F393919

General Info

Members Datasets Scaffolds Average Seq Length
297 209 254 285

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0039051|Ga0501034_0039051_2594_3553
Length 319
Sequence MRTAAVQARTATAIPGCYYPRFVPPATNRPPMTPRLPALRHVLVLLLLALFATSGCSRLKGVFKDKDSVEGQPVEQIYAKGQKLMHGGNWDGALRVYKRLVAQYPYGPYTEQTLMEMAYAYYKSGNNEEAISSIDRFIRTYPTHRNTPYMYYLRGLVNSNRDTVFLQKVWTLDASRRDLATPQQAYNDFNTVATRYLNSRYAADARQRMVALRNMFARHDMEVALYYLRRGANVSALERAKYLLETYPQSEFQNDAVALMAIAYTRLGNQTLASDAERVLKANDPQHAYFSGNWPDYPWTIRKLNPFAGEKSALNNEKR

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
18 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
22 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
23 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
24 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
25 2919513703 Luteimonas sp. 3794 Isolate Unclassified
26 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
27 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
28 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
29 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
30 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
31 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
32 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
33 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
34 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
35 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
36 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
37 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
38 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
39 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
40 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
55 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
72 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
73 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
144 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
198 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
203 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
204 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
208 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
209 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.52
Metatranscriptomes 0
Isolates 14.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 16.16
Nodule 0.34
Rhizoplane 7.07
Rhizosphere 53.87
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000041 3300002773 Bacteria 88071
2 JGI25150J39212_1000109 3300002774 Bacteria 47887
3 JGI25151J46595_10000141 3300003187 Bacteria 95351
4 JGI25151J46595_10000347 3300003187 Bacteria 49734
5 JGI25153J46596_10000106 3300003215 Bacteria 95351
6 rootH2_10038096 3300003320 Bacteria 4715
7 rootL2_10178006 3300003322 Bacteria 1455
8 rootH1_10248321 3300003323 Bacteria 1741
9 Ga0055526_1000240 3300003771 Bacteria 46312
10 Ga0055526_1004865 3300003771 Bacteria 7916
11 Ga0055537_1000841 3300003773 Bacteria 14936
12 Ga0055524_1000754 3300003775 Bacteria 21968
13 Ga0055536_1006384 3300003781 Bacteria 5521
14 Ga0055536_1007977 3300003781 Bacteria 4635
15 Ga0055536_1009052 3300003781 Bacteria 4184
16 Ga0055534_1000002 3300003784 Bacteria 390762
17 Ga0055534_1000276 3300003784 Bacteria 35065
18 Ga0055528_1000121 3300003790 Bacteria 62003
19 Ga0055528_1000789 3300003790 Bacteria 21984
20 Ga0058692_1000013 3300003856 Bacteria 316299
21 Ga0065714_10088628 3300005288 Bacteria 2002
22 Ga0065715_10106040 3300005293 Bacteria 2855
23 Ga0070670_100131014 3300005331 Bacteria 2165
24 Ga0070670_100326647 3300005331 Bacteria 1345
25 Ga0070661_100309198 3300005344 Bacteria 1232
26 Ga0070668_100069718 3300005347 Bacteria 2736
27 Ga0070669_100113842 3300005353 Bacteria 2056
28 Ga0070675_100106053 3300005354 Bacteria 2372
29 Ga0070671_100058872 3300005355 Bacteria 3197
30 Ga0070671_100185951 3300005355 Bacteria 1760
31 Ga0068867_100123840 3300005459 Bacteria 2001
32 Ga0070679_100228760 3300005530 Bacteria 1819
33 Ga0070672_100030258 3300005543 Bacteria 4066
34 Ga0068852_100634306 3300005616 Bacteria 1075
35 Ga0068862_100061230 3300005844 Bacteria 3235
36 Ga0068862_100492747 3300005844 Bacteria 1162
37 Ga0075364_10001001 3300006051 Bacteria 14958
38 Ga0075364_10173059 3300006051 Bacteria 1460
39 Ga0075367_10197018 3300006178 Bacteria 1258
40 Ga0105248_10102307 3300009177 Bacteria 3229
41 Ga0105148_102297 3300009978 Bacteria 1341
42 Ga0105032_105742 3300009979 Bacteria 1042
43 Ga0157316_1001237 3300012510 Bacteria 1539
44 Ga0157373_10063943 3300013100 Bacteria 2605
45 Ga0157371_10001811 3300013102 Bacteria 21588
