F392795

General Info

Members Datasets Scaffolds Average Seq Length
295 155 590 77

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_2101827|Ga0466967_2101827_259_540
Length 93
Sequence MVAIDAGRVPALTKRGVVMSTVETGDVTGTKDKDYNLLWFTQACLANALRLETYIHDAERAGDSEVAELFRKAQADSRKGAEQGKSLLASRIG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
96 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
99 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
100 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
101 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
142 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.51
Metatranscriptomes 9.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_2101827 3300045976 Bacteria 561
2 Ga0006778J45830_1010764 3300003162 Bacteria 2022
3 Ga0006759J45824_1014672 3300003163 Bacteria 604
4 JGI25406J46586_10080640 3300003203 Bacteria 999
5 Ga0006777J48905_1026254 3300003308 Bacteria 1765
6 rootH2_10212438 3300003320 Bacteria 2140
7 JGI25407J50210_10003592 3300003373 Bacteria 3725
8 JGI25407J50210_10040403 3300003373 Bacteria 1196
9 JGI25407J50210_10084976 3300003373 Bacteria 785
10 Ga0007429J51699_1027986 3300003579 Bacteria 641
11 JGI25404J52841_10102681 3300003659 Bacteria 600
12 Ga0032354_1032001 3300003693 Bacteria 1480
13 Ga0058863_11416064 3300004799 Bacteria 526
14 Ga0058862_10023625 3300004803 Bacteria 1697
15 Ga0070658_11629001 3300005327 Bacteria 559
16 Ga0070683_100748309 3300005329 Bacteria 936
17 Ga0070691_10466685 3300005341 Bacteria 724
18 Ga0070700_100316180 3300005441 Bacteria 1145
19 Ga0070663_100382098 3300005455 Bacteria 1147
20 Ga0070706_100285252 3300005467 Unclassified 1541
21 Ga0070707_100558559 3300005468 Bacteria 1107
22 Ga0070699_100581172 3300005518 Unclassified 1021
23 Ga0070679_100315576 3300005530 Bacteria 1513
24 Ga0068857_101948493 3300005577 Bacteria 576
25 Ga0068866_10928546 3300005718 Bacteria 614
26 Ga0068861_100420032 3300005719 Bacteria 1191
27 Ga0081455_10004056 3300005937 Bacteria 16598
28 Ga0081455_10038075 3300005937 Bacteria 4261
29 Ga0081538_10000159 3300005981 Bacteria 71002
30 Ga0081538_10001115 3300005981 Bacteria 28468
31 Ga0081538_10002707 3300005981 Bacteria 17037
32 Ga0081538_10044457 3300005981 Bacteria 2770
33 Ga0081538_10067686 3300005981 Bacteria 1992
34 Ga0081538_10084601 3300005981 Bacteria 1670
35 Ga0081540_1001665 3300005983 Bacteria 18914
36 Ga0081540_1090126 3300005983 Bacteria 1351
37 Ga0081539_10015292 3300005985 Bacteria 5587
38 Ga0081539_10089949 3300005985 Bacteria 1589
39 Ga0081539_10495788 3300005985 Bacteria 506
40 Ga0075368_10459811 3300006042 Bacteria 564
41 Ga0075369_10496065 3300006186 Bacteria 580
42 Ga0075428_100050319 3300006844 Bacteria 4571
43 Ga0075430_100010469 3300006846 Bacteria 7853
44 Ga0075431_100002698 3300006847 Bacteria 17202
45 Ga0075431_100019917 3300006847 Bacteria 6850
