F393304

General Info

Members Datasets Scaffolds Average Seq Length
296 212 293 149

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0359750|Ga0395905_0359750_304_813
Length 169
Sequence MSSSSQQAEKXXXXKSAAQLDGKGVVITCPSCGQRNRIAFARLGGENRCGKCHTTLSLPREPLEVPDAPSFDALVAGSALPVVVDFWAPWCGPCHMVAPEIARVAASNAGKFLVVKVNTDAIPELGDRLTIRSIPTMAVFAGGREVSRTAGARPAADIEAFVSQALQKR

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
3 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
155 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
156 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
157 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
158 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
159 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 1.01
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 4.39
Rhizosphere 87.84
Stem 0
Stem Tuber 0.34
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010154 3300002067 Bacteria 3008
2 JGI24751J29686_10113807 3300002459 Bacteria 567
3 JGI25159J45721_1002586 3300002987 Bacteria 6783
4 Ga0065165_1000612 3300005262 Bacteria 51854
5 Ga0065714_10086148 3300005288 Bacteria 2103
6 Ga0065712_10000229 3300005290 Bacteria 19853
7 Ga0065707_10576873 3300005295 Bacteria 704
8 Ga0070658_11084035 3300005327 Bacteria 697
9 Ga0068869_100527942 3300005334 Bacteria 989
10 Ga0070682_100309854 3300005337 Bacteria 1162
11 Ga0070661_100033248 3300005344 Bacteria 3735
12 Ga0070661_100114533 3300005344 Bacteria 2016
13 Ga0070669_100726312 3300005353 Bacteria 840
14 Ga0070688_100190346 3300005365 Bacteria 1429
15 Ga0070659_100023505 3300005366 Bacteria 4717
16 Ga0070703_10133164 3300005406 Bacteria 915
17 Ga0070714_100101450 3300005435 Bacteria 2536
18 Ga0070713_100651444 3300005436 Bacteria 1003
19 Ga0070710_10292126 3300005437 Bacteria 1061
20 Ga0070700_100696888 3300005441 Bacteria 807
21 Ga0070694_101426618 3300005444 Bacteria 585
22 Ga0070662_100156927 3300005457 Bacteria 1777
23 Ga0070681_10086927 3300005458 Bacteria 3079
24 Ga0070681_10542920 3300005458 Bacteria 1076
25 Ga0070706_100369778 3300005467 Bacteria 1336
26 Ga0070706_100475086 3300005467 Bacteria 1163
27 Ga0070707_100210296 3300005468 Bacteria 1896
28 Ga0070699_100306482 3300005518 Bacteria 1425
29 Ga0070699_100662132 3300005518 Bacteria 953
30 Ga0070684_100755170 3300005535 Bacteria 908
31 Ga0070697_100035745 3300005536 Bacteria 4010
32 Ga0068853_100029907 3300005539 Bacteria 4596
33 Ga0070672_100551284 3300005543 Bacteria 1001
34 Ga0070695_100017096 3300005545 Unclassified 4400
35 Ga0070696_100361492 3300005546 Unclassified 1127
36 Ga0070696_100385485 3300005546 Bacteria 1093
37 Ga0070696_100396050 3300005546 Bacteria 1079
38 Ga0070704_100172447 3300005549 Bacteria 1722
39 Ga0068855_100007994 3300005563 Bacteria 12776
40 Ga0068855_100226196 3300005563 Bacteria 2097
41 Ga0068855_100314069 3300005563 Bacteria 1733
42 Ga0070664_100104879 3300005564 Bacteria 2462
43 Ga0070664_101304714 3300005564 Bacteria 686
44 Ga0068857_100129764 3300005577 Bacteria 2273
45 Ga0068854_100000397 3300005578 Bacteria 27362
46 Ga0068852_100004484 3300005616 Bacteria 9866
47 Ga0068852_100337989 3300005616 Bacteria 1467
48 Ga0068859_100012598 3300005617 Bacteria 8504
49 Ga0068864_100673268 3300005618 Bacteria 1009
50 Ga0068861_100007820 3300005719 Bacteria 7348
51 Ga0068861_100086107 3300005719 Bacteria 2470
52 Ga0068860_101570398 3300005843 Bacteria 680
53 Ga0068862_100208395 3300005844 Bacteria 1765
54 Ga0068862_100609812 3300005844 Bacteria 1049
55 Ga0075368_10383345 3300006042 Bacteria 616
56 Ga0075363_100081833 3300006048 Bacteria 1766
57 Ga0075364_10005768 3300006051 Bacteria 7223
58 Ga0075364_10032950 3300006051 Bacteria 3333
59 Ga0075362_10088054 3300006177 Bacteria 1438
60 Ga0075367_10038828 3300006178 Bacteria 2773
61 Ga0075367_10168796 3300006178 Bacteria 1362
62 Ga0075366_10028451 3300006195 Bacteria 3280
63 Ga0075428_101932090 3300006844 Bacteria 613
64 Ga0075430_100033709 3300006846 Bacteria 4345
65 Ga0075431_100016336 3300006847 Bacteria 7529
66 Ga0075431_100029567 3300006847 Bacteria 5641
67 Ga0075431_100185179 3300006847 Bacteria 2135
68 Ga0075433_10242799 3300006852 Bacteria 1599
69 Ga0075434_100171874 3300006871 Bacteria 2187
70 Ga0075434_100489176 3300006871 Bacteria 1251
71 Ga0075429_100029013 3300006880 Bacteria 4804
