100002471 3300005548 Bacteria 20382
30 Ga0068855_100004393 3300005563 Bacteria 17231
31 Ga0068855_100222951 3300005563 Bacteria 2113
32 Ga0068855_100344111 3300005563 Bacteria 1644
33 Ga0068857_100037438 3300005577 Bacteria 4297
34 Ga0068854_100008569 3300005578 Bacteria 6580
35 Ga0068856_100000984 3300005614 Bacteria 30419
36 Ga0068852_100604417 3300005616 Bacteria 1101
37 Ga0068859_100760065 3300005617 Bacteria 1058
38 Ga0068866_10050789 3300005718 Bacteria 2108
39 Ga0068862_100456925 3300005844 Bacteria 1205
40 Ga0070717_10142506 3300006028 Bacteria 2068
41 Ga0075364_10055570 3300006051 Bacteria 2590
42 Ga0070712_100096682 3300006175 Bacteria 2175
43 Ga0097620_100760190 3300006931 Bacteria 1058
44 Ga0105240_10022455 3300009093 Bacteria 8363
45 Ga0105240_10025599 3300009093 Bacteria 7749
46 Ga0105240_10053535 3300009093 Bacteria 5065
47 Ga0105243_10196810 3300009148 Bacteria 1765
48 Ga0105242_10120578 3300009176 Bacteria 2250
49 Ga0105248_10137955 3300009177 Bacteria 2751
50 Ga0105237_10032277 3300009545 Bacteria 5302
51 Ga0105239_10082806 3300010375 Bacteria 3533
52 Ga0105246_10056111 3300011119 Bacteria 2721
53 Ga0163162_10059152 3300013306 Bacteria 3863
54 Ga0163162_10381340 3300013306 Bacteria 1543
55 Ga0157372_10394147 3300013307 Bacteria 1614
56 Ga0157375_10662477 3300013308 Bacteria 1199
57 Ga0157379_10040226 3300014968 Bacteria 4172
58 Ga0157376_10524831 3300014969 Bacteria 1168
59 Ga0213872_10019472 3300021361 Bacteria 3126
60 Ga0213872_10080350 3300021361 Bacteria 1465
61 Ga0209674_100041 3300025226 Bacteria 396231
62 Ga0209672_102952 3300025228 Bacteria 3764
63 Ga0209563_100043 3300025230 Bacteria 397271
64 Ga0207427_102470 3300025231 Bacteria 4933
65 Ga0209258_100513 3300025242 Bacteria 37337
66 Ga0209258_101214 3300025242 Bacteria 10080
67 Ga0207425_1000651 3300025245 Bacteria 19210
68 Ga0209646_1000069 3300025246 Bacteria 230340
69 Ga0209026_1000006 3300025250 Bacteria 677225
70 Ga0209677_100098 3300025253 Bacteria 96201
71 Ga0209677_100186 3300025253 Bacteria 50478
72 Ga0209677_103188 3300025253 Bacteria 5504
73 Ga0209148_1004130 3300025254 Bacteria 3665
74 Ga0209759_1000075 3300025256 Bacteria 176235
75 Ga0209759_1000746 3300025256 Bacteria 28241
76 Ga0209759_1001013 3300025256 Bacteria 18917
77 Ga0209759_1010518 3300025256 Bacteria 2707
78 Ga0209759_1013709 3300025256 Bacteria 2178
79 Ga0209759_1029156 3300025256 Bacteria 1110
80 Ga0209129_1000027 3300025258 Bacteria 409587
81 Ga0209455_1000311 3300025272 Bacteria 49589
82 Ga0209673_1023873 3300025273 Bacteria 2069
83 Ga0209564_1000014 3300025295 Bacteria 621501
84 Ga0209758_1000208 3300025297 Bacteria 128596
85 Ga0209050_1000198 3300025298 Bacteria 134820
86 Ga0209256_1015432 3300025299 Bacteria 2671
87 Ga0209051_1002590 3300025303 Bacteria 12732
88 Ga0209051_1009058 3300025303 Bacteria 5178
89 Ga0209051_1011937 3300025303 Bacteria 4243
90 Ga0207705_10035560 3300025909 Bacteria 3564
91 Ga0207705_10144325 3300025909 Bacteria 1780
92 Ga0207705_10177375 3300025909 Bacteria 1607
93 Ga0207695_10027178 3300025913 Bacteria 6374
94 Ga0207695_10068197 3300025913 Bacteria 3645
95 Ga0207695_10080133 3300025913 Bacteria 3308
96 Ga0207695_10104017 3300025913 Bacteria 2830
97 Ga0207671_10149938 3300025914 Bacteria 1801
98 Ga0207693_10143311 3300025915 Bacteria 1879
99 Ga0207663_10010962 3300025916 Bacteria 4845
100 Ga0207660_10047087 3300025917 Bacteria 3046
101 Ga0207657_10063261 3300025919 Bacteria 3164
102 Ga0207649_10037475 3300025920 Bacteria 2929
103 Ga0207694_10202043 3300025924 Bacteria 1617
104 Ga0207700_10049790 3300025928 Bacteria 3118
105 Ga0207700_10091038 3300025928 Bacteria 2409
106 Ga0207700_10679703 3300025928 Bacteria 918
107 Ga0207690_10026772 3300025932 Bacteria 3635
108 Ga0207709_10117593 3300025935 Bacteria 1789
109 Ga0207669_10190974 3300025937 Bacteria 1477
110 Ga0207689_10009525 3300025942 Bacteria 8381
111 Ga0207661_10037681 3300025944 Bacteria 3784
112 Ga0207667_10026152 3300025949 Bacteria 6381