46 Ga0075429_100005537 3300006880 Bacteria 10882
47 Ga0099795_10313819 3300007788 Bacteria 693
48 Ga0105245_10269885 3300009098 Bacteria 1659
49 Ga0114129_10274693 3300009147 Bacteria 2254
50 Ga0105238_10885924 3300009551 Bacteria 910
51 Ga0154016_128659 3300013045 Bacteria 892
52 Ga0154012_135191 3300013059 Bacteria 1054
53 Ga0163162_10236753 3300013306 Bacteria 1956
54 Ga0157372_11760644 3300013307 Bacteria 713
55 Ga0157375_10995956 3300013308 Bacteria 978
56 Ga0163161_10560278 3300017792 Bacteria 938
57 Ga0206349_1077591 3300020075 Bacteria 605
58 Ga0206349_1171923 3300020075 Bacteria 541
59 Ga0206355_1120844 3300020076 Bacteria 1990
60 Ga0206355_1592250 3300020076 Bacteria 627
61 Ga0206351_10956276 3300020077 Bacteria 509
62 Ga0206350_10502689 3300020080 Bacteria 600
63 Ga0206350_11180739 3300020080 Bacteria 515
64 Ga0206350_11310268 3300020080 Bacteria 951
65 Ga0206353_11010189 3300020082 Bacteria 975
66 Ga0213876_10097169 3300021384 Bacteria 1561
67 Ga0224712_10173618 3300022467 Bacteria 968
68 Ga0224712_10533438 3300022467 Bacteria 569
69 Ga0224712_10556475 3300022467 Bacteria 558
70 Ga0207647_10164762 3300025904 Bacteria 1292
71 Ga0207705_11483398 3300025909 Bacteria 514
72 Ga0207684_10328071 3300025910 Unclassified 1319
73 Ga0207707_10426005 3300025912 Bacteria 1137
74 Ga0207660_11117010 3300025917 Bacteria 642
75 Ga0207652_10073190 3300025921 Bacteria 2980
76 Ga0207687_10410834 3300025927 Bacteria 1115
77 Ga0207691_10609098 3300025940 Unclassified 924
78 Ga0207691_11127561 3300025940 Bacteria 652
79 Ga0207677_12274134 3300026023 Bacteria 505
80 Ga0207678_10530466 3300026067 Bacteria 1028
81 Ga0207708_10711231 3300026075 Bacteria 859
82 Ga0207674_10038405 3300026116 Bacteria 4969
83 Ga0207675_100515075 3300026118 Bacteria 1192
84 Ga0209813_10379809 3300027866 Bacteria 565
85 Ga0268265_12081224 3300028380 Bacteria 575
86 Ga0307515_10751073 3300028794 Bacteria 594
87 Ga0307408_100037735 3300031548 Bacteria 3404
88 Ga0307408_100046101 3300031548 Bacteria 3117
89 Ga0307408_100148493 3300031548 Bacteria 1848
90 Ga0307408_100149601 3300031548 Bacteria 1842
91 Ga0307408_101035459 3300031548 Bacteria 758
92 Ga0307408_102508700 3300031548 Bacteria 501
93 Ga0307405_10000664 3300031731 Bacteria 13281
94 Ga0307405_10003633 3300031731 Bacteria 7136
95 Ga0307405_10085737 3300031731 Bacteria 2071
96 Ga0307405_10264623 3300031731 Bacteria 1286
97 Ga0307405_10422370 3300031731 Bacteria 1050
98 Ga0307405_10627178 3300031731 Bacteria 881
99 Ga0307413_10027367 3300031824 Bacteria 3158
100 Ga0307413_10192149 3300031824 Bacteria 1467
101 Ga0307413_10275392 3300031824 Bacteria 1262
102 Ga0307413_10571487 3300031824 Bacteria 920
103 Ga0307413_10963558 3300031824 Bacteria 729
104 Ga0307413_11385011 3300031824 Bacteria 618
105 Ga0307413_11461352 3300031824 Bacteria 603
106 Ga0307410_10005145 3300031852 Bacteria 6881
