F394808

General Info

Members Datasets Scaffolds Average Seq Length
299 165 598 89

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001049|Ga0111539_1000104942
Length 96
Sequence MLYMIIEHFREGPVPVYRRFREKGRMAPEGLRYVNSWVTTDLNKCYQVMECENPDLIRQWIQNWEDLADFEIIPVVTSAQAAASAVAVGPADPSKQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
99 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
154 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
159 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
160 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 0.33
Rhizosphere 89.63
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10001049 3300009094 Bacteria 36370
2 JGI25153J46596_10000048 3300003215 Bacteria 141500
3 JGI25153J46596_10000356 3300003215 Bacteria 31589
4 rootH2_10126613 3300003320 Bacteria 1106
5 Ga0065715_11073925 3300005293 Bacteria 526
6 Ga0070661_100280984 3300005344 Bacteria 1291
7 Ga0070668_101511517 3300005347 Bacteria 614
8 Ga0070709_10392813 3300005434 Bacteria 1034
9 Ga0070714_100024234 3300005435 Bacteria 4992
10 Ga0070700_100096117 3300005441 Bacteria 1943
11 Ga0070694_100024467 3300005444 Bacteria 3897
12 Ga0070694_100024794 3300005444 Bacteria 3874
13 Ga0070694_101371801 3300005444 Bacteria 596
14 Ga0070708_100066382 3300005445 Bacteria 3239
15 Ga0070708_100450284 3300005445 Bacteria 1214
16 Ga0070708_100503241 3300005445 Unclassified 1143
17 Ga0070663_100011689 3300005455 Bacteria 5521
18 Ga0070706_100109381 3300005467 Bacteria 2572
19 Ga0070706_100293598 3300005467 Bacteria 1517
20 Ga0070706_100711558 3300005467 Bacteria 931
21 Ga0070706_101787515 3300005467 Bacteria 559
22 Ga0070707_100124592 3300005468 Bacteria 2503
23 Ga0070707_100151180 3300005468 Bacteria 2260
24 Ga0070707_100970130 3300005468 Bacteria 815
25 Ga0070699_100275801 3300005518 Bacteria 1506
26 Ga0070699_100725101 3300005518 Unclassified 909
27 Ga0070679_100359937 3300005530 Bacteria 1402
28 Ga0070697_100388086 3300005536 Bacteria 1210
29 Ga0070697_100461669 3300005536 Bacteria 1107
30 Ga0070697_101305464 3300005536 Bacteria 647
31 Ga0068853_101219205 3300005539 Bacteria 727
32 Ga0070695_100001203 3300005545 Bacteria 14250
33 Ga0070695_100023568 3300005545 Bacteria 3785
34 Ga0070696_100884654 3300005546 Bacteria 740
35 Ga0070696_101331460 3300005546 Unclassified 610
36 Ga0070693_101361867 3300005547 Bacteria 550
37 Ga0068856_100910559 3300005614 Bacteria 898
38 Ga0068852_101543349 3300005616 Unclassified 686
39 Ga0068864_101811231 3300005618 Bacteria 616
40 Ga0068861_100074258 3300005719 Bacteria 2644
41 Ga0068858_101436103 3300005842 Bacteria 680
42 Ga0068862_101522826 3300005844 Bacteria 674
43 Ga0081455_10330460 3300005937 Bacteria 1082
44 Ga0081539_10376821 3300005985 Bacteria 592
45 Ga0070717_10119919 3300006028 Bacteria 2252
46 Ga0070716_101525966 3300006173 Bacteria 547
47 Ga0075428_100018629 3300006844 Bacteria 7673
48 Ga0075428_100333447 3300006844 Bacteria 1629