113 Ga0207667_10112103 3300025949 Bacteria 2813
114 Ga0207667_10115828 3300025949 Bacteria 2762
115 Ga0207667_10345837 3300025949 Bacteria 1517
116 Ga0207712_10494766 3300025961 Bacteria 1044
117 Ga0207640_10001813 3300025981 Bacteria 11461
118 Ga0207702_10002113 3300026078 Bacteria 19138
119 Ga0207641_10290967 3300026088 Bacteria 1540
120 Ga0207648_10189354 3300026089 Bacteria 1823
121 Ga0207674_10050943 3300026116 Bacteria 4226
122 Ga0207674_10257202 3300026116 Bacteria 1693
123 Ga0207675_100081616 3300026118 Bacteria 3032
124 Ga0207675_100106055 3300026118 Bacteria 2649
125 Ga0207698_10270430 3300026142 Bacteria 1566
126 Ga0209974_10003382 3300027876 Bacteria 5764
127 Ga0268266_10003012 3300028379 Bacteria 17304
128 Ga0268265_10165976 3300028380 Bacteria 1882
129 Ga0265336_10000133 3300028666 Bacteria 53127
130 Ga0307515_10002873 3300028794 Bacteria 36628
131 Ga0307515_10021818 3300028794 Bacteria 11327
132 Ga0265324_10000607 3300029957 Bacteria 24457
133 Ga0307511_10100395 3300030521 Bacteria 1904
134 Ga0265760_10068735 3300031090 Bacteria 1084
135 Ga0265331_10005134 3300031250 Bacteria 7976
136 Ga0307513_10005765 3300031456 Bacteria 16291
137 Ga0307509_10407114 3300031507 Bacteria 1065
138 Ga0307514_10001033 3300031649 Bacteria 40119
139 Ga0307516_10002476 3300031730 Bacteria 24625
140 Ga0307516_10003587 3300031730 Bacteria 19791
141 Ga0307410_10241120 3300031852 Bacteria 1401
142 Ga0307412_10068768 3300031911 Bacteria 2409
143 Ga0373931_0004809 3300035691 Bacteria 6199
144 Ga0316582_0498270 3300036647 Bacteria 839
145 Ga0395899_0175670 3300037312 Bacteria 1506
146 Ga0436364_1315969 3300037853 Bacteria 1618
147 Ga0395901_0000878 3300038443 Bacteria 33132
148 Ga0436361_0387956 3300039447 Bacteria 5681
149 Ga0436361_0635551 3300039447 Bacteria 2986
150 Ga0436362_0931285 3300039453 Bacteria 1203
151 Ga0451791_1653870 3300041451 Bacteria 1314
152 Ga0451793_1692283 3300041452 Bacteria 1468
153 Ga0451795_1182154 3300041456 Bacteria 989
154 Ga0451845_0732888 3300041501 Bacteria 999
155 Ga0451853_1759196 3300041512 Bacteria 1692
156 Ga0451577_0415503 3300042876 Bacteria 1221
157 Ga0451577_0456247 3300042876 Bacteria 1161
158 Ga0466969_0030644 3300044656 Bacteria 2740
159 Ga0466965_0038726 3300044683 Bacteria 2342
160 Ga0466966_0001715 3300044684 Bacteria 14176
161 Ga0466966_0010876 3300044684 Bacteria 6044
162 Ga0466966_0065340 3300044684 Bacteria 2288
163 Ga0466961_0011302 3300044693 Bacteria 5708
164 Ga0466961_0082380 3300044693 Bacteria 2035
165 Ga0466961_0181033 3300044693 Bacteria 1309
166 Ga0466963_0035585 3300044694 Bacteria 3245
167 Ga0466963_0142259 3300044694 Bacteria 1662
168 Ga0453684_0000077 3300044712 Bacteria 435536
169 Ga0453684_0000882 3300044712 Bacteria 100349
170 Ga0466971_0004052 3300044719 Bacteria 6302
171 Ga0466971_0014347 3300044719 Bacteria 3486
172 Ga0466970_0160299 3300044765 Bacteria 1244
173 Ga0466957_0014398 3300044842 Bacteria 4605
174 Ga0466957_0118924 3300044842 Bacteria 1683
175 Ga0466960_0088335 3300044901 Bacteria 1576
176 Ga0466959_0019030 3300045049 Bacteria 5047
177 Ga0466959_0032235 3300045049 Bacteria 3879
178 Ga0466967_0269885 3300045976 Bacteria 1630
179 Ga0495592_0004349 3300046454 Bacteria 10367
180 Ga0495592_0065706 3300046454 Bacteria 2655
181 Ga0495603_0024571 3300046455 Bacteria 3645
182 Ga0495629_0110071 3300046459 Bacteria 1920
183 Ga0495638_0048008 3300046460 Bacteria 2674
184 Ga0495653_0296170 3300046463 Bacteria 1056
185 Ga0495580_0010289 3300046472 Bacteria 7295
186 Ga0495582_0030033 3300046473 Bacteria 2982
187 Ga0495639_0079361 3300046475 Bacteria 1526
188 Ga0495662_0156595 3300046476 Bacteria 1122
189 Ga0495664_0046131 3300046477 Bacteria 2586
190 Ga0495585_0009398 3300046492 Bacteria 5865
191 Ga0495594_0153889 3300046499 Bacteria 1306
192 Ga0495607_0118308 3300046501 Bacteria 1395
193 Ga0495583_0000081 3300046506 Bacteria 168304
194 Ga0495606_0001388 3300046507 Bacteria 32749
195 Ga0495606_0197424 3300046507 Bacteria 1149
196 Ga0495618_0045493 3300046514 Bacteria 2769