107 Ga0307410_10015374 3300031852 Bacteria 4537
108 Ga0307410_10047854 3300031852 Bacteria 2860
109 Ga0307410_10109705 3300031852 Bacteria 1994
110 Ga0307410_10110474 3300031852 Bacteria 1988
111 Ga0307410_10203435 3300031852 Bacteria 1513
112 Ga0307410_10521487 3300031852 Bacteria 981
113 Ga0307410_10872294 3300031852 Bacteria 769
114 Ga0307410_12108223 3300031852 Bacteria 504
115 Ga0326468_10085010 3300031889 Bacteria 554
116 Ga0307406_10018850 3300031901 Bacteria 4040
117 Ga0307406_10020194 3300031901 Bacteria 3919
118 Ga0307406_10176021 3300031901 Bacteria 1553
119 Ga0307406_10193861 3300031901 Bacteria 1490
120 Ga0307406_10304160 3300031901 Bacteria 1226
121 Ga0307406_10362017 3300031901 Bacteria 1137
122 Ga0307406_10420219 3300031901 Bacteria 1065
123 Ga0307406_10540828 3300031901 Bacteria 951
124 Ga0307406_10929145 3300031901 Bacteria 742
125 Ga0307406_11008808 3300031901 Bacteria 714
126 Ga0307407_10002256 3300031903 Bacteria 7458
127 Ga0307407_10008225 3300031903 Bacteria 4775
128 Ga0307407_10009593 3300031903 Bacteria 4517
129 Ga0307407_10010799 3300031903 Bacteria 4320
130 Ga0307407_10165178 3300031903 Bacteria 1452
131 Ga0307407_10178612 3300031903 Bacteria 1405
132 Ga0307407_10315327 3300031903 Bacteria 1095
133 Ga0307407_10372835 3300031903 Bacteria 1017
134 Ga0307407_11646384 3300031903 Bacteria 510
135 Ga0307412_10038682 3300031911 Bacteria 3074
136 Ga0307412_10082509 3300031911 Bacteria 2226
137 Ga0307412_10354248 3300031911 Bacteria 1179
138 Ga0307412_11119822 3300031911 Bacteria 701
139 Ga0307412_11432455 3300031911 Bacteria 626
140 Ga0307412_11970040 3300031911 Bacteria 540
141 Ga0307409_100052604 3300031995 Bacteria 3124
142 Ga0307409_100076711 3300031995 Bacteria 2681
143 Ga0307409_100095420 3300031995 Bacteria 2450
144 Ga0307409_100140738 3300031995 Bacteria 2078
145 Ga0307409_100177430 3300031995 Bacteria 1882
146 Ga0307409_100249393 3300031995 Bacteria 1622
147 Ga0307409_100382884 3300031995 Bacteria 1338
148 Ga0307409_100395562 3300031995 Bacteria 1318
149 Ga0307409_100481184 3300031995 Bacteria 1205
150 Ga0307409_100544137 3300031995 Bacteria 1138
151 Ga0307409_100661112 3300031995 Bacteria 1040
152 Ga0307409_100880524 3300031995 Bacteria 908
153 Ga0307409_101171362 3300031995 Bacteria 791
154 Ga0307409_101427216 3300031995 Bacteria 719
155 Ga0307409_102151585 3300031995 Bacteria 587
156 Ga0307416_100007540 3300032002 Bacteria 6933
157 Ga0307416_100012291 3300032002 Bacteria 5760
158 Ga0307416_100015190 3300032002 Bacteria 5306
159 Ga0307416_100043914 3300032002 Bacteria 3505
160 Ga0307416_100231710 3300032002 Bacteria 1781
161 Ga0307416_100522196 3300032002 Bacteria 1256
162 Ga0307416_100649437 3300032002 Bacteria 1139
163 Ga0307416_100684226 3300032002 Bacteria 1113
164 Ga0307416_101382045 3300032002 Bacteria 810
165 Ga0307416_101773830 3300032002 Bacteria 721