72 Ga0075429_100070573 3300006880 Bacteria 3042
73 Ga0075429_100144110 3300006880 Bacteria 2085
74 Ga0068865_100214720 3300006881 Bacteria 1501
75 Ga0097620_100012599 3300006931 Bacteria 8504
76 Ga0105244_10000700 3300009036 Bacteria 29092
77 Ga0105240_10015934 3300009093 Bacteria 10195
78 Ga0105240_10027310 3300009093 Bacteria 7474
79 Ga0111539_10004378 3300009094 Bacteria 18479
80 Ga0111539_10039046 3300009094 Bacteria 5725
81 Ga0111539_10353543 3300009094 Bacteria 1710
82 Ga0114129_10046517 3300009147 Bacteria 6098
83 Ga0114129_10272680 3300009147 Bacteria 2263
84 Ga0105243_11103517 3300009148 Bacteria 802
85 Ga0105237_10488643 3300009545 Bacteria 1237
86 Ga0105238_10057368 3300009551 Bacteria 3904
87 Ga0105249_10109308 3300009553 Bacteria 2611
88 Ga0105249_12556347 3300009553 Bacteria 583
89 Ga0157317_1007262 3300012475 Bacteria 791
90 Ga0157373_10652326 3300013100 Bacteria 769
91 Ga0157373_11146172 3300013100 Unclassified 584
92 Ga0157371_10269395 3300013102 Bacteria 1229
93 Ga0157369_10001974 3300013105 Bacteria 24742
94 Ga0157369_10061958 3300013105 Bacteria 4031
95 Ga0157378_11582315 3300013297 Bacteria 701
96 Ga0163162_11325357 3300013306 Bacteria 818
97 Ga0163162_12202305 3300013306 Bacteria 633
98 Ga0157372_10000388 3300013307 Bacteria 48764
99 Ga0157372_11300729 3300013307 Bacteria 839
100 Ga0163163_10975685 3300014325 Bacteria 911
101 Ga0157380_10138307 3300014326 Bacteria 2088
102 Ga0182008_10226764 3300014497 Bacteria 957
103 Ga0157377_10013346 3300014745 Bacteria 4158
104 Ga0157376_10933899 3300014969 Bacteria 887
105 Ga0209130_1000078 3300025284 Bacteria 169374
106 Ga0207692_10206221 3300025898 Bacteria 1158
107 Ga0207695_10009666 3300025913 Bacteria 11882
108 Ga0207695_10136447 3300025913 Bacteria 2406
109 Ga0207660_10381144 3300025917 Bacteria 1133
110 Ga0207649_10070603 3300025920 Bacteria 2228
111 Ga0207681_10570579 3300025923 Bacteria 933
112 Ga0207694_10256556 3300025924 Bacteria 1432
113 Ga0207659_10810410 3300025926 Bacteria 804
114 Ga0207706_10231635 3300025933 Bacteria 1616
115 Ga0207706_10276723 3300025933 Bacteria 1464
116 Ga0207670_10581162 3300025936 Bacteria 918
117 Ga0207669_10804136 3300025937 Bacteria 780
118 Ga0207704_10490879 3300025938 Bacteria 988
119 Ga0207689_10114136 3300025942 Bacteria 2220
120 Ga0207667_10000082 3300025949 Bacteria 157749
121 Ga0207667_10393537 3300025949 Bacteria 1411
122 Ga0207712_10095199 3300025961 Bacteria 2201
123 Ga0207712_11766164 3300025961 Bacteria 554
124 Ga0207640_10000018 3300025981 Bacteria 193664
125 Ga0207639_10015647 3300026041 Bacteria 5353
126 Ga0207708_10490838 3300026075 Bacteria 1028
127 Ga0207702_10149244 3300026078 Bacteria 2125
128 Ga0207675_100134251 3300026118 Bacteria 2347
129 Ga0207675_100167771 3300026118 Unclassified 2097
130 Ga0207698_10001847 3300026142 Bacteria 12367
131 Ga0207428_10272595 3300027907 Bacteria 1258
132 Ga0268265_10508590 3300028380 Bacteria 1136
133 Ga0268264_12069116 3300028381 Bacteria 578
134 Ga0307515_10132455 3300028794 Bacteria 2735
135 Ga0307513_10002184 3300031456 Bacteria 27365
136 Ga0316575_10047196 3300031665 Bacteria 1712
137 Ga0316575_10234469 3300031665 Bacteria 768
138 Ga0316579_10009075 3300031691 Bacteria 4173
139 Ga0316579_10014822 3300031691 Bacteria 3378
140 Ga0316579_10025385 3300031691 Bacteria 2674
141 Ga0316579_10026312 3300031691 Bacteria 2633
142 Ga0316576_10093910 3300031727 Bacteria 2236
143 Ga0316576_10239262 3300031727 Bacteria 1364
144 Ga0316578_10360249 3300031728 Bacteria 865
145 Ga0307405_10263625 3300031731 Bacteria 1288
146 Ga0307405_11646522 3300031731 Bacteria 567
147 Ga0316577_10110502 3300031733 Bacteria 1542
148 Ga0316577_10184131 3300031733 Bacteria 1180
149 Ga0307413_10615080 3300031824 Bacteria 891
150 Ga0307410_10358659 3300031852 Bacteria 1167
151 Ga0307410_11261384 3300031852 Bacteria 645
152 Ga0307412_10024900 3300031911 Bacteria 3700
153 Ga0307409_100056673 3300031995 Archaea 3032
154 Ga0307416_100102921 3300032002 Bacteria 2491
155 Ga0307416_101896037 3300032002 Bacteria 699
156 Ga0307416_103174981 3300032002 Bacteria 550
157 Ga0307414_10130203 3300032004 Archaea 1952
158 Ga0307414_11542239 3300032004 Bacteria 619
159 Ga0307415_100405377 3300032126 Bacteria 1165
160 Ga0316593_10214724 3300032168 Bacteria 714
161 Ga0316596_1057511 3300033541 Bacteria 1035