46 Ga0157371_10023009 3300013102 Bacteria 4556
47 Ga0157371_10128529 3300013102 Bacteria 1802
48 Ga0157371_10172036 3300013102 Bacteria 1548
49 Ga0157370_10025329 3300013104 Bacteria 5873
50 Ga0157370_10038874 3300013104 Bacteria 4602
51 Ga0157369_10025150 3300013105 Bacteria 6611
52 Ga0157369_10081977 3300013105 Bacteria 3452
53 Ga0157372_10462059 3300013307 Bacteria 1479
54 Ga0157375_10129775 3300013308 Bacteria 2639
55 Ga0157380_10286088 3300014326 Bacteria 1511
56 Ga0182008_10000279 3300014497 Bacteria 40058
57 Ga0182008_10038466 3300014497 Bacteria 2392
58 Ga0182006_1015675 3300015261 Bacteria 3244
59 Ga0182006_1020400 3300015261 Bacteria 2777
60 Ga0182007_10000026 3300015262 Bacteria 168694
61 Ga0182005_1000379 3300015265 Bacteria 24583
62 Ga0183360_10001 3300015689 Bacteria 3943671
63 Ga0163161_10012380 3300017792 Bacteria 5922
64 Ga0163161_10138971 3300017792 Bacteria 1838
65 Ga0207425_1000084 3300025245 Bacteria 95660
66 Ga0209129_1000057 3300025258 Bacteria 253632
67 Ga0209565_1000001 3300025263 Bacteria 2950419
68 Ga0209565_1000023 3300025263 Bacteria 388244
69 Ga0209673_1000001 3300025273 Bacteria 3176258
70 Ga0209673_1000116 3300025273 Bacteria 175933
71 Ga0209130_1019076 3300025284 Bacteria 1598
72 Ga0209675_1000001 3300025291 Bacteria 2950293
73 Ga0209675_1000016 3300025291 Bacteria 391965
74 Ga0209676_1000037 3300025292 Bacteria 457562
75 Ga0209676_1000770 3300025292 Bacteria 42881
76 Ga0209676_1001488 3300025292 Bacteria 21557
77 Ga0209025_1000006 3300025294 Bacteria 1153444
78 Ga0209025_1000013 3300025294 Bacteria 871757
79 Ga0209025_1045053 3300025294 Bacteria 1834
80 Ga0209564_1000001 3300025295 Bacteria 3176258
81 Ga0209564_1000347 3300025295 Bacteria 87112
82 Ga0209758_1000014 3300025297 Bacteria 871757
83 Ga0209050_1001150 3300025298 Bacteria 31702
84 Ga0209050_1002203 3300025298 Bacteria 17542
85 Ga0209050_1029744 3300025298 Bacteria 1738
86 Ga0209256_1000006 3300025299 Bacteria 1250310
87 Ga0209256_1008914 3300025299 Bacteria 4521
88 Ga0209051_1012449 3300025303 Bacteria 4115
89 Ga0209257_1000197 3300025304 Bacteria 149491
90 Ga0209257_1000868 3300025304 Bacteria 42949
91 Ga0207713_1043317 3300025735 Bacteria 1860
92 Ga0207705_10103656 3300025909 Bacteria 2095
93 Ga0207660_10077857 3300025917 Bacteria 2429
94 Ga0207657_10013731 3300025919 Bacteria 7928
95 Ga0207652_10154409 3300025921 Bacteria 2056
96 Ga0207681_10140556 3300025923 Bacteria 1797
97 Ga0207650_10131515 3300025925 Bacteria 1958
98 Ga0207650_10298284 3300025925 Bacteria 1316
99 Ga0207659_10060468 3300025926 Bacteria 2727
100 Ga0207659_10165617 3300025926 Bacteria 1740
101 Ga0207709_10001141 3300025935 Bacteria 19372
102 Ga0207691_10019083 3300025940 Bacteria 6494
103 Ga0207668_10037888 3300025972 Bacteria 3231
104 Ga0207708_10128166 3300026075 Bacteria 1982
105 Ga0207648_10230401 3300026089 Bacteria 1648
106 Ga0207676_10350011 3300026095 Bacteria 1366
107 Ga0207683_10455490 3300026121 Bacteria 1180
108 Ga0209371_1000007 3300027312 Bacteria 1050654
109 Ga0209983_1002188 3300027665 Bacteria 4303
110 Ga0209971_1000995 3300027682 Bacteria 7295
111 Ga0268265_10132721 3300028380 Bacteria 2073
112 Ga0268256_1000008 3300030500 Bacteria 1050654
113 Ga0314311_1174004 3300030733 Bacteria 3062
114 Ga0316183_1084551 3300030742 Bacteria 5022
115 Ga0316182_1100347 3300030745 Bacteria 1314
116 Ga0307513_10004744 3300031456 Bacteria 18056
117 Ga0307413_10025335 3300031824 Bacteria 3251
118 Ga0307413_10061657 3300031824 Bacteria 2315
119 Ga0307413_10152462 3300031824 Bacteria 1612
120 Ga0307410_10120382 3300031852 Bacteria 1913
121 Ga0307406_10009417 3300031901 Bacteria 5476
122 Ga0307406_10018607 3300031901 Bacteria 4062
123 Ga0307412_10000894 3300031911 Bacteria 17156
124 Ga0307412_10072132 3300031911 Bacteria 2359
125 Ga0307416_100307432 3300032002 Bacteria 1580
126 Ga0307414_10017843 3300032004 Bacteria 4353
127 Ga0307414_10018632 3300032004 Bacteria 4280
128 Ga0307414_10032922 3300032004 Bacteria 3419
129 Ga0307414_10103646 3300032004 Bacteria 2147
130 Ga0307414_10104878 3300032004 Bacteria 2136
131 Ga0307414_10129295 3300032004 Bacteria 1957
132 Ga0307414_10136300 3300032004 Bacteria 1914
133 Ga0307414_10136832 3300032004 Bacteria 1911
134 Ga0307411_10010178 3300032005 Bacteria 4998
135 Ga0307411_10055710 3300032005 Bacteria 2602
136 Ga0307411_10097460 3300032005 Bacteria 2070
137 Ga0395900_0150575 3300037418 Bacteria 2377
138 Ga0395905_0006669 3300037471 Bacteria 11568
139 Ga0395905_0240636 3300037471 Bacteria 1691
140 Ga0395905_0329652 3300037471 Bacteria 1417
141 Ga0395901_0031720 3300038443 Bacteria 5448