166 Ga0307416_102841413 3300032002 Bacteria 579
167 Ga0307416_102948183 3300032002 Bacteria 569
168 Ga0307416_103036769 3300032002 Bacteria 561
169 Ga0307416_103555151 3300032002 Bacteria 521
170 Ga0307414_10029169 3300032004 Bacteria 3587
171 Ga0307414_10035353 3300032004 Bacteria 3324
172 Ga0307414_10065924 3300032004 Bacteria 2586
173 Ga0307414_10314856 3300032004 Bacteria 1330
174 Ga0307414_10582120 3300032004 Bacteria 1002
175 Ga0307414_10672171 3300032004 Bacteria 935
176 Ga0307411_10073387 3300032005 Bacteria 2327
177 Ga0307411_10295285 3300032005 Bacteria 1297
178 Ga0307411_10358821 3300032005 Bacteria 1191
179 Ga0307411_10719112 3300032005 Bacteria 872
180 Ga0307411_11261661 3300032005 Bacteria 672
181 Ga0307411_11905560 3300032005 Bacteria 553
182 Ga0307415_100000003 3300032126 Bacteria 116928
183 Ga0307415_100001237 3300032126 Bacteria 11981
184 Ga0307415_100005461 3300032126 Bacteria 6753
185 Ga0307415_100020445 3300032126 Bacteria 4042
186 Ga0307415_100020534 3300032126 Bacteria 4035
187 Ga0307415_100056666 3300032126 Bacteria 2688
188 Ga0307415_100163720 3300032126 Bacteria 1727
189 Ga0307415_101117818 3300032126 Bacteria 738
190 Ga0307415_101132895 3300032126 Bacteria 734
191 Ga0307415_101325166 3300032126 Bacteria 683
192 Ga0307415_102429276 3300032126 Bacteria 515
193 Ga0316587_1116569 3300033529 Bacteria 521
194 Ga0373960_0035574 3300035121 Bacteria 1414
195 Ga0395899_0342614 3300037312 Bacteria 1002
196 Ga0395900_0179472 3300037418 Bacteria 2152
197 Ga0395900_0269415 3300037418 Bacteria 1698
198 Ga0395900_0333486 3300037418 Bacteria 1494
199 Ga0395900_0346149 3300037418 Bacteria 1461
200 Ga0395900_1157576 3300037418 Bacteria 690
201 Ga0395898_0210152 3300037466 Bacteria 1856
202 Ga0395898_0225142 3300037466 Bacteria 1789
203 Ga0395898_0327482 3300037466 Bacteria 1461
204 Ga0395898_0426636 3300037466 Bacteria 1263
205 Ga0395898_1429184 3300037466 Bacteria 619
206 Ga0395905_0113765 3300037471 Bacteria 2543
207 Ga0395905_0841891 3300037471 Bacteria 820
208 Ga0395905_1759380 3300037471 Bacteria 525
209 Ga0395901_0147090 3300038443 Bacteria 2476
210 Ga0395901_0367120 3300038443 Bacteria 1483
211 Ga0395901_0458178 3300038443 Bacteria 1303
212 Ga0395901_0813306 3300038443 Bacteria 922
213 Ga0436365_1379164 3300039437 Bacteria 17910
214 Ga0436360_1356192 3300039438 Bacteria 530
215 Ga0439436_0088867 3300041404 Bacteria 860
216 Ga0451807_1655285 3300041486 Bacteria 563
217 Ga0451853_0359081 3300041512 Bacteria 11865
218 Ga0439448_0006925 3300042005 Bacteria 3271
219 Ga0439448_0015232 3300042005 Bacteria 2327
220 Ga0439449_0025677 3300042007 Bacteria 2201
221 Ga0439450_000255 3300042008 Bacteria 6477
222 Ga0439454_002367 3300042011 Bacteria 1977
223 Ga0439463_017412 3300042016 Bacteria 1781
224 Ga0450894_000745 3300042131 Bacteria 5357
225 Ga0450896_000450 3300042133 Bacteria 4226