162 Ga0316596_1102522 3300033541 Bacteria 774
163 Ga0373944_0132813 3300035089 Bacteria 866
164 Ga0373945_0092222 3300035116 Bacteria 1174
165 Ga0373946_0045656 3300035171 Bacteria 1813
166 Ga0373931_0293380 3300035691 Unclassified 1002
167 Ga0373927_0512009 3300035695 Bacteria 793
168 Ga0373947_0004739 3300035725 Bacteria 7977
169 Ga0373947_0229656 3300035725 Bacteria 1222
170 Ga0316582_0533646 3300036647 Bacteria 808
171 Ga0316582_0582918 3300036647 Bacteria 770
172 Ga0316584_0002704 3300036712 Bacteria 11328
173 Ga0316584_0601907 3300036712 Bacteria 762
174 Ga0395898_0097552 3300037466 Bacteria 2823
175 Ga0395905_0359750 3300037471 Bacteria 1348
176 Ga0395901_0081138 3300038443 Bacteria 3388
177 Ga0439431_0014758 3300041997 Bacteria 1814
178 Ga0439448_0057618 3300042005 Bacteria 1280
179 Ga0439450_123811 3300042008 Bacteria 667
180 Ga0450923_011165 3300042125 Bacteria 1610
181 Ga0450896_060954 3300042133 Bacteria 614
182 Ga0439446_0035436 3300042156 Bacteria 1456
183 Ga0439459_0053531 3300042438 Bacteria 893
184 Ga0439460_0159779 3300042461 Bacteria 755
185 Ga0453683_0116934 3300044673 Bacteria 1678
186 Ga0451576_0037331 3300045051 Bacteria 5147
187 Ga0451576_0284788 3300045051 Bacteria 1728
188 Ga0451576_1560189 3300045051 Bacteria 685
189 Ga0495583_0000117 3300046506 Bacteria 135061
190 Ga0495581_0310259 3300047315 Bacteria 922
191 Ga0495686_0001443 3300047472 Bacteria 25925
192 Ga0496101_1225616 3300048904 Bacteria 588
193 Ga0496102_0087595 3300048905 Bacteria 2877
194 Ga0496102_0655488 3300048905 Bacteria 973
195 Ga0496102_0931820 3300048905 Bacteria 790
196 Ga0496104_0210117 3300048907 Bacteria 1858
197 Ga0496104_0494719 3300048907 Bacteria 1134
198 Ga0496105_0337634 3300048908 Bacteria 1205
199 Ga0496108_0231081 3300048911 Bacteria 1608
200 Ga0496109_0082607 3300048912 Bacteria 2961
201 Ga0496109_0645938 3300048912 Bacteria 995
202 Ga0496109_1560427 3300048912 Bacteria 595
203 Ga0496110_1568398 3300048913 Bacteria 568
204 Ga0496113_0098789 3300048916 Bacteria 2260
205 Ga0495678_161973 3300049459 Bacteria 714
206 Ga0501292_002235 3300049515 Archaea 2478
207 Ga0501296_006138 3300049519 Bacteria 1355
208 Ga0501297_026787 3300049520 Bacteria 749
209 Ga0501298_003716 3300049521 Archaea 2376
210 Ga0501299_020635 3300049522 Bacteria 1202
211 Ga0501300_012478 3300049523 Bacteria 1238
212 Ga0501033_0399245 3300049570 Bacteria 959
213 Ga0501034_0066049 3300049571 Bacteria 3631
214 Ga0501034_0258288 3300049571 Bacteria 1685
215 Ga0501038_0474429 3300049574 Bacteria 959
216 Ga0501039_0521692 3300049575 Bacteria 933
217 Ga0501039_0798104 3300049575 Bacteria 736
218 Ga0501040_0013198 3300049576 Bacteria 5433
219 Ga0501040_0086441 3300049576 Bacteria 2177
220 Ga0501041_0024922 3300049577 Bacteria 3593
221 Ga0501041_0043225 3300049577 Bacteria 2739
222 Ga0501042_0000606 3300049578 Bacteria 19118
223 Ga0501042_0361340 3300049578 Bacteria 1051
224 Ga0501046_1190252 3300049580 Bacteria 524
225 Ga0501047_0617138 3300049581 Bacteria 905
226 Ga0501048_0111168 3300049582 Bacteria 1934
227 Ga0501048_0214122 3300049582 Bacteria 1366
228 Ga0501071_0524596 3300049587 Bacteria 909
229 Ga0501071_0757999 3300049587 Bacteria 748
230 Ga0501072_0139802 3300049588 Bacteria 1930
231 Ga0501075_0057277 3300049591 Bacteria 2934
232 Ga0501075_0066598 3300049591 Bacteria 2718
233 Ga0501075_0683502 3300049591 Bacteria 782
234 Ga0501076_0070953 3300049592 Bacteria 2786
235 Ga0501076_0266861 3300049592 Bacteria 1401
236 Ga0501076_0602624 3300049592 Bacteria 906
237 Ga0501077_0054980 3300049593 Bacteria 2528
238 Ga0501077_0410990 3300049593 Bacteria 865
239 Ga0501202_025043 3300049652 Bacteria 1213
240 Ga0501216_003523 3300049660 Archaea 2285
241 Ga0501217_011359 3300049661 Archaea 1969
242 Ga0501223_024905 3300049663 Bacteria 1164
243 Ga0501227_040780 3300049665 Bacteria 1146
244 Ga0501233_019808 3300049668 Bacteria 1430
245 Ga0501243_063817 3300049675 Bacteria 688
246 Ga0501249_010730 3300049679 Archaea 1919
247 Ga0501259_014741 3300049688 Bacteria 1328
248 Ga0501221_016245 3300049704 Bacteria 1407
249 Ga0501225_0038290 3300049705 Bacteria 1321
250 Ga0501079_0074690 3300049741 Bacteria 2621
251 Ga0501079_0136115 3300049741 Bacteria 1913
252 Ga0501080_0112745 3300049742 Bacteria 2521
253 Ga0501081_0012890 3300049743 Bacteria 5498
254 Ga0501081_1187684 3300049743 Bacteria 578