142 Ga0237819_00065 3300038705 Bacteria 37820
143 Ga0439436_0009040 3300041404 Bacteria 3055
144 Ga0439436_0018515 3300041404 Bacteria 2082
145 Ga0439436_0019789 3300041404 Bacteria 2007
146 Ga0439436_0030437 3300041404 Bacteria 1568
147 Ga0439439_0004163 3300041406 Bacteria 3240
148 Ga0439465_0005464 3300041413 Bacteria 4057
149 Ga0439465_0005726 3300041413 Bacteria 3955
150 Ga0451793_1376657 3300041452 Bacteria 1256
151 Ga0451797_0154159 3300041453 Bacteria 2793
152 Ga0451797_0868936 3300041453 Bacteria 1168
153 Ga0451797_0925954 3300041453 Bacteria 1620
154 Ga0451795_1153928 3300041456 Bacteria 1881
155 Ga0451800_0129864 3300041459 Bacteria 1650
156 Ga0451806_457889 3300041462 Bacteria 1666
157 Ga0451804_0110272 3300041463 Bacteria 1659
158 Ga0451807_0853383 3300041486 Bacteria 1455
159 Ga0451837_1419908 3300041494 Bacteria 3373
160 Ga0451841_0238937 3300041498 Bacteria 1622
161 Ga0451843_0135032 3300041509 Bacteria 1094
162 Ga0451843_0364753 3300041509 Bacteria 2796
163 Ga0451843_1379205 3300041509 Bacteria 1652
164 Ga0451843_1511288 3300041509 Bacteria 1114
165 Ga0451853_2980789 3300041512 Bacteria 1942
166 Ga0439432_003329 3300042006 Bacteria 5970
167 Ga0439449_0002754 3300042007 Bacteria 6841
168 Ga0439449_0007871 3300042007 Bacteria 4047
169 Ga0439449_0022006 3300042007 Bacteria 2386
170 Ga0439449_0120320 3300042007 Bacteria 975
171 Ga0451577_0009134 3300042876 Bacteria 9565
172 Ga0495638_0003072 3300046460 Bacteria 13256
173 Ga0495638_0035189 3300046460 Bacteria 3194
174 Ga0495638_0044852 3300046460 Bacteria 2784
175 Ga0495631_0003326 3300046518 Bacteria 8835
176 Ga0495643_0005074 3300046522 Bacteria 9007
177 Ga0495643_0030209 3300046522 Bacteria 3028
178 Ga0495663_0000459 3300046525 Bacteria 14925
179 Ga0495663_0002146 3300046525 Bacteria 6013
180 Ga0495663_0003051 3300046525 Bacteria 4904
181 Ga0495663_0039373 3300046525 Bacteria 1432
182 Ga0495598_0004662 3300046537 Bacteria 2984
183 Ga0495621_0005329 3300046539 Bacteria 3687
184 Ga0495621_0115258 3300046539 Bacteria 1034
185 Ga0495633_0004096 3300046558 Bacteria 9405
186 Ga0495633_0022298 3300046558 Bacteria 3154
187 Ga0495656_0007415 3300046615 Bacteria 3874
188 Ga0495668_0006263 3300046616 Bacteria 7842
189 Ga0495625_0036992 3300046660 Bacteria 3583
190 Ga0495671_0022133 3300046692 Bacteria 3333
191 Ga0495672_0000724 3300047320 Bacteria 36306
192 Ga0495685_033433 3300047447 Bacteria 1767
193 Ga0495686_0007761 3300047472 Bacteria 7992
194 Ga0496101_0447959 3300048904 Bacteria 1018
195 Ga0496102_0502692 3300048905 Bacteria 1134
196 Ga0496105_0147423 3300048908 Bacteria 1935
197 Ga0496106_0141153 3300048909 Bacteria 1895
198 Ga0496107_0087177 3300048910 Bacteria 2279
199 Ga0496108_0096863 3300048911 Bacteria 2513
200 Ga0496110_0204870 3300048913 Bacteria 1792
201 Ga0496111_0064472 3300048914 Bacteria 2657
202 Ga0496112_0059779 3300048915 Bacteria 3755
203 Ga0496112_0188541 3300048915 Bacteria 2025
204 Ga0496113_0004326 3300048916 Bacteria 8701
205 Ga0496114_0023355 3300048917 Bacteria 5046
206 Ga0496116_0001245 3300048919 Bacteria 29576
207 Ga0496116_0060655 3300048919 Bacteria 2452
208 Ga0496116_0079175 3300048919 Bacteria 2046
209 Ga0496117_0001951 3300048920 Bacteria 27471
210 Ga0496117_0009746 3300048920 Bacteria 8863
211 Ga0496118_0001683 3300048921 Bacteria 32347
212 Ga0496118_0010949 3300048921 Bacteria 8914
213 Ga0496118_0015757 3300048921 Bacteria 6976
214 Ga0496118_0061539 3300048921 Bacteria 2779
215 Ga0496119_0000654 3300048922 Bacteria 46601
216 Ga0496120_0003725 3300048923 Bacteria 13553
217 Ga0496121_0010250 3300048924 Bacteria 10604
218 Ga0496121_0013278 3300048924 Bacteria 8867
219 Ga0496122_0002986 3300048925 Bacteria 23030
220 Ga0496123_0002440 3300048926 Bacteria 23081
221 Ga0496123_0014656 3300048926 Bacteria 6480
222 Ga0496124_0018239 3300048927 Bacteria 6579
223 Ga0496124_0031325 3300048927 Bacteria 4709
224 Ga0496124_0036796 3300048927 Bacteria 4263
225 Ga0496124_0073300 3300048927 Bacteria 2833
226 Ga0496124_0175014 3300048927 Bacteria 1657
227 Ga0496125_0012161 3300048928 Bacteria 8564
228 Ga0496125_0013432 3300048928 Bacteria 8048
229 Ga0496125_0015098 3300048928 Bacteria 7491
230 Ga0496125_0047305 3300048928 Bacteria 3599
231 Ga0496125_0100087 3300048928 Bacteria 2138
232 Ga0496126_0002641 3300048929 Bacteria 23800
233 Ga0496126_0209774 3300048929 Bacteria 1640
234 Ga0501290_002757 3300049513 Bacteria 2249
235 Ga0501031_0122350 3300049568 Bacteria 1700
236 Ga0501034_0039051 3300049571 Bacteria 4808
237 Ga0501034_0063582 3300049571 Bacteria 3704