49 Ga0075430_100005497 3300006846 Bacteria 10708
50 Ga0075430_100114580 3300006846 Bacteria 2246
51 Ga0075430_100138505 3300006846 Bacteria 2027
52 Ga0075430_100317427 3300006846 Bacteria 1288
53 Ga0075430_100820140 3300006846 Bacteria 767
54 Ga0075431_100001917 3300006847 Bacteria 19765
55 Ga0075431_100003456 3300006847 Bacteria 15325
56 Ga0075431_100003973 3300006847 Bacteria 14411
57 Ga0075431_100437333 3300006847 Bacteria 1305
58 Ga0075431_100563381 3300006847 Bacteria 1126
59 Ga0075431_101541101 3300006847 Unclassified 623
60 Ga0075433_10151092 3300006852 Bacteria 2066
61 Ga0075429_100000302 3300006880 Bacteria 34927
62 Ga0075429_100029399 3300006880 Bacteria 4773
63 Ga0099794_10026534 3300007265 Bacteria 2679
64 Ga0105240_10699303 3300009093 Bacteria 1107
65 Ga0114129_10035286 3300009147 Bacteria 7066
66 Ga0114129_10061637 3300009147 Bacteria 5242
67 Ga0114129_10204755 3300009147 Bacteria 2670
68 Ga0114129_10431619 3300009147 Bacteria 1731
69 Ga0105248_12397740 3300009177 Bacteria 601
70 Ga0105248_13454951 3300009177 Unclassified 502
71 Ga0105237_11714695 3300009545 Bacteria 635
72 Ga0105238_10009728 3300009551 Bacteria 9627
73 Ga0163162_11180043 3300013306 Bacteria 868
74 Ga0157372_10219219 3300013307 Bacteria 2205
75 Ga0163163_10108013 3300014325 Bacteria 2809
76 Ga0163161_10322784 3300017792 Bacteria 1221
77 Ga0213874_10214196 3300021377 Unclassified 698
78 Ga0213876_10326082 3300021384 Bacteria 816
79 Ga0209758_1000048 3300025297 Bacteria 358400
80 Ga0209758_1035865 3300025297 Bacteria 1946
81 Ga0207692_10189813 3300025898 Bacteria 1202
82 Ga0207699_10127602 3300025906 Bacteria 1654
83 Ga0207699_10689241 3300025906 Bacteria 747
84 Ga0207705_10012279 3300025909 Bacteria 6188
85 Ga0207684_10329156 3300025910 Bacteria 1316
86 Ga0207684_10353704 3300025910 Bacteria 1264
87 Ga0207684_11179802 3300025910 Bacteria 635
88 Ga0207695_10025961 3300025913 Bacteria 6547
89 Ga0207695_10765931 3300025913 Bacteria 845
90 Ga0207660_10499605 3300025917 Unclassified 987
91 Ga0207657_10137962 3300025919 Unclassified 1994
92 Ga0207652_10524199 3300025921 Bacteria 1066
93 Ga0207646_10053227 3300025922 Bacteria 3621
94 Ga0207646_10296463 3300025922 Bacteria 1461
95 Ga0207646_10431622 3300025922 Bacteria 1189
96 Ga0207664_10127716 3300025929 Bacteria 2136
97 Ga0207665_10091152 3300025939 Bacteria 2113
98 Ga0207679_10198601 3300025945 Bacteria 1674
99 Ga0207668_10711089 3300025972 Unclassified 884
100 Ga0207640_10048297 3300025981 Bacteria 2750
101 Ga0207703_11239971 3300026035 Bacteria 717
102 Ga0207678_10001055 3300026067 Bacteria 25207
103 Ga0207708_10133481 3300026075 Bacteria 1943
104 Ga0207708_11882206 3300026075 Bacteria 524
105 Ga0207702_10862019 3300026078 Bacteria 897
106 Ga0207676_10729547 3300026095 Bacteria 962
107 Ga0207675_100168344 3300026118 Bacteria 2093
108 Ga0207698_10171807 3300026142 Bacteria 1909
109 Ga0209968_1092865 3300027526 Bacteria 547