255 Ga0501265_005279 3300049762 Bacteria 1485
256 Ga0501283_047677 3300049779 Bacteria 754
257 Ga0501044_1034660 3300049823 Bacteria 692
258 Ga0501045_0412493 3300049824 Bacteria 1005
259 Ga0501212_003324 3300049851 Archaea 2010
260 nmdc:mga03n38_69729_c1 3300050490 Bacteria 1624
261 nmdc:mga00v17_35164_c1 3300050491 Bacteria 2980
262 nmdc:mga00v17_48163_c1 3300050491 Bacteria 2583
263 nmdc:mga0k408_27106_c1 3300050493 Bacteria 3252
264 nmdc:mga06z11_19988_c1 3300050494 Bacteria 3089
265 nmdc:mga04h51_31314_c1 3300050495 Bacteria 1680
266 nmdc:mga05p37_288157_c1 3300050507 Bacteria 1955
267 nmdc:mga05p37_435527_c1 3300050507 Bacteria 1522
268 nmdc:mga09592_11610_c1 3300050508 Bacteria 7162
269 nmdc:mga09592_264020_c1 3300050508 Bacteria 1493
270 nmdc:mga09592_4081_c1 3300050508 Bacteria 11792
271 nmdc:mga09592_925258_c1 3300050508 Bacteria 732
272 nmdc:mga0qj67_116217_c1 3300050509 Bacteria 2162
273 nmdc:mga0qj67_144693_c1 3300050509 Bacteria 1927
274 nmdc:mga0qj67_71303_c1 3300050509 Bacteria 2773
275 nmdc:mga06r32_371206_c1 3300050510 Bacteria 1414
276 nmdc:mga06r32_5303_c1 3300050510 Bacteria 11604
277 nmdc:mga06r32_68877_c1 3300050510 Bacteria 3419
278 nmdc:mga06r32_76325_c1 3300050510 Bacteria 3254
279 nmdc:mga08y16_206110_c1 3300050511 Bacteria 2037
280 nmdc:mga08y16_251323_c1 3300050511 Bacteria 1827
281 nmdc:mga08y16_461_c1 3300050511 Bacteria 37939
282 nmdc:mga08y16_873744_c1 3300050511 Bacteria 887
283 nmdc:mga0n895_549280_c1 3300050512 Bacteria 1161
284 nmdc:mga0a205_853437_c1 3300050515 Bacteria 758
285 Ga0495619_0034431 3300053085 Bacteria 3293
286 Ga0500559_0189928 3300053136 Bacteria 968
287 Ga0500636_0366682 3300053177 Bacteria 681
288 Ga0501084_0091263 3300054114 Bacteria 2558
289 Ga0590077_013187 3300059426 Bacteria 1718
290 Ga0501082_0348386 3300060353 Bacteria 1291
291 Ga0501082_1095855 3300060353 Bacteria 696
292 Ga0530510_0146856 3300061734 Bacteria 1740
293 Ga0530510_0231221 3300061734 Bacteria 1375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_1225616 Ga0496101_1225616_16_384 122
2 3300049519 Ga0501296_006138 Ga0501296_006138_819_1220 123
3 3300049523 Ga0501300_012478 Ga0501300_012478_784_1185 123
4 3300031728 Ga0316578_10360249 Ga0316578_103602491 126
5 3300050508 nmdc:mga09592_925258_c1 nmdc:mga09592_925258_c1_306_704 127
6 3300014325 Ga0163163_10975685 Ga0163163_109756851 128
7 3300048912 Ga0496109_0645938 Ga0496109_0645938_481_909 128
8 3300005546 Ga0070696_100385485 Ga0070696_1003854851 130
9 3300009094 Ga0111539_10039046 Ga0111539_100390467 130
10 3300009147 Ga0114129_10046517 Ga0114129_100465176 130
11 3300013306 Ga0163162_12202305 Ga0163162_122023051 130
12 3300014745 Ga0157377_10013346 Ga0157377_100133465 130
13 3300028381 Ga0268264_12069116 Ga0268264_120691161 130
14 3300031731 Ga0307405_11646522 Ga0307405_116465221 130
15 3300036647 Ga0316582_0533646 Ga0316582_0533646_144_536 130
16 3300048911 Ga0496108_0231081 Ga0496108_0231081_1091_1489 130
17 3300048912 Ga0496109_0082607 Ga0496109_0082607_2149_2547 130
18 3300048916 Ga0496113_0098789 Ga0496113_0098789_633_1031 130
19 3300050508 nmdc:mga09592_264020_c1 nmdc:mga09592_264020_c1_228_626 130
20 3300050511 nmdc:mga08y16_251323_c1 nmdc:mga08y16_251323_c1_522_920 130
21 3300050515 nmdc:mga0a205_853437_c1 nmdc:mga0a205_853437_c1_203_601 130
22 3300005467 Ga0070706_100369778 Ga0070706_1003697781 131
23 3300005536 Ga0070697_100035745 Ga0070697_1000357452 131
24 3300005545 Ga0070695_100017096 Ga0070695_1000170962 131
25 3300005549 Ga0070704_100172447 Ga0070704_1001724472 131
26 3300005719 Ga0068861_100007820 Ga0068861_1000078208 131
27 3300026118 Ga0207675_100167771 Ga0207675_1001677712 131
28 3300049459 Ga0495678_161973 Ga0495678_161973_15_413 131
29 3300032002 Ga0307416_103174981 Ga0307416_1031749811 132
30 3300005436 Ga0070713_100651444 Ga0070713_1006514441 135
31 iso_pu_bacteria 2854601825 2854603892 135
32 3300031824 Ga0307413_10615080 Ga0307413_106150802 136
33 3300032002 Ga0307416_100102921 Ga0307416_1001029212 136
34 3300049521 Ga0501298_003716 Ga0501298_003716_607_1065 136
35 3300049660 Ga0501216_003523 Ga0501216_003523_996_1454 136
36 3300049668 Ga0501233_019808 Ga0501233_019808_879_1337 136
37 3300049704 Ga0501221_016245 Ga0501221_016245_177_635 136
38 3300049762 Ga0501265_005279 Ga0501265_005279_446_904 136
39 iso_pu_bacteria 2884086401 2884087577 136