226 Ga0450898_000089 3300042134 Bacteria 8296
227 Ga0450899_005251 3300042135 Bacteria 1391
228 Ga0450906_004672 3300042145 Bacteria 2855
229 Ga0450908_040531 3300042184 Bacteria 807
230 Ga0439435_0033687 3300042436 Bacteria 1404
231 Ga0439444_0010914 3300042437 Bacteria 1460
232 Ga0439444_0014616 3300042437 Bacteria 1315
233 Ga0439464_0078693 3300042439 Bacteria 982
234 Ga0439460_0012601 3300042461 Bacteria 2198
235 Ga0439440_0000564 3300042993 Bacteria 6288
236 Ga0466972_0238710 3300044658 Bacteria 850
237 Ga0466965_0381905 3300044683 Bacteria 776
238 Ga0466966_0003446 3300044684 Bacteria 10425
239 Ga0466966_0645024 3300044684 Bacteria 638
240 Ga0466961_0004572 3300044693 Bacteria 8684
241 Ga0466961_0248678 3300044693 Bacteria 1092
242 Ga0466963_0198643 3300044694 Bacteria 1402
243 Ga0466963_0317346 3300044694 Bacteria 1096
244 Ga0466964_0025347 3300044706 Bacteria 2315
245 Ga0466964_0105661 3300044706 Bacteria 1248
246 Ga0466964_0110101 3300044706 Bacteria 1227
247 Ga0466964_0766484 3300044706 Bacteria 543
248 Ga0466968_0088731 3300044735 Bacteria 1367
249 Ga0466957_1009625 3300044842 Bacteria 598
250 Ga0466957_1057053 3300044842 Bacteria 584
251 Ga0466959_0096105 3300045049 Bacteria 2124
252 Ga0466958_0206446 3300045836 Bacteria 1251
253 Ga0466958_1102641 3300045836 Bacteria 518
254 Ga0466967_0112658 3300045976 Bacteria 2501
255 Ga0466967_0237975 3300045976 Bacteria 1735
256 Ga0466967_0340871 3300045976 Bacteria 1449
257 Ga0466967_2594168 3300045976 Bacteria 501
258 Ga0495663_0149253 3300046525 Bacteria 797
259 Ga0496104_0748570 3300048907 Bacteria 884
260 Ga0496109_0142300 3300048912 Bacteria 2243
261 Ga0496110_0899590 3300048913 Bacteria 791
262 Ga0496111_0224583 3300048914 Bacteria 1395
263 Ga0496112_0366949 3300048915 Bacteria 1381
264 Ga0496112_1629058 3300048915 Bacteria 558
265 Ga0496113_0419800 3300048916 Bacteria 1074
266 Ga0501309_038988 3300049129 Bacteria 722
267 Ga0501317_063985 3300049533 Bacteria 609
268 Ga0501322_031511 3300049538 Bacteria 503
269 Ga0501036_0041585 3300049572 Bacteria 3888
270 Ga0501038_0142716 3300049574 Bacteria 1958
271 Ga0501039_0300807 3300049575 Bacteria 1261
272 Ga0501040_0824232 3300049576 Bacteria 671
273 Ga0501041_0015511 3300049577 Bacteria 4526
274 Ga0501046_0662624 3300049580 Bacteria 737
275 Ga0501048_0285746 3300049582 Bacteria 1173
276 Ga0501071_0024782 3300049587 Bacteria 4197
277 Ga0501072_0033446 3300049588 Bacteria 4028
278 Ga0501075_0367517 3300049591 Bacteria 1096
279 Ga0501076_0013471 3300049592 Bacteria 6135
280 Ga0501077_0119442 3300049593 Bacteria 1670
281 Ga0501252_074878 3300049682 Bacteria 552
282 Ga0501255_047994 3300049684 Bacteria 646
283 Ga0501081_0302994 3300049743 Bacteria 1172
284 Ga0501045_0118680 3300049824 Bacteria 1963
285 nmdc:mga05p37_1004151_c1 3300050507 Bacteria 886
286 nmdc:mga09592_8673_c1 3300050508 Bacteria 8275