197 Ga0495620_0026566 3300046515 Bacteria 2722
198 Ga0495630_0040083 3300046517 Bacteria 3500
199 Ga0495631_0122797 3300046518 Bacteria 1117
200 Ga0495632_0001262 3300046519 Bacteria 21459
201 Ga0495632_0023083 3300046519 Bacteria 3326
202 Ga0495643_0197184 3300046522 Bacteria 968
203 Ga0495666_0030291 3300046526 Bacteria 2656
204 Ga0495652_0088130 3300046529 Bacteria 2544
205 Ga0495652_0089181 3300046529 Bacteria 2525
206 Ga0495665_0017827 3300046531 Bacteria 3816
207 Ga0495640_0012027 3300046533 Bacteria 6631
208 Ga0495640_0130968 3300046533 Bacteria 1623
209 Ga0495586_0094417 3300046535 Bacteria 1654
210 Ga0495609_0004011 3300046538 Bacteria 8217
211 Ga0495597_0000335 3300046542 Bacteria 42105
212 Ga0495668_0202789 3300046616 Bacteria 1086
213 Ga0495634_0037735 3300046642 Bacteria 3299
214 Ga0495634_0218131 3300046642 Bacteria 1178
215 Ga0495625_0001985 3300046660 Bacteria 23083
216 Ga0495625_0008259 3300046660 Bacteria 8900
217 Ga0495661_0247394 3300046665 Bacteria 911
218 Ga0495623_0043357 3300046679 Bacteria 2863
219 Ga0495613_0050922 3300046689 Bacteria 3053
220 Ga0495624_0026762 3300046690 Bacteria 3779
221 Ga0495624_0129767 3300046690 Bacteria 1546
222 Ga0495670_0053826 3300046691 Bacteria 2015
223 Ga0495649_0000579 3300046694 Bacteria 30684
224 Ga0495649_0046127 3300046694 Bacteria 2374
225 Ga0495589_0086288 3300046794 Bacteria 1524
226 Ga0495600_0226948 3300046809 Bacteria 1193
227 Ga0495604_0047380 3300047317 Bacteria 3347
228 Ga0495604_0244779 3300047317 Bacteria 1224
229 Ga0495604_0362664 3300047317 Bacteria 961
230 Ga0495676_0114169 3300047321 Bacteria 1976
231 Ga0495680_0466660 3300047322 Bacteria 862
232 Ga0495683_0038531 3300047323 Bacteria 2420
233 Ga0495683_0068560 3300047323 Bacteria 1744
234 Ga0495675_0031143 3300047444 Bacteria 3405
235 Ga0495675_0053497 3300047444 Bacteria 2563
236 Ga0495686_0000135 3300047472 Bacteria 148920
237 Ga0495686_0004725 3300047472 Bacteria 11027
238 Ga0495626_0176151 3300048091 Bacteria 889
239 Ga0496104_0121108 3300048907 Bacteria 2512
240 Ga0496105_0073429 3300048908 Bacteria 2826
241 Ga0496107_0056714 3300048910 Bacteria 2831
242 Ga0496107_0297039 3300048910 Bacteria 1202
243 Ga0496108_0239624 3300048911 Bacteria 1578
244 Ga0496110_0000001 3300048913 Bacteria 232652
245 Ga0496111_0128140 3300048914 Bacteria 1877
246 Ga0496124_0127228 3300048927 Bacteria 2028
247 Ga0496124_0216086 3300048927 Bacteria 1446
248 Ga0496124_0376514 3300048927 Bacteria 994
249 Ga0496126_0037046 3300048929 Bacteria 4555
250 Ga0495682_0002798 3300049460 Bacteria 8058
251 Ga0501033_0096431 3300049570 Bacteria 2161
252 Ga0501036_0614004 3300049572 Bacteria 901
253 Ga0501038_0077255 3300049574 Bacteria 2811
254 Ga0501041_0175229 3300049577 Bacteria 1342
255 Ga0501043_0488040 3300049579 Bacteria 922
256 Ga0501046_0092460 3300049580 Bacteria 2326
257 Ga0501047_0327433 3300049581 Bacteria 1371
258 Ga0501075_0224166 3300049591 Bacteria 1434
259 Ga0501257_024491 3300049686 Bacteria 1434
260 Ga0501262_017231 3300049759 Bacteria 962
261 Ga0501035_0232346 3300049822 Bacteria 1571
262 Ga0501044_0067492 3300049823 Bacteria 3644
263 nmdc:mga00v17_40512_c1 3300050491 Bacteria 2795
264 Ga0495601_0011173 3300053077 Bacteria 5363
265 Ga0495601_0013588 3300053077 Bacteria 4898
266 Ga0500635_0000345 3300053080 Bacteria 15206
267 Ga0495619_0099072 3300053085 Bacteria 1982
268 Ga0500578_0000006 3300053086 Bacteria 234598
269 Ga0500646_0035483 3300053090 Bacteria 1386
270 Ga0500651_0041402 3300053093 Bacteria 2903
271 Ga0500650_0223898 3300053098 Bacteria 850
272 Ga0500556_0015086 3300053104 Bacteria 2375
273 Ga0500562_045634 3300053108 Bacteria 1168
274 Ga0500569_066616 3300053109 Bacteria 1124
275 Ga0500617_018076 3300053124 Bacteria 3066
276 Ga0500623_083231 3300053127 Bacteria 1516
277 Ga0500642_0007656 3300053130 Bacteria 3644
278 Ga0500652_010152 3300053131 Bacteria 3213
279 Ga0500655_020436 3300053133 Bacteria 1237
280 Ga0500658_0029306 3300053134 Bacteria 2140