40 3300005546 Ga0070696_100361492 Ga0070696_1003614922 137
41 3300049580 Ga0501046_1190252 Ga0501046_1190252_14_442 137
42 3300037466 Ga0395898_0097552 Ga0395898_0097552_268_729 138
43 3300038443 Ga0395901_0081138 Ga0395901_0081138_1229_1690 138
44 iso_pu_bacteria 2643221654 2644302177 138
45 3300005406 Ga0070703_10133164 Ga0070703_101331641 140
46 3300005441 Ga0070700_100696888 Ga0070700_1006968882 140
47 3300009036 Ga0105244_10000700 Ga0105244_100007008 140
48 3300009147 Ga0114129_10272680 Ga0114129_102726802 140
49 3300013297 Ga0157378_11582315 Ga0157378_115823151 140
50 3300013306 Ga0163162_11325357 Ga0163162_113253571 140
51 3300013307 Ga0157372_11300729 Ga0157372_113007292 140
52 3300026075 Ga0207708_10490838 Ga0207708_104908382 140
53 3300048905 Ga0496102_0931820 Ga0496102_0931820_281_736 140
54 3300048907 Ga0496104_0210117 Ga0496104_0210117_650_1072 140
55 3300048912 Ga0496109_1560427 Ga0496109_1560427_14_436 140
56 3300050507 nmdc:mga05p37_288157_c1 nmdc:mga05p37_288157_c1_78_533 140
57 3300050508 nmdc:mga09592_4081_c1 nmdc:mga09592_4081_c1_11015_11470 140
58 3300050509 nmdc:mga0qj67_71303_c1 nmdc:mga0qj67_71303_c1_781_1236 140
59 3300050510 nmdc:mga06r32_5303_c1 nmdc:mga06r32_5303_c1_395_850 140
60 3300012475 Ga0157317_1007262 Ga0157317_10072622 141
61 3300053136 Ga0500559_0189928 Ga0500559_0189928_389_823 141
62 3300005344 Ga0070661_100033248 Ga0070661_1000332484 142
63 3300005435 Ga0070714_100101450 Ga0070714_1001014503 142
64 3300005437 Ga0070710_10292126 Ga0070710_102921262 142
65 3300005458 Ga0070681_10542920 Ga0070681_105429202 142
66 3300005535 Ga0070684_100755170 Ga0070684_1007551701 142
67 3300005539 Ga0068853_100029907 Ga0068853_1000299074 142
68 3300005563 Ga0068855_100226196 Ga0068855_1002261961 142
69 3300005616 Ga0068852_100004484 Ga0068852_1000044844 142
70 3300005616 Ga0068852_100337989 Ga0068852_1003379893 142
71 3300005844 Ga0068862_100609812 Ga0068862_1006098121 142
72 3300006847 Ga0075431_100029567 Ga0075431_1000295672 142
73 3300006880 Ga0075429_100029013 Ga0075429_1000290134 142
74 3300009093 Ga0105240_10015934 Ga0105240_100159344 142
75 3300009551 Ga0105238_10057368 Ga0105238_100573682 142
76 3300013102 Ga0157371_10269395 Ga0157371_102693952 142
77 3300013105 Ga0157369_10001974 Ga0157369_100019744 142
78 3300013307 Ga0157372_10000388 Ga0157372_1000038847 142
79 3300025898 Ga0207692_10206221 Ga0207692_102062212 142
80 3300025913 Ga0207695_10136447 Ga0207695_101364473 142
81 3300025920 Ga0207649_10070603 Ga0207649_100706031 142
82 3300025923 Ga0207681_10570579 Ga0207681_105705792 142
83 3300025924 Ga0207694_10256556 Ga0207694_102565563 142
84 3300025937 Ga0207669_10804136 Ga0207669_108041361 142
85 3300025949 Ga0207667_10393537 Ga0207667_103935371 142
86 3300026041 Ga0207639_10015647 Ga0207639_100156473 142
87 3300026078 Ga0207702_10149244 Ga0207702_101492442 142
88 3300026142 Ga0207698_10001847 Ga0207698_100018472 142
89 3300028794 Ga0307515_10132455 Ga0307515_101324553 142
90 3300031456 Ga0307513_10002184 Ga0307513_1000218416 142
91 3300031731 Ga0307405_10263625 Ga0307405_102636251 142
92 3300031852 Ga0307410_10358659 Ga0307410_103586592 142
93 3300031852 Ga0307410_11261384 Ga0307410_112613842 142
94 3300031911 Ga0307412_10024900 Ga0307412_100249004 142
95 3300031995 Ga0307409_100056673 Ga0307409_1000566733 142
96 3300032004 Ga0307414_10130203 Ga0307414_101302032 142
97 3300032004 Ga0307414_11542239 Ga0307414_115422391 142
98 3300032126 Ga0307415_100405377 Ga0307415_1004053771 142
99 3300042156 Ga0439446_0035436 Ga0439446_0035436_163_618 142
100 3300049515 Ga0501292_002235 Ga0501292_002235_434_892 142
101 3300049520 Ga0501297_026787 Ga0501297_026787_49_507 142
102 3300049522 Ga0501299_020635 Ga0501299_020635_732_1190 142
103 3300049574 Ga0501038_0474429 Ga0501038_0474429_226_687 142
104 3300049576 Ga0501040_0086441 Ga0501040_0086441_848_1309 142
105 3300049577 Ga0501041_0024922 Ga0501041_0024922_1558_2019 142
106 3300049582 Ga0501048_0214122 Ga0501048_0214122_580_1041 142
107 3300049588 Ga0501072_0139802 Ga0501072_0139802_1220_1681 142
108 3300049591 Ga0501075_0066598 Ga0501075_0066598_1952_2413 142
109 3300049592 Ga0501076_0266861 Ga0501076_0266861_804_1265 142
110 3300049593 Ga0501077_0410990 Ga0501077_0410990_135_596 142
111 3300049652 Ga0501202_025043 Ga0501202_025043_104_562 142