238 Ga0501202_004781 3300049652 Bacteria 2380
239 Ga0501223_017105 3300049663 Bacteria 1431
240 Ga0501233_013771 3300049668 Bacteria 1645
241 Ga0501239_004776 3300049672 Bacteria 1345
242 Ga0501240_015866 3300049673 Bacteria 1076
243 Ga0501250_001802 3300049680 Bacteria 1843
244 Ga0501250_006281 3300049680 Bacteria 1252
245 Ga0501253_013135 3300049683 Bacteria 1313
246 Ga0501241_022566 3300049758 Bacteria 1163
247 Ga0501265_007999 3300049762 Bacteria 1253
248 Ga0501268_005525 3300049765 Bacteria 1822
249 Ga0501270_019327 3300049767 Bacteria 1019
250 Ga0501274_003549 3300049771 Bacteria 1260
251 Ga0501275_001205 3300049772 Bacteria 2611
252 nmdc:mga00v17_1016_c1 3300050491 Bacteria 15002
253 nmdc:mga00v17_29051_c1 3300050491 Bacteria 3243
254 Ga0500634_0000677 3300053161 Bacteria 11649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100113842 Ga0070669_1001138422 256
2 3300005355 Ga0070671_100185951 Ga0070671_1001859512 256
3 3300005459 Ga0068867_100123840 Ga0068867_1001238402 256
4 3300005543 Ga0070672_100030258 Ga0070672_1000302582 256
5 3300013308 Ga0157375_10129775 Ga0157375_101297753 256
6 3300014326 Ga0157380_10286088 Ga0157380_102860882 256
7 3300025940 Ga0207691_10019083 Ga0207691_100190833 256
8 3300026089 Ga0207648_10230401 Ga0207648_102304012 256
9 3300046537 Ga0495598_0004662 Ga0495598_0004662_1947_2822 256
10 3300046539 Ga0495621_0005329 Ga0495621_0005329_1128_2003 256
11 3300049672 Ga0501239_004776 Ga0501239_004776_559_1335 256
12 3300013105 Ga0157369_10081977 Ga0157369_100819773 257
13 3300026075 Ga0207708_10128166 Ga0207708_101281662 257
14 3300009978 Ga0105148_102297 Ga0105148_1022972 258
15 3300037471 Ga0395905_0329652 Ga0395905_0329652_123_1001 258
16 3300048915 Ga0496112_0059779 Ga0496112_0059779_1799_2671 258
17 3300048916 Ga0496113_0004326 Ga0496113_0004326_6876_7748 258
18 3300037471 Ga0395905_0240636 Ga0395905_0240636_398_1270 259
19 3300037471 Ga0395905_0006669 Ga0395905_0006669_9914_10786 260
20 3300038443 Ga0395901_0031720 Ga0395901_0031720_1113_1985 260
21 3300013307 Ga0157372_10462059 Ga0157372_104620592 263
22 3300025923 Ga0207681_10140556 Ga0207681_101405561 263
23 3300005331 Ga0070670_100131014 Ga0070670_1001310142 264
24 3300005844 Ga0068862_100061230 Ga0068862_1000612303 264
25 3300025925 Ga0207650_10131515 Ga0207650_101315152 264
26 3300048910 Ga0496107_0087177 Ga0496107_0087177_767_1606 265
27 3300048913 Ga0496110_0204870 Ga0496110_0204870_565_1404 265
28 3300048914 Ga0496111_0064472 Ga0496111_0064472_429_1268 265
29 3300048917 Ga0496114_0023355 Ga0496114_0023355_3203_4042 265
30 3300005344 Ga0070661_100309198 Ga0070661_1003091982 266
31 3300025926 Ga0207659_10060468 Ga0207659_100604682 266
32 3300026121 Ga0207683_10455490 Ga0207683_104554901 266
33 3300037418 Ga0395900_0150575 Ga0395900_0150575_563_1441 266
34 3300005530 Ga0070679_100228760 Ga0070679_1002287601 267
35 3300005616 Ga0068852_100634306 Ga0068852_1006343061 267
36 3300025909 Ga0207705_10103656 Ga0207705_101036562 267
37 3300025917 Ga0207660_10077857 Ga0207660_100778572 267
38 3300025919 Ga0207657_10013731 Ga0207657_100137314 267
39 3300025921 Ga0207652_10154409 Ga0207652_101544092 267
40 3300005331 Ga0070670_100326647 Ga0070670_1003266471 270
41 3300005354 Ga0070675_100106053 Ga0070675_1001060532 270
42 3300005355 Ga0070671_100058872 Ga0070671_1000588722 270
43 3300005844 Ga0068862_100492747 Ga0068862_1004927472 270
44 3300009177 Ga0105248_10102307 Ga0105248_101023072 270
45 3300012510 Ga0157316_1001237 Ga0157316_10012371 270
46 3300025926 Ga0207659_10165617 Ga0207659_101656171 270
47 3300026095 Ga0207676_10350011 Ga0207676_103500111 270
48 3300028380 Ga0268265_10132721 Ga0268265_101327212 270
49 3300046615 Ga0495656_0007415 Ga0495656_0007415_1083_1937 270
50 3300048904 Ga0496101_0447959 Ga0496101_0447959_49_903 270
51 3300048909 Ga0496106_0141153 Ga0496106_0141153_893_1747 270
52 3300048911 Ga0496108_0096863 Ga0496108_0096863_620_1474 270
53 3300048915 Ga0496112_0188541 Ga0496112_0188541_936_1790 270
54 3300025304 Ga0209257_1000197 Ga0209257_100019789 273
55 3300005347 Ga0070668_100069718 Ga0070668_1000697181 274
56 3300049568 Ga0501031_0122350 Ga0501031_0122350_484_1323 276
57 iso_pu_bacteria 8003014200 8003015182 276
58 3300015262 Ga0182007_10000026 Ga0182007_10000026136 278
59 3300015265 Ga0182005_1000379 Ga0182005_10003793 278
60 3300025925 Ga0207650_10298284 Ga0207650_102982842 278
61 3300038705 Ga0237819_00065 Ga0237819_00065_8285_9148 278
62 3300046539 Ga0495621_0115258 Ga0495621_0115258_17_862 278
63 3300048919 Ga0496116_0079175 Ga0496116_0079175_686_1552 278