281 Ga0500577_0092291 3300053142 Bacteria 1225
282 Ga0500604_0029826 3300053151 Bacteria 1592
283 Ga0500622_0000311 3300053156 Bacteria 49557
284 Ga0500637_0007943 3300053178 Bacteria 5327
285 Ga0500637_0038654 3300053178 Bacteria 2690
286 Ga0466962_0008903 3300061719 Bacteria 4812
287 Ga0466962_0092613 3300061719 Bacteria 1449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0247394 Ga0495661_0247394_250_900 212
2 3300048091 Ga0495626_0176151 Ga0495626_0176151_17_667 212
3 3300044765 Ga0466970_0160299 Ga0466970_0160299_543_1196 216
4 3300046501 Ga0495607_0118308 Ga0495607_0118308_10_687 221
5 3300047317 Ga0495604_0362664 Ga0495604_0362664_146_823 224
6 3300046518 Ga0495631_0122797 Ga0495631_0122797_266_1027 226
7 3300048910 Ga0496107_0056714 Ga0496107_0056714_863_1561 228
8 3300005355 Ga0070671_100203769 Ga0070671_1002037692 232
9 3300005617 Ga0068859_100760065 Ga0068859_1007600652 232
10 3300005718 Ga0068866_10050789 Ga0068866_100507892 232
11 3300005844 Ga0068862_100456925 Ga0068862_1004569252 232
12 3300006931 Ga0097620_100760190 Ga0097620_1007601902 232
13 3300009148 Ga0105243_10196810 Ga0105243_101968103 232
14 3300009176 Ga0105242_10120578 Ga0105242_101205782 232
15 3300009177 Ga0105248_10137955 Ga0105248_101379553 232
16 3300013308 Ga0157375_10662477 Ga0157375_106624772 232
17 3300025937 Ga0207669_10190974 Ga0207669_101909742 232
18 3300025961 Ga0207712_10494766 Ga0207712_104947662 232
19 3300026088 Ga0207641_10290967 Ga0207641_102909672 232
20 3300026089 Ga0207648_10189354 Ga0207648_101893543 232
21 3300026118 Ga0207675_100081616 Ga0207675_1000816162 232
22 3300028380 Ga0268265_10165976 Ga0268265_101659762 232
23 3300049580 Ga0501046_0092460 Ga0501046_0092460_179_997 232
24 3300049581 Ga0501047_0327433 Ga0501047_0327433_353_1180 238
25 3300046538 Ga0495609_0004011 Ga0495609_0004011_5912_6682 240
26 3300046542 Ga0495597_0000335 Ga0495597_0000335_1932_2702 240
27 3300002773 JGI25152J39213_1001052 JGI25152J39213_10010528 242
28 3300003215 JGI25153J46596_10000500 JGI25153J46596_1000050018 242
29 3300003771 Ga0055526_1001517 Ga0055526_100151714 242
30 3300025245 Ga0207425_1000651 Ga0207425_10006518 242
31 3300025258 Ga0209129_1000027 Ga0209129_1000027248 242
32 3300025295 Ga0209564_1000014 Ga0209564_1000014534 242
33 3300025297 Ga0209758_1000208 Ga0209758_100020889 242
34 3300025299 Ga0209256_1015432 Ga0209256_10154322 242
35 3300036647 Ga0316582_0498270 Ga0316582_0498270_23_793 243
36 3300046499 Ga0495594_0153889 Ga0495594_0153889_40_867 243
37 3300046533 Ga0495640_0130968 Ga0495640_0130968_108_935 243
38 3300047317 Ga0495604_0047380 Ga0495604_0047380_638_1465 243
39 3300005347 Ga0070668_100340524 Ga0070668_1003405241 245
40 3300013306 Ga0163162_10381340 Ga0163162_103813402 245
41 iso_pu_bacteria 2585428057 2587725037 245
42 3300031852 Ga0307410_10241120 Ga0307410_102411202 246
43 3300031911 Ga0307412_10068768 Ga0307412_100687683 246
44 3300049579 Ga0501043_0488040 Ga0501043_0488040_166_906 246
45 3300005262 Ga0065165_1000977 Ga0065165_100097713 247
46 3300046507 Ga0495606_0197424 Ga0495606_0197424_153_908 247
47 3300046616 Ga0495668_0202789 Ga0495668_0202789_217_972 247
48 3300046691 Ga0495670_0053826 Ga0495670_0053826_1208_1963 247
49 3300046694 Ga0495649_0046127 Ga0495649_0046127_436_1191 247
50 3300047323 Ga0495683_0068560 Ga0495683_0068560_336_1091 247
51 3300047472 Ga0495686_0000135 Ga0495686_0000135_62283_63038 247
52 3300048927 Ga0496124_0376514 Ga0496124_0376514_11_766 247
53 3300049460 Ga0495682_0002798 Ga0495682_0002798_1890_2645 247
54 3300025909 Ga0207705_10177375 Ga0207705_101773751 248
55 3300048910 Ga0496107_0297039 Ga0496107_0297039_290_1036 248
56 3300048913 Ga0496110_0000001 Ga0496110_0000001_170075_170833 248
57 3300048914 Ga0496111_0128140 Ga0496111_0128140_806_1564 248
58 3300048927 Ga0496124_0127228 Ga0496124_0127228_601_1359 248
59 iso_pu_bacteria 2585428062 2587755413 248
60 iso_pu_bacteria 2643221592 2643968083 248
61 iso_pu_bacteria 2643221625 2644142561 248