112 3300049661 Ga0501217_011359 Ga0501217_011359_636_1094 142
113 3300049663 Ga0501223_024905 Ga0501223_024905_571_1029 142
114 3300049665 Ga0501227_040780 Ga0501227_040780_583_1041 142
115 3300049675 Ga0501243_063817 Ga0501243_063817_220_678 142
116 3300049679 Ga0501249_010730 Ga0501249_010730_817_1275 142
117 3300049688 Ga0501259_014741 Ga0501259_014741_614_1072 142
118 3300049705 Ga0501225_0038290 Ga0501225_0038290_164_622 142
119 3300049743 Ga0501081_1187684 Ga0501081_1187684_54_524 142
120 3300049779 Ga0501283_047677 Ga0501283_047677_172_630 142
121 3300049851 Ga0501212_003324 Ga0501212_003324_784_1242 142
122 3300050511 nmdc:mga08y16_873744_c1 nmdc:mga08y16_873744_c1_363_830 142
123 3300053177 Ga0500636_0366682 Ga0500636_0366682_185_616 142
124 3300054114 Ga0501084_0091263 Ga0501084_0091263_1135_1596 142
125 3300060353 Ga0501082_0348386 Ga0501082_0348386_460_921 142
126 3300061734 Ga0530510_0146856 Ga0530510_0146856_379_840 142
127 3300005518 Ga0070699_100306482 Ga0070699_1003064822 143
128 3300009148 Ga0105243_11103517 Ga0105243_111035172 143
129 3300009553 Ga0105249_12556347 Ga0105249_125563471 143
130 3300014326 Ga0157380_10138307 Ga0157380_101383074 143
131 3300014969 Ga0157376_10933899 Ga0157376_109338991 143
132 3300025961 Ga0207712_11766164 Ga0207712_117661642 143
133 3300032002 Ga0307416_101896037 Ga0307416_1018960371 143
134 3300042133 Ga0450896_060954 Ga0450896_060954_60_521 143
135 3300049578 Ga0501042_0361340 Ga0501042_0361340_552_1007 143
136 3300049587 Ga0501071_0524596 Ga0501071_0524596_83_538 143
137 3300049592 Ga0501076_0602624 Ga0501076_0602624_349_804 143
138 3300049741 Ga0501079_0136115 Ga0501079_0136115_545_1000 143
139 3300049824 Ga0501045_0412493 Ga0501045_0412493_512_967 143
140 3300059426 Ga0590077_013187 Ga0590077_013187_782_1240 143
141 3300002459 JGI24751J29686_10113807 JGI24751J29686_101138071 144
142 3300002987 JGI25159J45721_1002586 JGI25159J45721_10025862 144
143 3300005262 Ga0065165_1000612 Ga0065165_100061218 144
144 3300005288 Ga0065714_10086148 Ga0065714_100861485 144
145 3300005290 Ga0065712_10000229 Ga0065712_1000022920 144
146 3300005295 Ga0065707_10576873 Ga0065707_105768731 144
147 3300005327 Ga0070658_11084035 Ga0070658_110840351 144
148 3300005334 Ga0068869_100527942 Ga0068869_1005279422 144
149 3300005365 Ga0070688_100190346 Ga0070688_1001903463 144
150 3300005444 Ga0070694_101426618 Ga0070694_1014266181 144
151 3300005543 Ga0070672_100551284 Ga0070672_1005512842 144
152 3300005564 Ga0070664_100104879 Ga0070664_1001048792 144
153 3300005564 Ga0070664_101304714 Ga0070664_1013047142 144
154 3300005617 Ga0068859_100012598 Ga0068859_1000125987 144
155 3300005618 Ga0068864_100673268 Ga0068864_1006732682 144
156 3300005719 Ga0068861_100086107 Ga0068861_1000861072 144
157 3300005843 Ga0068860_101570398 Ga0068860_1015703982 144
158 3300005844 Ga0068862_100208395 Ga0068862_1002083955 144
159 3300006844 Ga0075428_101932090 Ga0075428_1019320901 144
160 3300006846 Ga0075430_100033709 Ga0075430_1000337093 144
161 3300006847 Ga0075431_100016336 Ga0075431_1000163363 144
162 3300006847 Ga0075431_100185179 Ga0075431_1001851794 144
163 3300006852 Ga0075433_10242799 Ga0075433_102427995 144
164 3300006871 Ga0075434_100489176 Ga0075434_1004891762 144
165 3300006880 Ga0075429_100070573 Ga0075429_1000705734 144
166 3300006880 Ga0075429_100144110 Ga0075429_1001441103 144
167 3300006881 Ga0068865_100214720 Ga0068865_1002147202 144
168 3300006931 Ga0097620_100012599 Ga0097620_1000125997 144
169 3300009094 Ga0111539_10004378 Ga0111539_100043788 144
170 3300025284 Ga0209130_1000078 Ga0209130_1000078105 144
171 3300025926 Ga0207659_10810410 Ga0207659_108104101 144
172 3300025933 Ga0207706_10276723 Ga0207706_102767233 144
173 3300025936 Ga0207670_10581162 Ga0207670_105811622 144
174 3300025938 Ga0207704_10490879 Ga0207704_104908792 144
175 3300025942 Ga0207689_10114136 Ga0207689_101141366 144
176 3300026118 Ga0207675_100134251 Ga0207675_1001342512 144
177 3300027907 Ga0207428_10272595 Ga0207428_102725951 144
178 3300028380 Ga0268265_10508590 Ga0268265_105085902 144
179 3300031665 Ga0316575_10234469 Ga0316575_102344691 144
180 3300031691 Ga0316579_10009075 Ga0316579_100090753 144
181 3300031691 Ga0316579_10014822 Ga0316579_100148222 144
182 3300031691 Ga0316579_10025385 Ga0316579_100253852 144