287 nmdc:mga0qj67_3520_c1 3300050509 Bacteria 11302
288 nmdc:mga06r32_1386_c1 3300050510 Bacteria 21909
289 nmdc:mga0sz30_282691_c1 3300050516 Bacteria 739
290 Ga0501084_0048969 3300054114 Bacteria 3537
291 Ga0587073_0337727 3300059492 Bacteria 502
292 Ga0587085_180116 3300059506 Bacteria 506
293 Ga0587091_110718 3300059511 Bacteria 655
294 Ga0501082_0824514 3300060353 Bacteria 811
295 Ga0530510_0064354 3300061734 Bacteria 2656
296 Ga0466967_2101827
297 Ga0006778J45830_1010764
298 Ga0006759J45824_1014672
299 JGI25406J46586_10080640
300 Ga0006777J48905_1026254
301 rootH2_10212438
302 JGI25407J50210_10003592
303 JGI25407J50210_10040403
304 JGI25407J50210_10084976
305 Ga0007429J51699_1027986
306 JGI25404J52841_10102681
307 Ga0032354_1032001
308 Ga0058863_11416064
309 Ga0058862_10023625
310 Ga0070658_11629001
311 Ga0070683_100748309
312 Ga0070691_10466685
313 Ga0070700_100316180
314 Ga0070663_100382098
315 Ga0070706_100285252
316 Ga0070707_100558559
317 Ga0070699_100581172
318 Ga0070679_100315576
319 Ga0068857_101948493
320 Ga0068866_10928546
321 Ga0068861_100420032
322 Ga0081455_10004056
323 Ga0081455_10038075
324 Ga0081538_10000159
325 Ga0081538_10001115
326 Ga0081538_10002707
327 Ga0081538_10044457
328 Ga0081538_10067686
329 Ga0081538_10084601
330 Ga0081540_1001665
331 Ga0081540_1090126
332 Ga0081539_10015292
333 Ga0081539_10089949
334 Ga0081539_10495788
335 Ga0075368_10459811
336 Ga0075369_10496065
337 Ga0075428_100050319
338 Ga0075430_100010469
339 Ga0075431_100002698
340 Ga0075431_100019917
341 Ga0075429_100005537
342 Ga0099795_10313819
343 Ga0105245_10269885
344 Ga0114129_10274693
345 Ga0105238_10885924
346 Ga0154016_128659
347 Ga0154012_135191
348 Ga0163162_10236753
349 Ga0157372_11760644
350 Ga0157375_10995956
351 Ga0163161_10560278
352 Ga0206349_1077591
353 Ga0206349_1171923
354 Ga0206355_1120844
355 Ga0206355_1592250
356 Ga0206351_10956276
357 Ga0206350_10502689
358 Ga0206350_11180739
359 Ga0206350_11310268
360 Ga0206353_11010189
361 Ga0213876_10097169
362 Ga0224712_10173618
363 Ga0224712_10533438
364 Ga0224712_10556475
365 Ga0207647_10164762
366 Ga0207705_11483398
367 Ga0207684_10328071
368 Ga0207707_10426005
369 Ga0207660_11117010
370 Ga0207652_10073190
371 Ga0207687_10410834
372 Ga0207691_10609098
373 Ga0207691_11127561
374 Ga0207677_12274134
375 Ga0207678_10530466
376 Ga0207708_10711231
377 Ga0207674_10038405
378 Ga0207675_100515075
379 Ga0209813_10379809
380 Ga0268265_12081224
381 Ga0307515_10751073
382 Ga0307408_100037735
383 Ga0307408_100046101
384 Ga0307408_100148493
385 Ga0307408_100149601
386 Ga0307408_101035459
387 Ga0307408_102508700
388 Ga0307405_10000664
389 Ga0307405_10003633
390 Ga0307405_10085737
391 Ga0307405_10264623
392 Ga0307405_10422370
393 Ga0307405_10627178
394 Ga0307413_10027367
395 Ga0307413_10192149
396 Ga0307413_10275392
397 Ga0307413_10571487