62 iso_pu_bacteria 2643221648 2644276940 248
63 iso_pu_bacteria 2867346516 2867351174 249
64 3300013307 Ga0157372_10394147 Ga0157372_103941472 250
65 3300041451 Ga0451791_1653870 Ga0451791_1653870_27_779 250
66 3300041452 Ga0451793_1692283 Ga0451793_1692283_626_1378 250
67 3300041456 Ga0451795_1182154 Ga0451795_1182154_104_856 250
68 3300041512 Ga0451853_1759196 Ga0451853_1759196_74_826 250
69 3300046460 Ga0495638_0048008 Ga0495638_0048008_735_1487 250
70 3300046519 Ga0495632_0001262 Ga0495632_0001262_16678_17430 250
71 3300049686 Ga0501257_024491 Ga0501257_024491_318_1070 250
72 3300049759 Ga0501262_017231 Ga0501262_017231_101_853 250
73 3300053090 Ga0500646_0035483 Ga0500646_0035483_376_1128 250
74 3300053093 Ga0500651_0041402 Ga0500651_0041402_1523_2275 250
75 3300053098 Ga0500650_0223898 Ga0500650_0223898_59_811 250
76 3300053109 Ga0500569_066616 Ga0500569_066616_228_980 250
77 3300053127 Ga0500623_083231 Ga0500623_083231_168_920 250
78 3300053130 Ga0500642_0007656 Ga0500642_0007656_100_852 250
79 3300053131 Ga0500652_010152 Ga0500652_010152_1795_2547 250
80 3300053133 Ga0500655_020436 Ga0500655_020436_267_1019 250
81 3300053142 Ga0500577_0092291 Ga0500577_0092291_224_976 250
82 3300053151 Ga0500604_0029826 Ga0500604_0029826_255_1007 250
83 3300053156 Ga0500622_0000311 Ga0500622_0000311_28574_29326 250
84 iso_pu_bacteria 2861691609 2861695232 250
85 3300031649 Ga0307514_10001033 Ga0307514_1000103322 251
86 3300045976 Ga0466967_0269885 Ga0466967_0269885_641_1429 251
87 3300046463 Ga0495653_0296170 Ga0495653_0296170_63_830 251
88 3300046472 Ga0495580_0010289 Ga0495580_0010289_4981_5748 251
89 3300046473 Ga0495582_0030033 Ga0495582_0030033_762_1529 251
90 3300046517 Ga0495630_0040083 Ga0495630_0040083_2020_2787 251
91 3300046526 Ga0495666_0030291 Ga0495666_0030291_342_1109 251
92 3300046529 Ga0495652_0089181 Ga0495652_0089181_1478_2245 251
93 3300046531 Ga0495665_0017827 Ga0495665_0017827_2199_2966 251
94 3300046535 Ga0495586_0094417 Ga0495586_0094417_661_1428 251
95 3300046642 Ga0495634_0037735 Ga0495634_0037735_1920_2687 251
96 3300046679 Ga0495623_0043357 Ga0495623_0043357_172_939 251
97 3300046690 Ga0495624_0129767 Ga0495624_0129767_479_1246 251
98 3300047317 Ga0495604_0244779 Ga0495604_0244779_10_777 251
99 3300047444 Ga0495675_0031143 Ga0495675_0031143_2359_3126 251
100 iso_pu_bacteria 2588253510 2588292543 251
101 3300005262 Ga0065165_1000923 Ga0065165_100092324 252
102 3300025273 Ga0209673_1023873 Ga0209673_10238732 252
103 3300025298 Ga0209050_1000198 Ga0209050_100019875 252
104 3300028794 Ga0307515_10021818 Ga0307515_100218189 252
105 3300031730 Ga0307516_10002476 Ga0307516_1000247620 252
106 3300053086 Ga0500578_0000006 Ga0500578_0000006_205898_206755 252
107 iso_pu_bacteria 2585428058 2587731604 252
108 3300028794 Ga0307515_10002873 Ga0307515_1000287329 253
109 3300031456 Ga0307513_10005765 Ga0307513_1000576512 253
110 3300041501 Ga0451845_0732888 Ga0451845_0732888_85_858 253
111 3300044684 Ga0466966_0010876 Ga0466966_0010876_2622_3395 253
112 3300044693 Ga0466961_0181033 Ga0466961_0181033_292_1065 253
113 3300044694 Ga0466963_0142259 Ga0466963_0142259_581_1354 253
114 3300044719 Ga0466971_0014347 Ga0466971_0014347_429_1202 253
115 3300044842 Ga0466957_0014398 Ga0466957_0014398_2791_3564 253
116 3300044901 Ga0466960_0088335 Ga0466960_0088335_97_870 253
117 3300045049 Ga0466959_0032235 Ga0466959_0032235_2234_3007 253
118 3300046515 Ga0495620_0026566 Ga0495620_0026566_361_1134 253
119 3300046519 Ga0495632_0023083 Ga0495632_0023083_156_929 253
120 3300046522 Ga0495643_0197184 Ga0495643_0197184_34_807 253
121 3300046660 Ga0495625_0001985 Ga0495625_0001985_18190_18963 253
122 3300053077 Ga0495601_0013588 Ga0495601_0013588_3726_4499 253
123 3300053085 Ga0495619_0099072 Ga0495619_0099072_964_1737 253
124 3300061719 Ga0466962_0092613 Ga0466962_0092613_150_923 253
125 3300021361 Ga0213872_10019472 Ga0213872_100194722 254
126 3300021361 Ga0213872_10080350 Ga0213872_100803502 254