64 3300048927 Ga0496124_0018239 Ga0496124_0018239_3561_4427 278
65 iso_pu_bacteria 2894414249 2894417903 278
66 3300009979 Ga0105032_105742 Ga0105032_1057421 279
67 3300032002 Ga0307416_100307432 Ga0307416_1003074321 279
68 3300050491 nmdc:mga00v17_29051_c1 nmdc:mga00v17_29051_c1_2094_2960 279
69 3300003856 Ga0058692_1000013 Ga0058692_100001332 280
70 3300025294 Ga0209025_1045053 Ga0209025_10450532 280
71 3300025298 Ga0209050_1029744 Ga0209050_10297441 280
72 3300041404 Ga0439436_0018515 Ga0439436_0018515_497_1342 280
73 3300041413 Ga0439465_0005726 Ga0439465_0005726_2062_2907 280
74 3300042007 Ga0439449_0120320 Ga0439449_0120320_87_932 280
75 3300046460 Ga0495638_0044852 Ga0495638_0044852_69_914 280
76 3300032004 Ga0307414_10017843 Ga0307414_100178432 281
77 3300041453 Ga0451797_0154159 Ga0451797_0154159_255_1109 281
78 3300041453 Ga0451797_0868936 Ga0451797_0868936_87_941 281
79 3300041494 Ga0451837_1419908 Ga0451837_1419908_1165_2019 281
80 3300041509 Ga0451843_0364753 Ga0451843_0364753_1309_2163 281
81 3300041509 Ga0451843_1379205 Ga0451843_1379205_403_1257 281
82 3300003320 rootH2_10038096 rootH2_100380962 282
83 3300003323 rootH1_10248321 rootH1_102483211 282
84 3300003781 Ga0055536_1006384 Ga0055536_10063844 282
85 3300005288 Ga0065714_10088628 Ga0065714_100886282 282
86 3300005293 Ga0065715_10106040 Ga0065715_101060403 282
87 3300013102 Ga0157371_10001811 Ga0157371_100018113 282
88 3300015261 Ga0182006_1020400 Ga0182006_10204003 282
89 3300025292 Ga0209676_1000037 Ga0209676_1000037228 282
90 3300027665 Ga0209983_1002188 Ga0209983_10021886 282
91 3300027682 Ga0209971_1000995 Ga0209971_10009952 282
92 3300032004 Ga0307414_10129295 Ga0307414_101292952 282
93 3300041512 Ga0451853_2980789 Ga0451853_2980789_424_1290 282
94 3300046558 Ga0495633_0022298 Ga0495633_0022298_521_1387 282
95 3300048908 Ga0496105_0147423 Ga0496105_0147423_317_1183 282
96 3300048921 Ga0496118_0061539 Ga0496118_0061539_1523_2389 282
97 3300048922 Ga0496119_0000654 Ga0496119_0000654_2115_2981 282
98 3300048923 Ga0496120_0003725 Ga0496120_0003725_2125_2991 282
99 3300048928 Ga0496125_0047305 Ga0496125_0047305_2435_3301 282
100 3300048928 Ga0496125_0100087 Ga0496125_0100087_961_1821 282
101 3300048929 Ga0496126_0002641 Ga0496126_0002641_2100_2966 282
102 3300049683 Ga0501253_013135 Ga0501253_013135_307_1167 282
103 3300003781 Ga0055536_1007977 Ga0055536_10079774 283
104 3300003781 Ga0055536_1009052 Ga0055536_10090521 283
105 3300003784 Ga0055534_1000276 Ga0055534_100027618 283
106 3300006178 Ga0075367_10197018 Ga0075367_101970181 283
107 3300013100 Ga0157373_10063943 Ga0157373_100639433 283
108 3300013102 Ga0157371_10172036 Ga0157371_101720362 283
109 3300013104 Ga0157370_10038874 Ga0157370_100388741 283
110 3300014497 Ga0182008_10000279 Ga0182008_100002794 283
111 3300014497 Ga0182008_10038466 Ga0182008_100384663 283
112 3300025263 Ga0209565_1000023 Ga0209565_1000023155 283
113 3300025273 Ga0209673_1000116 Ga0209673_1000116135 283
114 3300025284 Ga0209130_1019076 Ga0209130_10190762 283
115 3300025291 Ga0209675_1000016 Ga0209675_1000016261 283
116 3300025292 Ga0209676_1000770 Ga0209676_100077026 283
117 3300025292 Ga0209676_1001488 Ga0209676_100148812 283
118 3300025295 Ga0209564_1000347 Ga0209564_100034752 283
119 3300025298 Ga0209050_1001150 Ga0209050_100115017 283
120 3300025298 Ga0209050_1002203 Ga0209050_10022035 283
121 3300025299 Ga0209256_1008914 Ga0209256_10089143 283
122 3300025303 Ga0209051_1012449 Ga0209051_10124494 283
123 3300025304 Ga0209257_1000868 Ga0209257_10008685 283
124 3300025735 Ga0207713_1043317 Ga0207713_10433172 283
125 3300030742 Ga0316183_1084551 Ga0316183_10845511 283
126 3300031824 Ga0307413_10152462 Ga0307413_101524622 283
127 3300031852 Ga0307410_10120382 Ga0307410_101203822 283
128 3300032004 Ga0307414_10104878 Ga0307414_101048782 283
129 3300032004 Ga0307414_10136832 Ga0307414_101368322 283
130 3300032005 Ga0307411_10055710 Ga0307411_100557102 283
131 3300032005 Ga0307411_10097460 Ga0307411_100974602 283
132 3300041498 Ga0451841_0238937 Ga0451841_0238937_221_1105 283
133 3300046460 Ga0495638_0003072 Ga0495638_0003072_2476_3360 283
134 3300046522 Ga0495643_0005074 Ga0495643_0005074_6029_6913 283
135 3300046660 Ga0495625_0036992 Ga0495625_0036992_2420_3304 283
136 3300047320 Ga0495672_0000724 Ga0495672_0000724_32129_33013 283
137 3300047472 Ga0495686_0007761 Ga0495686_0007761_928_1812 283
138 3300048919 Ga0496116_0060655 Ga0496116_0060655_948_1832 283
139 3300048920 Ga0496117_0009746 Ga0496117_0009746_4325_5209 283
140 3300048921 Ga0496118_0010949 Ga0496118_0010949_4357_5241 283