110 Ga0207428_10032093 3300027907 Unclassified 4323
111 Ga0268265_10623447 3300028380 Bacteria 1033
112 Ga0307515_10439994 3300028794 Bacteria 921
113 Ga0307512_10110857 3300030522 Bacteria 1809
114 Ga0307512_10434350 3300030522 Bacteria 537
115 Ga0307513_10397706 3300031456 Bacteria 1113
116 Ga0307408_100060044 3300031548 Bacteria 2770
117 Ga0307408_100067482 3300031548 Bacteria 2631
118 Ga0307408_100368804 3300031548 Bacteria 1224
119 Ga0307405_10263683 3300031731 Bacteria 1288
120 Ga0307410_10337702 3300031852 Bacteria 1200
121 Ga0307407_10287626 3300031903 Bacteria 1141
122 Ga0307412_10059214 3300031911 Bacteria 2566
123 Ga0307409_100251068 3300031995 Bacteria 1617
124 Ga0307409_101939989 3300031995 Bacteria 618
125 Ga0307416_101058524 3300032002 Bacteria 915
126 Ga0307416_101874099 3300032002 Bacteria 703
127 Ga0307416_102157098 3300032002 Bacteria 659
128 Ga0307416_103250064 3300032002 Bacteria 544
129 Ga0307414_11848493 3300032004 Bacteria 564
130 Ga0307411_10491357 3300032005 Bacteria 1036
131 Ga0373950_0013949 3300034818 Bacteria 1347
132 Ga0373934_0481393 3300035086 Unclassified 521
133 Ga0373932_0067871 3300035112 Unclassified 1099
134 Ga0373939_0019633 3300035114 Bacteria 1826
135 Ga0373939_0129134 3300035114 Bacteria 900
136 Ga0373941_0037904 3300035115 Bacteria 1473
137 Ga0373960_0019452 3300035121 Bacteria 1784
138 Ga0373962_0088350 3300035242 Unclassified 951
139 Ga0373931_0043761 3300035691 Bacteria 2359
140 Ga0395901_0740740 3300038443 Bacteria 977
141 Ga0242420_096648 3300038996 Bacteria 625
142 Ga0436360_0616252 3300039438 Bacteria 1439
143 Ga0436360_1251750 3300039438 Bacteria 2065
144 Ga0436363_0076552 3300039450 Bacteria 1063
145 Ga0436363_0954255 3300039450 Bacteria 642
146 Ga0436363_1142631 3300039450 Bacteria 5245
147 Ga0451802_0278656 3300041460 Bacteria 687
148 Ga0451835_0299706 3300041492 Bacteria 1057
149 Ga0451577_0042913 3300042876 Bacteria 4053
150 Ga0451577_1932908 3300042876 Bacteria 516
151 Ga0453684_1037309 3300044712 Bacteria 870
152 Ga0466957_0252462 3300044842 Bacteria 1173
153 Ga0495638_0330723 3300046460 Bacteria 811
154 Ga0495580_0154257 3300046472 Bacteria 1591
155 Ga0495594_0097882 3300046499 Bacteria 1649
156 Ga0501031_0092090 3300049568 Bacteria 1978
157 Ga0501031_0669078 3300049568 Bacteria 667
158 Ga0501031_0742466 3300049568 Unclassified 630
159 Ga0501032_0203415 3300049569 Bacteria 1292
160 Ga0501033_0058077 3300049570 Bacteria 2859
161 Ga0501034_0254793 3300049571 Bacteria 1699
162 Ga0501036_0439252 3300049572 Bacteria 1087
163 Ga0501037_0232597 3300049573 Bacteria 1294
164 Ga0501038_0058187 3300049574 Bacteria 3315
165 Ga0501038_0094562 3300049574 Bacteria 2498
166 Ga0501038_1081038 3300049574 Bacteria 586
167 Ga0501039_0114640 3300049575 Bacteria 2109
168 Ga0501039_0193748 3300049575 Bacteria 1598
169 Ga0501040_0004404 3300049576 Bacteria 9148
170 Ga0501040_0131884 3300049576 Bacteria 1757