127 3300039447 Ga0436361_0387956 Ga0436361_0387956_1834_2601 254
128 3300039447 Ga0436361_0635551 Ga0436361_0635551_70_837 254
129 3300046454 Ga0495592_0004349 Ga0495592_0004349_3477_4328 254
130 3300046455 Ga0495603_0024571 Ga0495603_0024571_449_1300 254
131 3300046459 Ga0495629_0110071 Ga0495629_0110071_252_1103 254
132 3300046476 Ga0495662_0156595 Ga0495662_0156595_128_979 254
133 3300046477 Ga0495664_0046131 Ga0495664_0046131_327_1178 254
134 3300046514 Ga0495618_0045493 Ga0495618_0045493_1485_2336 254
135 3300046529 Ga0495652_0088130 Ga0495652_0088130_1324_2175 254
136 3300046533 Ga0495640_0012027 Ga0495640_0012027_1171_2022 254
137 3300046642 Ga0495634_0218131 Ga0495634_0218131_281_1132 254
138 3300046689 Ga0495613_0050922 Ga0495613_0050922_964_1815 254
139 3300046690 Ga0495624_0026762 Ga0495624_0026762_1802_2653 254
140 3300046809 Ga0495600_0226948 Ga0495600_0226948_267_1118 254
141 3300047321 Ga0495676_0114169 Ga0495676_0114169_840_1691 254
142 3300047322 Ga0495680_0466660 Ga0495680_0466660_34_813 254
143 3300047444 Ga0495675_0053497 Ga0495675_0053497_1636_2487 254
144 3300003316 rootH1_10081718 rootH1_100817182 255
145 3300003322 rootL2_10245500 rootL2_102455002 255
146 3300003792 Ga0055540_1014999 Ga0055540_10149992 255
147 3300025303 Ga0209051_1002590 Ga0209051_10025903 255
148 3300025935 Ga0207709_10117593 Ga0207709_101175932 255
149 3300031507 Ga0307509_10407114 Ga0307509_104071141 255
150 3300035691 Ga0373931_0004809 Ga0373931_0004809_4490_5272 255
151 3300037853 Ga0436364_1315969 Ga0436364_1315969_349_1131 255
152 3300046492 Ga0495585_0009398 Ga0495585_0009398_300_1082 255
153 3300053108 Ga0500562_045634 Ga0500562_045634_256_1122 255
154 3300013306 Ga0163162_10059152 Ga0163162_100591522 256
155 3300025303 Ga0209051_1011937 Ga0209051_10119374 256
156 3300042876 Ga0451577_0456247 Ga0451577_0456247_348_1118 256
157 3300048911 Ga0496108_0239624 Ga0496108_0239624_118_903 256
158 3300049577 Ga0501041_0175229 Ga0501041_0175229_57_827 256
159 3300049591 Ga0501075_0224166 Ga0501075_0224166_569_1339 256
160 iso_pu_bacteria 2643221682 2644463068 256
161 3300044684 Ga0466966_0065340 Ga0466966_0065340_772_1548 257
162 3300044693 Ga0466961_0082380 Ga0466961_0082380_480_1256 257
163 3300044719 Ga0466971_0004052 Ga0466971_0004052_1180_1956 257
164 3300049570 Ga0501033_0096431 Ga0501033_0096431_906_1685 257
165 3300049574 Ga0501038_0077255 Ga0501038_0077255_1226_2005 257
166 3300049822 Ga0501035_0232346 Ga0501035_0232346_339_1118 257
167 3300049823 Ga0501044_0067492 Ga0501044_0067492_2200_2979 257
168 3300053104 Ga0500556_0015086 Ga0500556_0015086_60_833 257
169 3300053124 Ga0500617_018076 Ga0500617_018076_1585_2358 257
170 3300053134 Ga0500658_0029306 Ga0500658_0029306_468_1241 257
171 3300061719 Ga0466962_0008903 Ga0466962_0008903_500_1276 257
172 3300006028 Ga0070717_10142506 Ga0070717_101425062 258
173 3300031090 Ga0265760_10068735 Ga0265760_100687352 258
174 iso_pu_bacteria 2834641062 2834645016 258
175 iso_pu_bacteria 8003400568 8003401402 258
176 3300005436 Ga0070713_100058685 Ga0070713_1000586852 259
177 3300006175 Ga0070712_100096682 Ga0070712_1000966822 259
178 3300025915 Ga0207693_10143311 Ga0207693_101433112 259
179 3300025916 Ga0207663_10010962 Ga0207663_100109622 259
180 3300025928 Ga0207700_10049790 Ga0207700_100497903 259
181 3300046454 Ga0495592_0065706 Ga0495592_0065706_1770_2555 259
182 3300048907 Ga0496104_0121108 Ga0496104_0121108_472_1257 259
183 3300048908 Ga0496105_0073429 Ga0496105_0073429_454_1239 259
184 3300053077 Ga0495601_0011173 Ga0495601_0011173_3908_4693 259
185 3300048927 Ga0496124_0216086 Ga0496124_0216086_543_1328 260
186 3300005336 Ga0070680_100068122 Ga0070680_1000681222 261
187 3300005436 Ga0070713_100020170 Ga0070713_1000201704 261
188 3300005436 Ga0070713_100342359 Ga0070713_1003423592 261
189 3300005548 Ga0070665_100002471 Ga0070665_10000247113 261
190 3300009093 Ga0105240_10025599 Ga0105240_100255997 261
191 3300009093 Ga0105240_10053535 Ga0105240_100535352 261