398 Ga0307413_10963558
399 Ga0307413_11385011
400 Ga0307413_11461352
401 Ga0307410_10005145
402 Ga0307410_10015374
403 Ga0307410_10047854
404 Ga0307410_10109705
405 Ga0307410_10110474
406 Ga0307410_10203435
407 Ga0307410_10521487
408 Ga0307410_10872294
409 Ga0307410_12108223
410 Ga0326468_10085010
411 Ga0307406_10018850
412 Ga0307406_10020194
413 Ga0307406_10176021
414 Ga0307406_10193861
415 Ga0307406_10304160
416 Ga0307406_10362017
417 Ga0307406_10420219
418 Ga0307406_10540828
419 Ga0307406_10929145
420 Ga0307406_11008808
421 Ga0307407_10002256
422 Ga0307407_10008225
423 Ga0307407_10009593
424 Ga0307407_10010799
425 Ga0307407_10165178
426 Ga0307407_10178612
427 Ga0307407_10315327
428 Ga0307407_10372835
429 Ga0307407_11646384
430 Ga0307412_10038682
431 Ga0307412_10082509
432 Ga0307412_10354248
433 Ga0307412_11119822
434 Ga0307412_11432455
435 Ga0307412_11970040
436 Ga0307409_100052604
437 Ga0307409_100076711
438 Ga0307409_100095420
439 Ga0307409_100140738
440 Ga0307409_100177430
441 Ga0307409_100249393
442 Ga0307409_100382884
443 Ga0307409_100395562
444 Ga0307409_100481184
445 Ga0307409_100544137
446 Ga0307409_100661112
447 Ga0307409_100880524
448 Ga0307409_101171362
449 Ga0307409_101427216
450 Ga0307409_102151585
451 Ga0307416_100007540
452 Ga0307416_100012291
453 Ga0307416_100015190
454 Ga0307416_100043914
455 Ga0307416_100231710
456 Ga0307416_100522196
457 Ga0307416_100649437
458 Ga0307416_100684226
459 Ga0307416_101382045
460 Ga0307416_101773830
461 Ga0307416_102841413
462 Ga0307416_102948183
463 Ga0307416_103036769
464 Ga0307416_103555151
465 Ga0307414_10029169
466 Ga0307414_10035353
467 Ga0307414_10065924
468 Ga0307414_10314856
469 Ga0307414_10582120
470 Ga0307414_10672171
471 Ga0307411_10073387
472 Ga0307411_10295285
473 Ga0307411_10358821
474 Ga0307411_10719112
475 Ga0307411_11261661
476 Ga0307411_11905560
477 Ga0307415_100000003
478 Ga0307415_100001237
479 Ga0307415_100005461
480 Ga0307415_100020445
481 Ga0307415_100020534
482 Ga0307415_100056666
483 Ga0307415_100163720
484 Ga0307415_101117818
485 Ga0307415_101132895
486 Ga0307415_101325166
487 Ga0307415_102429276
488 Ga0316587_1116569
489 Ga0373960_0035574
490 Ga0395899_0342614
491 Ga0395900_0179472
492 Ga0395900_0269415
493 Ga0395900_0333486
494 Ga0395900_0346149
495 Ga0395900_1157576
496 Ga0395898_0210152
497 Ga0395898_0225142
498 Ga0395898_0327482
499 Ga0395898_0426636
500 Ga0395898_1429184
501 Ga0395905_0113765
502 Ga0395905_0841891
503 Ga0395905_1759380
504 Ga0395901_0147090
505 Ga0395901_0367120
506 Ga0395901_0458178
507 Ga0395901_0813306
508 Ga0436365_1379164
509 Ga0436360_1356192
510 Ga0439436_0088867
511 Ga0451807_1655285
512 Ga0451853_0359081
513 Ga0439448_0006925
514 Ga0439448_0015232
515 Ga0439449_0025677
516 Ga0439450_000255
517 Ga0439454_002367
518 Ga0439463_017412
519 Ga0450894_000745
520 Ga0450896_000450
521 Ga0450898_000089