183 3300031691 Ga0316579_10026312 Ga0316579_100263124 144
184 3300031727 Ga0316576_10093910 Ga0316576_100939102 144
185 3300031733 Ga0316577_10184131 Ga0316577_101841311 144
186 3300032168 Ga0316593_10214724 Ga0316593_102147242 144
187 3300033541 Ga0316596_1057511 Ga0316596_10575112 144
188 3300035089 Ga0373944_0132813 Ga0373944_0132813_102_563 144
189 3300035116 Ga0373945_0092222 Ga0373945_0092222_680_1141 144
190 3300035171 Ga0373946_0045656 Ga0373946_0045656_893_1354 144
191 3300035695 Ga0373927_0512009 Ga0373927_0512009_61_522 144
192 3300035725 Ga0373947_0004739 Ga0373947_0004739_7044_7505 144
193 3300036712 Ga0316584_0601907 Ga0316584_0601907_208_642 144
194 3300042125 Ga0450923_011165 Ga0450923_011165_537_992 144
195 3300042438 Ga0439459_0053531 Ga0439459_0053531_324_791 144
196 3300044673 Ga0453683_0116934 Ga0453683_0116934_40_474 144
197 3300045051 Ga0451576_0037331 Ga0451576_0037331_1553_1987 144
198 3300047472 Ga0495686_0001443 Ga0495686_0001443_7267_7704 144
199 3300048913 Ga0496110_1568398 Ga0496110_1568398_98_553 144
200 3300049570 Ga0501033_0399245 Ga0501033_0399245_87_542 144
201 3300049571 Ga0501034_0258288 Ga0501034_0258288_487_951 144
202 3300049575 Ga0501039_0521692 Ga0501039_0521692_290_745 144
203 3300049575 Ga0501039_0798104 Ga0501039_0798104_194_649 144
204 3300049576 Ga0501040_0013198 Ga0501040_0013198_1843_2298 144
205 3300049577 Ga0501041_0043225 Ga0501041_0043225_1800_2255 144
206 3300049578 Ga0501042_0000606 Ga0501042_0000606_161_616 144
207 3300049582 Ga0501048_0111168 Ga0501048_0111168_605_1060 144
208 3300049587 Ga0501071_0757999 Ga0501071_0757999_64_519 144
209 3300049591 Ga0501075_0057277 Ga0501075_0057277_2388_2843 144
210 3300049591 Ga0501075_0683502 Ga0501075_0683502_236_691 144
211 3300049592 Ga0501076_0070953 Ga0501076_0070953_118_573 144
212 3300049593 Ga0501077_0054980 Ga0501077_0054980_1124_1579 144
213 3300049741 Ga0501079_0074690 Ga0501079_0074690_2109_2564 144
214 3300049742 Ga0501080_0112745 Ga0501080_0112745_1888_2343 144
215 3300049743 Ga0501081_0012890 Ga0501081_0012890_4854_5309 144
216 3300050507 nmdc:mga05p37_435527_c1 nmdc:mga05p37_435527_c1_977_1432 144
217 3300050508 nmdc:mga09592_11610_c1 nmdc:mga09592_11610_c1_512_967 144
218 3300050509 nmdc:mga0qj67_116217_c1 nmdc:mga0qj67_116217_c1_900_1355 144
219 3300050509 nmdc:mga0qj67_144693_c1 nmdc:mga0qj67_144693_c1_552_1007 144
220 3300050510 nmdc:mga06r32_371206_c1 nmdc:mga06r32_371206_c1_211_666 144
221 3300050510 nmdc:mga06r32_68877_c1 nmdc:mga06r32_68877_c1_1454_1909 144
222 3300050510 nmdc:mga06r32_76325_c1 nmdc:mga06r32_76325_c1_2369_2824 144
223 3300050511 nmdc:mga08y16_461_c1 nmdc:mga08y16_461_c1_29964_30419 144
224 3300050512 nmdc:mga0n895_549280_c1 nmdc:mga0n895_549280_c1_432_893 144
225 3300060353 Ga0501082_1095855 Ga0501082_1095855_60_515 144
226 3300061734 Ga0530510_0231221 Ga0530510_0231221_702_1157 144
227 3300002067 JGI24735J21928_10010154 JGI24735J21928_100101544 145
228 3300005337 Ga0070682_100309854 Ga0070682_1003098542 145
229 3300005344 Ga0070661_100114533 Ga0070661_1001145332 145
230 3300005353 Ga0070669_100726312 Ga0070669_1007263121 145
231 3300005366 Ga0070659_100023505 Ga0070659_1000235053 145
232 3300005457 Ga0070662_100156927 Ga0070662_1001569272 145
233 3300005458 Ga0070681_10086927 Ga0070681_100869273 145
234 3300005467 Ga0070706_100475086 Ga0070706_1004750862 145
235 3300005468 Ga0070707_100210296 Ga0070707_1002102962 145
236 3300005518 Ga0070699_100662132 Ga0070699_1006621322 145
237 3300005546 Ga0070696_100396050 Ga0070696_1003960502 145
238 3300005563 Ga0068855_100007994 Ga0068855_1000079946 145
239 3300005563 Ga0068855_100314069 Ga0068855_1003140692 145
240 3300005577 Ga0068857_100129764 Ga0068857_1001297643 145
241 3300005578 Ga0068854_100000397 Ga0068854_10000039719 145
242 3300006042 Ga0075368_10383345 Ga0075368_103833451 145
243 3300006048 Ga0075363_100081833 Ga0075363_1000818332 145
244 3300006051 Ga0075364_10005768 Ga0075364_100057681 145
245 3300006051 Ga0075364_10032950 Ga0075364_100329502 145
246 3300006177 Ga0075362_10088054 Ga0075362_100880541 145
247 3300006178 Ga0075367_10038828 Ga0075367_100388282 145
248 3300006178 Ga0075367_10168796 Ga0075367_101687961 145
249 3300006195 Ga0075366_10028451 Ga0075366_100284513 145
250 3300006871 Ga0075434_100171874 Ga0075434_1001718742 145