171 Ga0501040_0891328 3300049576 Bacteria 644
172 Ga0501041_0147497 3300049577 Bacteria 1468
173 Ga0501041_1065845 3300049577 Unclassified 521
174 Ga0501042_0106930 3300049578 Bacteria 2014
175 Ga0501042_0856950 3300049578 Bacteria 661
176 Ga0501043_0010328 3300049579 Bacteria 7320
177 Ga0501043_0595879 3300049579 Bacteria 817
178 Ga0501043_0807828 3300049579 Bacteria 678
179 Ga0501046_0037902 3300049580 Bacteria 3872
180 Ga0501046_0143101 3300049580 Bacteria 1808
181 Ga0501046_0192344 3300049580 Bacteria 1521
182 Ga0501046_0270216 3300049580 Bacteria 1247
183 Ga0501047_0007673 3300049581 Bacteria 10161
184 Ga0501047_0709748 3300049581 Bacteria 823
185 Ga0501067_0003210 3300049583 Bacteria 9007
186 Ga0501068_0012355 3300049584 Bacteria 4839
187 Ga0501068_0012615 3300049584 Bacteria 4795
188 Ga0501068_0024686 3300049584 Bacteria 3531
189 Ga0501068_0056540 3300049584 Bacteria 2379
190 Ga0501069_0007864 3300049585 Bacteria 5598
191 Ga0501069_0073866 3300049585 Bacteria 1913
192 Ga0501070_0277115 3300049586 Bacteria 1369
193 Ga0501071_0234169 3300049587 Bacteria 1384
194 Ga0501071_1275507 3300049587 Bacteria 567
195 Ga0501072_0010370 3300049588 Bacteria 7098
196 Ga0501072_0079532 3300049588 Bacteria 2596
197 Ga0501072_0419084 3300049588 Bacteria 1061
198 Ga0501072_0549600 3300049588 Bacteria 912
199 Ga0501073_0005457 3300049589 Bacteria 9526
200 Ga0501073_0109017 3300049589 Bacteria 1921
201 Ga0501073_0597483 3300049589 Bacteria 762
202 Ga0501074_0124771 3300049590 Bacteria 1841
203 Ga0501074_0136903 3300049590 Bacteria 1752
204 Ga0501074_0211851 3300049590 Bacteria 1380
205 Ga0501075_0018261 3300049591 Bacteria 5074
206 Ga0501075_0042672 3300049591 Bacteria 3401
207 Ga0501075_0068384 3300049591 Bacteria 2683
208 Ga0501075_0175991 3300049591 Bacteria 1633
209 Ga0501075_0197116 3300049591 Bacteria 1536
210 Ga0501076_0006652 3300049592 Bacteria 8383
211 Ga0501076_0008524 3300049592 Bacteria 7516
212 Ga0501076_0098297 3300049592 Bacteria 2358
213 Ga0501076_0226615 3300049592 Bacteria 1528
214 Ga0501076_0469467 3300049592 Bacteria 1036
215 Ga0501076_1290648 3300049592 Bacteria 600
216 Ga0501077_0003132 3300049593 Bacteria 9945
217 Ga0501077_0030103 3300049593 Bacteria 3453
218 Ga0501077_0125992 3300049593 Bacteria 1623
219 Ga0501235_069601 3300049669 Unclassified 832
220 Ga0501079_0008198 3300049741 Bacteria 7919
221 Ga0501079_0064684 3300049741 Bacteria 2821
222 Ga0501079_0119034 3300049741 Bacteria 2053
223 Ga0501080_0035536 3300049742 Bacteria 4650
224 Ga0501080_0206989 3300049742 Bacteria 1799
225 Ga0501080_0229339 3300049742 Bacteria 1698
226 Ga0501080_0440814 3300049742 Bacteria 1168
227 Ga0501081_0011615 3300049743 Bacteria 5763
228 Ga0501081_0097410 3300049743 Bacteria 2075
229 Ga0501081_0405749 3300049743 Bacteria 1009
230 Ga0501083_0002558 3300049744 Bacteria 12498
231 Ga0501035_0046061 3300049822 Bacteria 3923
232 Ga0501035_0149888 3300049822 Bacteria 2025