192 3300009545 Ga0105237_10032277 Ga0105237_100322774 261
193 3300014968 Ga0157379_10040226 Ga0157379_100402264 261
194 3300025913 Ga0207695_10068197 Ga0207695_100681974 261
195 3300025913 Ga0207695_10080133 Ga0207695_100801332 261
196 3300025914 Ga0207671_10149938 Ga0207671_101499383 261
197 3300025917 Ga0207660_10047087 Ga0207660_100470872 261
198 3300025928 Ga0207700_10091038 Ga0207700_100910382 261
199 3300025928 Ga0207700_10679703 Ga0207700_106797031 261
200 3300025944 Ga0207661_10037681 Ga0207661_100376813 261
201 3300028379 Ga0268266_10003012 Ga0268266_1000301214 261
202 3300031250 Ga0265331_10005134 Ga0265331_100051345 261
203 3300048929 Ga0496126_0037046 Ga0496126_0037046_415_1200 261
204 3300053178 Ga0500637_0007943 Ga0500637_0007943_2434_3219 261
205 3300053178 Ga0500637_0038654 Ga0500637_0038654_523_1308 261
206 3300042876 Ga0451577_0415503 Ga0451577_0415503_143_937 263
207 3300044712 Ga0453684_0000882 Ga0453684_0000882_48602_49396 263
208 3300044712 Ga0453684_0000077 Ga0453684_0000077_375777_376574 264
209 3300039453 Ga0436362_0931285 Ga0436362_0931285_76_873 265
210 3300049572 Ga0501036_0614004 Ga0501036_0614004_62_865 265
211 iso_pu_bacteria 3006321560 3006325355 265
212 3300005364 Ga0070673_100044792 Ga0070673_1000447922 273
213 3300031730 Ga0307516_10003587 Ga0307516_1000358711 273
214 3300006051 Ga0075364_10055570 Ga0075364_100555702 275
215 3300050491 nmdc:mga00v17_40512_c1 nmdc:mga00v17_40512_c1_804_1649 275
216 3300025256 Ga0209759_1029156 Ga0209759_10291562 281
217 3300046475 Ga0495639_0079361 Ga0495639_0079361_222_1127 281
218 3300027876 Ga0209974_10003382 Ga0209974_100033823 284
219 3300037312 Ga0395899_0175670 Ga0395899_0175670_99_1001 287
220 3300038443 Ga0395901_0000878 Ga0395901_0000878_24915_25817 287
221 3300025303 Ga0209051_1009058 Ga0209051_10090584 288
222 3300025253 Ga0209677_100186 Ga0209677_10018613 291
223 3300005616 Ga0068852_100604417 Ga0068852_1006044172 294
224 3300026142 Ga0207698_10270430 Ga0207698_102704301 294
225 3300044656 Ga0466969_0030644 Ga0466969_0030644_770_1672 296
226 3300044683 Ga0466965_0038726 Ga0466965_0038726_900_1802 296
227 3300044684 Ga0466966_0001715 Ga0466966_0001715_565_1467 296
228 3300044693 Ga0466961_0011302 Ga0466961_0011302_4760_5662 296
229 3300044694 Ga0466963_0035585 Ga0466963_0035585_292_1194 296
230 3300045049 Ga0466959_0019030 Ga0466959_0019030_2855_3757 296
231 3300047472 Ga0495686_0004725 Ga0495686_0004725_5465_6364 297
232 3300003761 Ga0055535_1000309 Ga0055535_100030938 299
233 3300003763 Ga0055529_1000363 Ga0055529_100036313 299
234 3300025228 Ga0209672_102952 Ga0209672_1029521 299
235 3300025242 Ga0209258_100513 Ga0209258_10051326 299
236 3300025254 Ga0209148_1004130 Ga0209148_10041302 299
237 3300025256 Ga0209759_1001013 Ga0209759_10010135 299
238 3300025272 Ga0209455_1000311 Ga0209455_100031138 299
239 3300025909 Ga0207705_10035560 Ga0207705_100355602 299
240 3300025949 Ga0207667_10112103 Ga0207667_101121032 299
241 3300026116 Ga0207674_10257202 Ga0207674_102572022 299
242 3300053080 Ga0500635_0000345 Ga0500635_0000345_6911_7813 299
243 3300002705 JGI25156J39149_1000145 JGI25156J39149_100014536 300
244 3300002741 JGI25157J39369_1000150 JGI25157J39369_100015013 300
245 3300003752 Ga0055539_1000489 Ga0055539_100048912 300
246 3300003756 Ga0055533_1000016 Ga0055533_100001692 300
247 3300003759 Ga0055525_1001034 Ga0055525_10010342 300
248 3300005327 Ga0070658_10033369 Ga0070658_100333692 300
249 3300005327 Ga0070658_10197005 Ga0070658_101970052 300
250 3300005334 Ga0068869_100430833 Ga0068869_1004308331 300
251 3300005339 Ga0070660_100053740 Ga0070660_1000537402 300
252 3300005344 Ga0070661_100040013 Ga0070661_1000400132 300
253 3300005366 Ga0070659_100510253 Ga0070659_1005102531 300
254 3300005563 Ga0068855_100004393 Ga0068855_10000439313 300
255 3300005563 Ga0068855_100222951 Ga0068855_1002229513 300
256 3300005563 Ga0068855_100344111 Ga0068855_1003441112 300
257 3300005577 Ga0068857_100037438 Ga0068857_1000374382 300