141 3300048921 Ga0496118_0015757 Ga0496118_0015757_4396_5280 283
142 3300048924 Ga0496121_0013278 Ga0496121_0013278_4348_5232 283
143 3300048926 Ga0496123_0014656 Ga0496123_0014656_1413_2297 283
144 3300048927 Ga0496124_0175014 Ga0496124_0175014_60_944 283
145 3300048928 Ga0496125_0013432 Ga0496125_0013432_1583_2467 283
146 3300048928 Ga0496125_0015098 Ga0496125_0015098_2474_3358 283
147 3300048929 Ga0496126_0209774 Ga0496126_0209774_221_1105 283
148 3300049652 Ga0501202_004781 Ga0501202_004781_1183_2043 283
149 3300049668 Ga0501233_013771 Ga0501233_013771_159_1019 283
150 3300049680 Ga0501250_006281 Ga0501250_006281_233_1093 283
151 3300049765 Ga0501268_005525 Ga0501268_005525_54_914 283
152 3300049767 Ga0501270_019327 Ga0501270_019327_134_994 283
153 iso_pu_bacteria 2571042365 2572254774 283
154 iso_pu_bacteria 2643221695 2644530496 283
155 iso_pu_bacteria 2919513703 2919515544 283
156 3300003771 Ga0055526_1004865 Ga0055526_10048654 284
157 3300003790 Ga0055528_1000121 Ga0055528_10001216 284
158 3300047447 Ga0495685_033433 Ga0495685_033433_873_1739 284
159 iso_pu_bacteria 2547132130 2547499665 284
160 iso_pu_bacteria 2747842428 2747948365 284
161 iso_pu_bacteria 2765235840 2765580238 284
162 iso_pu_bacteria 2816332141 2816518730 284
163 iso_pu_bacteria 2842391507 2842393787 284
164 iso_pu_bacteria 2852649853 2852652373 284
165 iso_pu_bacteria 2919134579 2919138694 284
166 iso_pu_bacteria 2961064222 2961066639 284
167 3300041452 Ga0451793_1376657 Ga0451793_1376657_231_1109 285
168 3300041459 Ga0451800_0129864 Ga0451800_0129864_388_1266 285
169 3300041462 Ga0451806_457889 Ga0451806_457889_506_1384 285
170 3300041463 Ga0451804_0110272 Ga0451804_0110272_107_985 285
171 3300041486 Ga0451807_0853383 Ga0451807_0853383_257_1135 285
172 3300046525 Ga0495663_0002146 Ga0495663_0002146_4594_5475 285
173 3300049571 Ga0501034_0039051 Ga0501034_0039051_2594_3553 285
174 3300027312 Ga0209371_1000007 Ga0209371_1000007713 286
175 3300030500 Ga0268256_1000008 Ga0268256_1000008238 286
176 3300030733 Ga0314311_1174004 Ga0314311_11740043 286
177 3300031456 Ga0307513_10004744 Ga0307513_100047446 286
178 3300031911 Ga0307412_10072132 Ga0307412_100721322 286
179 3300032004 Ga0307414_10032922 Ga0307414_100329222 286
180 3300032004 Ga0307414_10103646 Ga0307414_101036462 286
181 3300032004 Ga0307414_10136300 Ga0307414_101363002 286
182 3300032005 Ga0307411_10010178 Ga0307411_100101783 286
183 3300041404 Ga0439436_0009040 Ga0439436_0009040_744_1616 286
184 3300041404 Ga0439436_0019789 Ga0439436_0019789_569_1444 286
185 3300041413 Ga0439465_0005464 Ga0439465_0005464_2827_3714 286
186 3300041453 Ga0451797_0925954 Ga0451797_0925954_537_1424 286
187 3300042006 Ga0439432_003329 Ga0439432_003329_3364_4236 286
188 3300042007 Ga0439449_0002754 Ga0439449_0002754_24_896 286
189 3300042007 Ga0439449_0007871 Ga0439449_0007871_1466_2338 286
190 3300042007 Ga0439449_0022006 Ga0439449_0022006_1452_2339 286
191 3300046522 Ga0495643_0030209 Ga0495643_0030209_2071_2958 286
192 3300046525 Ga0495663_0000459 Ga0495663_0000459_9804_10691 286
193 3300046692 Ga0495671_0022133 Ga0495671_0022133_2233_3120 286
194 3300048927 Ga0496124_0031325 Ga0496124_0031325_1345_2232 286
195 3300048927 Ga0496124_0073300 Ga0496124_0073300_1269_2153 286
196 3300049663 Ga0501223_017105 Ga0501223_017105_188_1060 286
197 3300049673 Ga0501240_015866 Ga0501240_015866_115_987 286
198 3300049680 Ga0501250_001802 Ga0501250_001802_882_1754 286
199 3300049758 Ga0501241_022566 Ga0501241_022566_189_1061 286
200 3300049771 Ga0501274_003549 Ga0501274_003549_91_963 286
201 3300006051 Ga0075364_10173059 Ga0075364_101730592 287
202 3300013102 Ga0157371_10023009 Ga0157371_100230094 287
203 3300031824 Ga0307413_10061657 Ga0307413_100616572 287
204 3300048905 Ga0496102_0502692 Ga0496102_0502692_33_932 287
205 3300048927 Ga0496124_0036796 Ga0496124_0036796_3320_4204 287
206 iso_pu_bacteria 2643221559 2643815449 287
207 iso_pu_bacteria 2643221586 2643941262 287
208 iso_pu_bacteria 2643221612 2644079674 287
209 iso_pu_bacteria 2643221720 2644662975 287
210 iso_pu_bacteria 2643221727 2644696176 287
211 iso_pu_bacteria 2643221728 2644699868 287
212 iso_pu_bacteria 8021622325 8021625121 287
213 iso_pu_bacteria 8021648035 8021649452 287
214 3300013102 Ga0157371_10128529 Ga0157371_101285292 288
215 3300013104 Ga0157370_10025329 Ga0157370_100253293 288
216 3300013105 Ga0157369_10025150 Ga0157369_100251504 288
217 3300015261 Ga0182006_1015675 Ga0182006_10156752 288
218 3300017792 Ga0163161_10012380 Ga0163161_100123803 288
219 3300017792 Ga0163161_10138971 Ga0163161_101389711 288