233 Ga0501035_0265142 3300049822 Bacteria 1455
234 Ga0501044_0015275 3300049823 Bacteria 8270
235 Ga0501044_0235587 3300049823 Bacteria 1776
236 Ga0501044_0628854 3300049823 Bacteria 964
237 Ga0501045_0012551 3300049824 Bacteria 5966
238 Ga0501045_0128944 3300049824 Bacteria 1880
239 Ga0501045_0648382 3300049824 Bacteria 780
240 nmdc:mga05p37_168209_c1 3300050507 Bacteria 2675
241 nmdc:mga05p37_234340_c1 3300050507 Bacteria 2210
242 nmdc:mga05p37_321568_c1 3300050507 Bacteria 1831
243 nmdc:mga05p37_344984_c1 3300050507 Bacteria 1755
244 nmdc:mga05p37_447770_c1 3300050507 Bacteria 1496
245 nmdc:mga05p37_716665_c1 3300050507 Bacteria 1109
246 nmdc:mga09592_203231_c1 3300050508 Bacteria 1716
247 nmdc:mga09592_231328_c1 3300050508 Bacteria 1602
248 nmdc:mga09592_40754_c1 3300050508 Bacteria 3902
249 nmdc:mga0qj67_133886_c1 3300050509 Bacteria 2008
250 nmdc:mga0qj67_1448374_c1 3300050509 Bacteria 529
251 nmdc:mga0qj67_296153_c1 3300050509 Bacteria 1311
252 nmdc:mga0qj67_709214_c1 3300050509 Bacteria 800
253 nmdc:mga0qj67_875555_c1 3300050509 Bacteria 709
254 nmdc:mga0qj67_98609_c1 3300050509 Bacteria 2354
255 nmdc:mga06r32_1397060_c1 3300050510 Unclassified 642
256 nmdc:mga06r32_5876_c1 3300050510 Bacteria 11041
257 nmdc:mga06r32_972109_c1 3300050510 Bacteria 803
258 nmdc:mga08y16_3729_c1 3300050511 Bacteria 15864
259 nmdc:mga08y16_746752_c1 3300050511 Bacteria 975
260 nmdc:mga0n895_17744_c1 3300050512 Bacteria 6567
261 nmdc:mga0n895_294730_c1 3300050512 Bacteria 1645
262 nmdc:mga0n895_611220_c1 3300050512 Bacteria 1092
263 nmdc:mga0rr50_134577_c1 3300050513 Bacteria 1983
264 nmdc:mga0rr50_1655969_c1 3300050513 Bacteria 540
265 nmdc:mga08x19_162169_c1 3300050514 Bacteria 1519
266 nmdc:mga0a205_552339_c1 3300050515 Bacteria 1007
267 nmdc:mga0a205_647758_c1 3300050515 Bacteria 908
268 nmdc:mga0a205_91560_c1 3300050515 Bacteria 2939
269 Ga0500643_016312 3300053087 Bacteria 2519
270 Ga0500646_0004775 3300053090 Bacteria 3430
271 Ga0500583_0107278 3300053092 Bacteria 1373
272 Ga0500651_0198494 3300053093 Bacteria 1185
273 Ga0500594_0307393 3300053118 Bacteria 532
274 Ga0500642_0000906 3300053130 Bacteria 8592
275 Ga0500655_108842 3300053133 Bacteria 584
276 Ga0500658_0071374 3300053134 Unclassified 1466
277 Ga0500658_0086988 3300053134 Bacteria 1345
278 Ga0500588_0003494 3300053146 Bacteria 3322
279 Ga0500588_0058435 3300053146 Bacteria 1228
280 Ga0500622_0304729 3300053156 Bacteria 677
281 Ga0500611_121437 3300053727 Bacteria 696
282 Ga0500609_000434 3300053731 Bacteria 6195
283 Ga0500587_018320 3300053739 Bacteria 901
284 Ga0501084_0006201 3300054114 Bacteria 9833
285 Ga0501084_0029336 3300054114 Bacteria 4602
286 Ga0501084_0808636 3300054114 Unclassified 789
287 Ga0590071_027222 3300059421 Bacteria 1357
288 Ga0590077_046616 3300059426 Bacteria 969
289 Ga0501082_0003314 3300060353 Bacteria 14057
290 Ga0501082_0021158 3300060353 Bacteria 5610