522 Ga0450899_005251
523 Ga0450906_004672
524 Ga0450908_040531
525 Ga0439435_0033687
526 Ga0439444_0010914
527 Ga0439444_0014616
528 Ga0439464_0078693
529 Ga0439460_0012601
530 Ga0439440_0000564
531 Ga0466972_0238710
532 Ga0466965_0381905
533 Ga0466966_0003446
534 Ga0466966_0645024
535 Ga0466961_0004572
536 Ga0466961_0248678
537 Ga0466963_0198643
538 Ga0466963_0317346
539 Ga0466964_0025347
540 Ga0466964_0105661
541 Ga0466964_0110101
542 Ga0466964_0766484
543 Ga0466968_0088731
544 Ga0466957_1009625
545 Ga0466957_1057053
546 Ga0466959_0096105
547 Ga0466958_0206446
548 Ga0466958_1102641
549 Ga0466967_0112658
550 Ga0466967_0237975
551 Ga0466967_0340871
552 Ga0466967_2594168
553 Ga0495663_0149253
554 Ga0496104_0748570
555 Ga0496109_0142300
556 Ga0496110_0899590
557 Ga0496111_0224583
558 Ga0496112_0366949
559 Ga0496112_1629058
560 Ga0496113_0419800
561 Ga0501309_038988
562 Ga0501317_063985
563 Ga0501322_031511
564 Ga0501036_0041585
565 Ga0501038_0142716
566 Ga0501039_0300807
567 Ga0501040_0824232
568 Ga0501041_0015511
569 Ga0501046_0662624
570 Ga0501048_0285746
571 Ga0501071_0024782
572 Ga0501072_0033446
573 Ga0501075_0367517
574 Ga0501076_0013471
575 Ga0501077_0119442
576 Ga0501252_074878
577 Ga0501255_047994
578 Ga0501081_0302994
579 Ga0501045_0118680
580 nmdc:mga05p37_1004151_c1
581 nmdc:mga09592_8673_c1
582 nmdc:mga0qj67_3520_c1
583 nmdc:mga06r32_1386_c1
584 nmdc:mga0sz30_282691_c1
585 Ga0501084_0048969
586 Ga0587073_0337727
587 Ga0587085_180116
588 Ga0587091_110718
589 Ga0501082_0824514
590 Ga0530510_0064354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4m-assembly3.cif.gz_E p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9933 24 70
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9872 18 72
4di0-assembly1.cif.gz_A the structure of rubrerythrin from burkholderia pseudomallei 0.9827 16 72
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9819 18 72
1f4m-assembly1.cif.gz_A p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9818 19 70
ID Description Score Start End Superfamily
1f4mE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9933 24 70 1.10.287.230
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9857 18 72 1.20.1260.10
1f4mF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9839 21 70 1.10.287.230
4di0A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9827 16 72 1.20.1260.10
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9819 18 72 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7X6LZF7-F1-model_v4 Ferritin-like diiron domain-containing protein 1.007 16 77
AF-A0A7G9S7P4-F1-model_v4 Uncharacterized protein 0.9981 15 76
AF-A0A3D2JBZ2-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9962 16 77
AF-A0A6F9WSQ9-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9951 16 75
AF-A0A6N7CMC1-F1-model_v4 Uncharacterized protein 0.994 17 77

Map