220 3300025935 Ga0207709_10001141 Ga0207709_100011419 288
221 3300025972 Ga0207668_10037888 Ga0207668_100378882 288
222 3300030745 Ga0316182_1100347 Ga0316182_11003472 288
223 3300031824 Ga0307413_10025335 Ga0307413_100253352 288
224 3300031911 Ga0307412_10000894 Ga0307412_100008944 288
225 3300032004 Ga0307414_10018632 Ga0307414_100186323 288
226 3300041456 Ga0451795_1153928 Ga0451795_1153928_848_1750 288
227 3300041509 Ga0451843_0135032 Ga0451843_0135032_99_992 288
228 3300041509 Ga0451843_1511288 Ga0451843_1511288_173_1048 288
229 3300046460 Ga0495638_0035189 Ga0495638_0035189_1877_2779 288
230 3300046525 Ga0495663_0003051 Ga0495663_0003051_545_1429 288
231 3300046558 Ga0495633_0004096 Ga0495633_0004096_3649_4533 288
232 3300048919 Ga0496116_0001245 Ga0496116_0001245_25027_25911 288
233 3300048920 Ga0496117_0001951 Ga0496117_0001951_3251_4135 288
234 3300048921 Ga0496118_0001683 Ga0496118_0001683_3285_4169 288
235 3300048928 Ga0496125_0012161 Ga0496125_0012161_4558_5442 288
236 iso_pu_bacteria 2818991457 2819660941 288
237 3300042876 Ga0451577_0009134 Ga0451577_0009134_2888_3775 289
238 3300046518 Ga0495631_0003326 Ga0495631_0003326_2724_3608 289
239 iso_pu_bacteria 2747842501 2748016765 289
240 iso_pu_bacteria 2987605356 2987608504 289
241 iso_pu_bacteria 2576861471 2578457251 290
242 iso_pu_bacteria 2643221593 2643972999 290
243 iso_pu_bacteria 2842757796 2842759950 290
244 iso_pu_bacteria 2857442823 2857445210 290
245 iso_pu_bacteria 2874220319 2874222919 290
246 iso_pu_bacteria 2919089067 2919092877 290
247 iso_pu_bacteria 2928496128 2928499259 290
248 iso_pu_bacteria 2931380184 2931383618 290
249 iso_pu_bacteria 2937610967 2937614883 290
250 iso_pu_bacteria 2939589442 2939589534 290
251 iso_pu_bacteria 2939622612 2939626055 290
252 iso_pu_bacteria 2939626828 2939630566 290
253 iso_pu_bacteria 2941475908 2941478991 290
254 iso_pu_bacteria 2941489479 2941492250 290
255 iso_pu_bacteria 2961047084 2961049684 290
256 iso_pu_bacteria 2974307012 2974307892 290
257 iso_pu_bacteria 2977247770 2977248629 290
258 iso_pu_bacteria 2984514374 2984516903 290
259 iso_pu_bacteria 2995948881 2995949975 290
260 3300006051 Ga0075364_10001001 Ga0075364_100010019 291
261 3300041404 Ga0439436_0030437 Ga0439436_0030437_472_1359 291
262 3300041406 Ga0439439_0004163 Ga0439439_0004163_307_1194 291
263 3300050491 nmdc:mga00v17_1016_c1 nmdc:mga00v17_1016_c1_12296_13174 291
264 3300053161 Ga0500634_0000677 Ga0500634_0000677_8615_9493 292
265 3300046525 Ga0495663_0039373 Ga0495663_0039373_291_1196 293
266 3300046616 Ga0495668_0006263 Ga0495668_0006263_618_1523 293
267 3300048925 Ga0496122_0002986 Ga0496122_0002986_6111_6995 293
268 3300048926 Ga0496123_0002440 Ga0496123_0002440_6141_7025 293
269 3300049571 Ga0501034_0063582 Ga0501034_0063582_2110_2991 293
270 3300002773 JGI25152J39213_1000041 JGI25152J39213_100004145 294
271 3300002774 JGI25150J39212_1000109 JGI25150J39212_10001095 294
272 3300003187 JGI25151J46595_10000141 JGI25151J46595_1000014138 294
273 3300003187 JGI25151J46595_10000347 JGI25151J46595_1000034740 294
274 3300003215 JGI25153J46596_10000106 JGI25153J46596_1000010638 294
275 3300003322 rootL2_10178006 rootL2_101780062 294
276 3300003771 Ga0055526_1000240 Ga0055526_100024028 294
277 3300003773 Ga0055537_1000841 Ga0055537_10008411 294
278 3300003775 Ga0055524_1000754 Ga0055524_100075411 294
279 3300003784 Ga0055534_1000002 Ga0055534_1000002355 294
280 3300003790 Ga0055528_1000789 Ga0055528_100078911 294
281 3300015689 Ga0183360_10001 Ga0183360_100013054 294
282 3300025245 Ga0207425_1000084 Ga0207425_100008449 294
283 3300025258 Ga0209129_1000057 Ga0209129_1000057179 294
284 3300025263 Ga0209565_1000001 Ga0209565_1000001802 294
285 3300025273 Ga0209673_1000001 Ga0209673_1000001802 294
286 3300025291 Ga0209675_1000001 Ga0209675_10000011731 294
287 3300025294 Ga0209025_1000006 Ga0209025_1000006292 294
288 3300025294 Ga0209025_1000013 Ga0209025_1000013246 294
289 3300025295 Ga0209564_1000001 Ga0209564_10000011893 294
290 3300025297 Ga0209758_1000014 Ga0209758_1000014246 294
291 3300025299 Ga0209256_1000006 Ga0209256_1000006329 294
292 3300031901 Ga0307406_10009417 Ga0307406_100094172 294
293 3300031901 Ga0307406_10018607 Ga0307406_100186072 294
294 3300048924 Ga0496121_0010250 Ga0496121_0010250_2131_3057 294
295 3300049513 Ga0501290_002757 Ga0501290_002757_740_1645 294
296 3300049762 Ga0501265_007999 Ga0501265_007999_131_1036 294
297 3300049772 Ga0501275_001205 Ga0501275_001205_1438_2343 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13512