291 Ga0501082_0064134 3300060353 Bacteria 3164
292 Ga0501082_0224272 3300060353 Bacteria 1635
293 Ga0501082_0234205 3300060353 Bacteria 1598
294 Ga0501082_0676328 3300060353 Bacteria 903
295 Ga0501082_1362911 3300060353 Unclassified 620
296 Ga0530510_0001922 3300061734 Bacteria 14210
297 Ga0530510_0282171 3300061734 Bacteria 1241
298 Ga0530510_0423725 3300061734 Bacteria 1005
299 Ga0530510_1453031 3300061734 Bacteria 526
300 Ga0111539_10001049
301 JGI25153J46596_10000048
302 JGI25153J46596_10000356
303 rootH2_10126613
304 Ga0065715_11073925
305 Ga0070661_100280984
306 Ga0070668_101511517
307 Ga0070709_10392813
308 Ga0070714_100024234
309 Ga0070700_100096117
310 Ga0070694_100024467
311 Ga0070694_100024794
312 Ga0070694_101371801
313 Ga0070708_100066382
314 Ga0070708_100450284
315 Ga0070708_100503241
316 Ga0070663_100011689
317 Ga0070706_100109381
318 Ga0070706_100293598
319 Ga0070706_100711558
320 Ga0070706_101787515
321 Ga0070707_100124592
322 Ga0070707_100151180
323 Ga0070707_100970130
324 Ga0070699_100275801
325 Ga0070699_100725101
326 Ga0070679_100359937
327 Ga0070697_100388086
328 Ga0070697_100461669
329 Ga0070697_101305464
330 Ga0068853_101219205
331 Ga0070695_100001203
332 Ga0070695_100023568
333 Ga0070696_100884654
334 Ga0070696_101331460
335 Ga0070693_101361867
336 Ga0068856_100910559
337 Ga0068852_101543349
338 Ga0068864_101811231
339 Ga0068861_100074258
340 Ga0068858_101436103
341 Ga0068862_101522826
342 Ga0081455_10330460
343 Ga0081539_10376821
344 Ga0070717_10119919
345 Ga0070716_101525966
346 Ga0075428_100018629
347 Ga0075428_100333447
348 Ga0075430_100005497
349 Ga0075430_100114580
350 Ga0075430_100138505
351 Ga0075430_100317427
352 Ga0075430_100820140
353 Ga0075431_100001917
354 Ga0075431_100003456
355 Ga0075431_100003973
356 Ga0075431_100437333
357 Ga0075431_100563381
358 Ga0075431_101541101
359 Ga0075433_10151092
360 Ga0075429_100000302
361 Ga0075429_100029399
362 Ga0099794_10026534
363 Ga0105240_10699303
364 Ga0114129_10035286
365 Ga0114129_10061637
366 Ga0114129_10204755
367 Ga0114129_10431619
368 Ga0105248_12397740
369 Ga0105248_13454951
370 Ga0105237_11714695
371 Ga0105238_10009728
372 Ga0163162_11180043
373 Ga0157372_10219219
374 Ga0163163_10108013
375 Ga0163161_10322784
376 Ga0213874_10214196
377 Ga0213876_10326082
378 Ga0209758_1000048
379 Ga0209758_1035865
380 Ga0207692_10189813
381 Ga0207699_10127602
382 Ga0207699_10689241
383 Ga0207705_10012279
384 Ga0207684_10329156
385 Ga0207684_10353704
386 Ga0207684_11179802
387 Ga0207695_10025961
388 Ga0207695_10765931
389 Ga0207660_10499605
390 Ga0207657_10137962
391 Ga0207652_10524199
392 Ga0207646_10053227
393 Ga0207646_10296463
394 Ga0207646_10431622
395 Ga0207664_10127716
396 Ga0207665_10091152
397 Ga0207679_10198601
398 Ga0207668_10711089
399 Ga0207640_10048297
400 Ga0207703_11239971
401 Ga0207678_10001055
402 Ga0207708_10133481
403 Ga0207708_11882206
404 Ga0207702_10862019
405 Ga0207676_10729547