251 3300009093 Ga0105240_10027310 Ga0105240_100273105 145
252 3300009094 Ga0111539_10353543 Ga0111539_103535432 145
253 3300009545 Ga0105237_10488643 Ga0105237_104886431 145
254 3300009553 Ga0105249_10109308 Ga0105249_101093082 145
255 3300013100 Ga0157373_10652326 Ga0157373_106523261 145
256 3300013100 Ga0157373_11146172 Ga0157373_111461721 145
257 3300013105 Ga0157369_10061958 Ga0157369_100619583 145
258 3300014497 Ga0182008_10226764 Ga0182008_102267641 145
259 3300025913 Ga0207695_10009666 Ga0207695_100096665 145
260 3300025917 Ga0207660_10381144 Ga0207660_103811442 145
261 3300025933 Ga0207706_10231635 Ga0207706_102316352 145
262 3300025949 Ga0207667_10000082 Ga0207667_1000008296 145
263 3300025961 Ga0207712_10095199 Ga0207712_100951993 145
264 3300025981 Ga0207640_10000018 Ga0207640_1000001855 145
265 3300031665 Ga0316575_10047196 Ga0316575_100471962 145
266 3300031727 Ga0316576_10239262 Ga0316576_102392622 145
267 3300031733 Ga0316577_10110502 Ga0316577_101105022 145
268 3300033541 Ga0316596_1102522 Ga0316596_11025222 145
269 3300035691 Ga0373931_0293380 Ga0373931_0293380_240_731 145
270 3300035725 Ga0373947_0229656 Ga0373947_0229656_199_669 145
271 3300036647 Ga0316582_0582918 Ga0316582_0582918_318_755 145
272 3300036712 Ga0316584_0002704 Ga0316584_0002704_3304_3741 145
273 3300037471 Ga0395905_0359750 Ga0395905_0359750_304_813 145
274 3300041997 Ga0439431_0014758 Ga0439431_0014758_100_567 145
275 3300042005 Ga0439448_0057618 Ga0439448_0057618_206_643 145
276 3300042008 Ga0439450_123811 Ga0439450_123811_79_516 145
277 3300042461 Ga0439460_0159779 Ga0439460_0159779_250_687 145
278 3300045051 Ga0451576_0284788 Ga0451576_0284788_658_1125 145
279 3300045051 Ga0451576_1560189 Ga0451576_1560189_193_660 145
280 3300046506 Ga0495583_0000117 Ga0495583_0000117_12708_13157 145
281 3300047315 Ga0495581_0310259 Ga0495581_0310259_14_490 145
282 3300048905 Ga0496102_0087595 Ga0496102_0087595_615_1076 145
283 3300048905 Ga0496102_0655488 Ga0496102_0655488_148_606 145
284 3300048907 Ga0496104_0494719 Ga0496104_0494719_574_1065 145
285 3300048908 Ga0496105_0337634 Ga0496105_0337634_65_556 145
286 3300049571 Ga0501034_0066049 Ga0501034_0066049_2027_2509 145
287 3300049581 Ga0501047_0617138 Ga0501047_0617138_400_882 145
288 3300049823 Ga0501044_1034660 Ga0501044_1034660_108_575 145
289 3300050490 nmdc:mga03n38_69729_c1 nmdc:mga03n38_69729_c1_436_903 145
290 3300050491 nmdc:mga00v17_35164_c1 nmdc:mga00v17_35164_c1_615_1082 145
291 3300050491 nmdc:mga00v17_48163_c1 nmdc:mga00v17_48163_c1_289_756 145
292 3300050493 nmdc:mga0k408_27106_c1 nmdc:mga0k408_27106_c1_255_722 145
293 3300050494 nmdc:mga06z11_19988_c1 nmdc:mga06z11_19988_c1_664_1131 145
294 3300050495 nmdc:mga04h51_31314_c1 nmdc:mga04h51_31314_c1_194_661 145
295 3300050511 nmdc:mga08y16_206110_c1 nmdc:mga08y16_206110_c1_336_803 145
296 3300053085 Ga0495619_0034431 Ga0495619_0034431_2273_2755 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21352

Thio2_N

Thioredoxin 2, N-terminal

28

54

0.97

PF00085

Thioredoxin

Thioredoxin

63

164

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

75

162

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.984 65 139
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9763 42 143
2yj7-assembly2.cif.gz_B crystal structure of a hyperstable protein from the precambrian period 0.9753 41 142
4xhm-assembly2.cif.gz_B archaeoglobus fulgidus thioredoxin 3 m60h 0.975 39 142
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.975 41 141
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.984 65 139 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9731 41 142 3.40.30.10
2pptB01 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.9729 4 36 2.30.30.380
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.97 69 142 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 42 144 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5E4JIL8-F1-model_v4 Thioredoxin 0.9888 42 142 GO:0005737
GO:0015035
AF-A0A101BVB3-F1-model_v4 deleted 0.9864 41 142
AF-A0A368YW69-F1-model_v4 Thioredoxin 0.9863 41 145 GO:0005737
GO:0015035
AF-A0A835X768-F1-model_v4 Thioredoxin 0.9858 43 145 GO:0005829
GO:0015035
GO:0045454
AF-A0A2V1HFW6-F1-model_v4 deleted 0.9855 42 142

Feature Viewer

pLDDT pTM Quality
95.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map