TPR_18

Tetratricopeptide repeat

65

209

0.97

PF13525

YfiO

Outer membrane lipoprotein

70

279

0.97

PF13174

TPR_6

Tetratricopeptide repeat

112

144

0.93

PF13174

TPR_6

Tetratricopeptide repeat

77

105

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r1w-assembly1.cif.gz_D e. coli bam complex (bamabcde) bound to dynobactin a 0.9254 40 253
6lys-assembly1.cif.gz_D structure of the bam complex 0.9203 42 253
7tt1-assembly1.cif.gz_D bamabcde bound to substrate espp class 4 0.912 42 253
6lyr-assembly1.cif.gz_D structure of the bam complex 0.9076 40 253
2xev-assembly1.cif.gz_A crystal structure of the tpr domain of xanthomonas campestris ybgf 0.9055 46 181
ID Description Score Start End Superfamily
2xevB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9142 46 182 1.25.40.10
2xevA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9055 46 181 1.25.40.10
af_G3UYY4_1546_1623_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8955 80 172 1.25.40.10
af_Q86TZ1_175_262_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8928 42 129 1.25.40.10
af_O96215_2_106_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8919 43 129 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2X2C323-F1-model_v4 Outer membrane protein assembly complex subunit YfiO 0.9516 48 187
AF-A0A7C4YYS4-F1-model_v4 Tol-pal system protein YbgF 0.9486 40 184 GO:0051301
AF-A0A1Q3NPH6-F1-model_v4 Outer membrane protein assembly factor BamD 0.9399 52 254 GO:0009279
AF-A0A855HRQ6-F1-model_v4 deleted 0.9387 56 254
AF-A0A2X2C323-F1-model_v4 Outer membrane protein assembly complex subunit YfiO 0.9322 48 187

Feature Viewer

pLDDT pTM Quality
80.69 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map