406 Ga0207675_100168344
407 Ga0207698_10171807
408 Ga0209968_1092865
409 Ga0207428_10032093
410 Ga0268265_10623447
411 Ga0307515_10439994
412 Ga0307512_10110857
413 Ga0307512_10434350
414 Ga0307513_10397706
415 Ga0307408_100060044
416 Ga0307408_100067482
417 Ga0307408_100368804
418 Ga0307405_10263683
419 Ga0307410_10337702
420 Ga0307407_10287626
421 Ga0307412_10059214
422 Ga0307409_100251068
423 Ga0307409_101939989
424 Ga0307416_101058524
425 Ga0307416_101874099
426 Ga0307416_102157098
427 Ga0307416_103250064
428 Ga0307414_11848493
429 Ga0307411_10491357
430 Ga0373950_0013949
431 Ga0373934_0481393
432 Ga0373932_0067871
433 Ga0373939_0019633
434 Ga0373939_0129134
435 Ga0373941_0037904
436 Ga0373960_0019452
437 Ga0373962_0088350
438 Ga0373931_0043761
439 Ga0395901_0740740
440 Ga0242420_096648
441 Ga0436360_0616252
442 Ga0436360_1251750
443 Ga0436363_0076552
444 Ga0436363_0954255
445 Ga0436363_1142631
446 Ga0451802_0278656
447 Ga0451835_0299706
448 Ga0451577_0042913
449 Ga0451577_1932908
450 Ga0453684_1037309
451 Ga0466957_0252462
452 Ga0495638_0330723
453 Ga0495580_0154257
454 Ga0495594_0097882
455 Ga0501031_0092090
456 Ga0501031_0669078
457 Ga0501031_0742466
458 Ga0501032_0203415
459 Ga0501033_0058077
460 Ga0501034_0254793
461 Ga0501036_0439252
462 Ga0501037_0232597
463 Ga0501038_0058187
464 Ga0501038_0094562
465 Ga0501038_1081038
466 Ga0501039_0114640
467 Ga0501039_0193748
468 Ga0501040_0004404
469 Ga0501040_0131884
470 Ga0501040_0891328
471 Ga0501041_0147497
472 Ga0501041_1065845
473 Ga0501042_0106930
474 Ga0501042_0856950
475 Ga0501043_0010328
476 Ga0501043_0595879
477 Ga0501043_0807828
478 Ga0501046_0037902
479 Ga0501046_0143101
480 Ga0501046_0192344
481 Ga0501046_0270216
482 Ga0501047_0007673
483 Ga0501047_0709748
484 Ga0501067_0003210
485 Ga0501068_0012355
486 Ga0501068_0012615
487 Ga0501068_0024686
488 Ga0501068_0056540
489 Ga0501069_0007864
490 Ga0501069_0073866
491 Ga0501070_0277115
492 Ga0501071_0234169
493 Ga0501071_1275507
494 Ga0501072_0010370
495 Ga0501072_0079532
496 Ga0501072_0419084
497 Ga0501072_0549600
498 Ga0501073_0005457
499 Ga0501073_0109017
500 Ga0501073_0597483
501 Ga0501074_0124771
502 Ga0501074_0136903
503 Ga0501074_0211851
504 Ga0501075_0018261
505 Ga0501075_0042672
506 Ga0501075_0068384
507 Ga0501075_0175991
508 Ga0501075_0197116
509 Ga0501076_0006652
510 Ga0501076_0008524
511 Ga0501076_0098297
512 Ga0501076_0226615
513 Ga0501076_0469467
514 Ga0501076_1290648
515 Ga0501077_0003132
516 Ga0501077_0030103
517 Ga0501077_0125992
518 Ga0501235_069601
519 Ga0501079_0008198
520 Ga0501079_0064684
521 Ga0501079_0119034
522 Ga0501080_0035536
523 Ga0501080_0206989
524 Ga0501080_0229339
525 Ga0501080_0440814
526 Ga0501081_0011615
527 Ga0501081_0097410
528 Ga0501081_0405749
529 Ga0501083_0002558
530 Ga0501035_0046061
531 Ga0501035_0149888
532 Ga0501035_0265142
533 Ga0501044_0015275
534 Ga0501044_0235587
535 Ga0501044_0628854
536 Ga0501045_0012551