258 3300005578 Ga0068854_100008569 Ga0068854_1000085696 300
259 3300005614 Ga0068856_100000984 Ga0068856_10000098418 300
260 3300009093 Ga0105240_10022455 Ga0105240_100224555 300
261 3300010375 Ga0105239_10082806 Ga0105239_100828062 300
262 3300011119 Ga0105246_10056111 Ga0105246_100561112 300
263 3300014969 Ga0157376_10524831 Ga0157376_105248311 300
264 3300025226 Ga0209674_100041 Ga0209674_100041292 300
265 3300025230 Ga0209563_100043 Ga0209563_100043292 300
266 3300025231 Ga0207427_102470 Ga0207427_1024701 300
267 3300025242 Ga0209258_101214 Ga0209258_1012142 300
268 3300025246 Ga0209646_1000069 Ga0209646_100006913 300
269 3300025250 Ga0209026_1000006 Ga0209026_1000006108 300
270 3300025253 Ga0209677_100098 Ga0209677_10009827 300
271 3300025253 Ga0209677_103188 Ga0209677_1031884 300
272 3300025256 Ga0209759_1000075 Ga0209759_100007513 300
273 3300025256 Ga0209759_1000746 Ga0209759_100074610 300
274 3300025256 Ga0209759_1010518 Ga0209759_10105182 300
275 3300025256 Ga0209759_1013709 Ga0209759_10137093 300
276 3300025909 Ga0207705_10144325 Ga0207705_101443251 300
277 3300025913 Ga0207695_10027178 Ga0207695_100271784 300
278 3300025913 Ga0207695_10104017 Ga0207695_101040173 300
279 3300025919 Ga0207657_10063261 Ga0207657_100632612 300
280 3300025920 Ga0207649_10037475 Ga0207649_100374752 300
281 3300025924 Ga0207694_10202043 Ga0207694_102020432 300
282 3300025932 Ga0207690_10026772 Ga0207690_100267724 300
283 3300025942 Ga0207689_10009525 Ga0207689_100095256 300
284 3300025949 Ga0207667_10026152 Ga0207667_100261525 300
285 3300025949 Ga0207667_10115828 Ga0207667_101158282 300
286 3300025949 Ga0207667_10345837 Ga0207667_103458372 300
287 3300025981 Ga0207640_10001813 Ga0207640_100018135 300
288 3300026078 Ga0207702_10002113 Ga0207702_100021136 300
289 3300026116 Ga0207674_10050943 Ga0207674_100509434 300
290 3300026118 Ga0207675_100106055 Ga0207675_1001060553 300
291 3300028666 Ga0265336_10000133 Ga0265336_100001338 300
292 3300029957 Ga0265324_10000607 Ga0265324_1000060713 300
293 3300030521 Ga0307511_10100395 Ga0307511_101003951 300
294 3300044842 Ga0466957_0118924 Ga0466957_0118924_157_1059 300
295 3300046506 Ga0495583_0000081 Ga0495583_0000081_161325_162227 300
296 3300046507 Ga0495606_0001388 Ga0495606_0001388_7694_8596 300
297 3300046660 Ga0495625_0008259 Ga0495625_0008259_5486_6388 300
298 3300046694 Ga0495649_0000579 Ga0495649_0000579_15142_16044 300
299 3300046794 Ga0495589_0086288 Ga0495589_0086288_462_1364 300
300 3300047323 Ga0495683_0038531 Ga0495683_0038531_549_1451 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

48

241

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

298

0.9

PF08659

KR

KR domain

49

226

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

50

225

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.971 46 300
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9703 47 299
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9673 46 300
4i08-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph 0.9662 47 297
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9655 46 296
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 46 300 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 43 223 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 46 300 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 47 300 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9599 45 299 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A540WHA0-F1-model_v4 SDR family oxidoreductase 0.9827 200 299
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.9781 45 226 GO:0006633
GO:0016616
GO:0048038
AF-A0A529ZG08-F1-model_v4 SDR family oxidoreductase 0.9725 170 297 GO:0016491
AF-A0A537VFX7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9684 47 297 GO:0016491
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9679 126 223 GO:0004745
GO:0005829
GO:0016020
GO:0042572

Feature Viewer

pLDDT pTM Quality
85.16 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map