537 Ga0501045_0128944
538 Ga0501045_0648382
539 nmdc:mga05p37_168209_c1
540 nmdc:mga05p37_234340_c1
541 nmdc:mga05p37_321568_c1
542 nmdc:mga05p37_344984_c1
543 nmdc:mga05p37_447770_c1
544 nmdc:mga05p37_716665_c1
545 nmdc:mga09592_203231_c1
546 nmdc:mga09592_231328_c1
547 nmdc:mga09592_40754_c1
548 nmdc:mga0qj67_133886_c1
549 nmdc:mga0qj67_1448374_c1
550 nmdc:mga0qj67_296153_c1
551 nmdc:mga0qj67_709214_c1
552 nmdc:mga0qj67_875555_c1
553 nmdc:mga0qj67_98609_c1
554 nmdc:mga06r32_1397060_c1
555 nmdc:mga06r32_5876_c1
556 nmdc:mga06r32_972109_c1
557 nmdc:mga08y16_3729_c1
558 nmdc:mga08y16_746752_c1
559 nmdc:mga0n895_17744_c1
560 nmdc:mga0n895_294730_c1
561 nmdc:mga0n895_611220_c1
562 nmdc:mga0rr50_134577_c1
563 nmdc:mga0rr50_1655969_c1
564 nmdc:mga08x19_162169_c1
565 nmdc:mga0a205_552339_c1
566 nmdc:mga0a205_647758_c1
567 nmdc:mga0a205_91560_c1
568 Ga0500643_016312
569 Ga0500646_0004775
570 Ga0500583_0107278
571 Ga0500651_0198494
572 Ga0500594_0307393
573 Ga0500642_0000906
574 Ga0500655_108842
575 Ga0500658_0071374
576 Ga0500658_0086988
577 Ga0500588_0003494
578 Ga0500588_0058435
579 Ga0500622_0304729
580 Ga0500611_121437
581 Ga0500609_000434
582 Ga0500587_018320
583 Ga0501084_0006201
584 Ga0501084_0029336
585 Ga0501084_0808636
586 Ga0590071_027222
587 Ga0590077_046616
588 Ga0501082_0003314
589 Ga0501082_0021158
590 Ga0501082_0064134
591 Ga0501082_0224272
592 Ga0501082_0234205
593 Ga0501082_0676328
594 Ga0501082_1362911
595 Ga0530510_0001922
596 Ga0530510_0282171
597 Ga0530510_0423725
598 Ga0530510_1453031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

1

89

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3edd-assembly1.cif.gz_A structural base for cyclodextrin hydrolysis 0.6703 30 52
2qmw-assembly1.cif.gz_B-2 the crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50 0.6451 2 73
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.6236 1 78
3ibw-assembly1.cif.gz_B crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a 0.6184 2 74
4lub-assembly1.cif.gz_B x-ray structure of prephenate dehydratase from streptococcus mutans 0.6168 2 74
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6845 32 54 3.40.430.10
4waoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.671 1 76 3.30.70.60
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6665 1 77 3.30.70.920
5hl8C00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;General secretion pathway protein M, EpsM 0.6646 17 63 3.30.1360.100
4hl9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6456 1 77 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y5NG27-F1-model_v4 DUF3303 family protein 0.998 1 70
AF-A0A2V6U4X1-F1-model_v4 DUF3303 domain-containing protein 0.9886 1 86
AF-A0A521H3A0-F1-model_v4 DUF3303 domain-containing protein 0.987 5 86
AF-A0A2V6SFN8-F1-model_v4 DUF3303 domain-containing protein 0.9868 5 87
AF-A0A536Y4F4-F1-model_v4 DUF3303 domain-containing protein 0.9838 5 86

Map