F392320

General Info

Members Datasets Scaffolds Average Seq Length
294 212 588 134

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0002916|Ga0501031_0002916_3635_4099
Length 154
Sequence MKAIENAARNQWASGIFFMTSILFRDMNERIRVTSGARWEPLVGYCRAIRVGSRIYVTGTTSLDEKGHLVSPGDAYAQTVQVIRNIEAALKRLGAGLEHIVRTRMFVTDISRWEEIGRAHGEFFREFPPATTMVQVSGLIDPGMLIEMEADAEI

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
192 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
212 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.34
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.34
Rhizoplane 1.36
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 18.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0002916 3300049568 Bacteria 10940
2 JGI25406J46586_10001824 3300003203 Bacteria 9992
3 Ga0065704_10186965 3300005289 Bacteria 1208
4 Ga0065715_10130417 3300005293 Bacteria 2026
5 Ga0065707_10022434 3300005295 Bacteria 1618
6 Ga0070683_100456592 3300005329 Bacteria 1219
7 Ga0068869_100052541 3300005334 Bacteria 2959
8 Ga0068869_101765554 3300005334 Unclassified 553
9 Ga0070680_100249071 3300005336 Bacteria 1502
10 Ga0070680_100834870 3300005336 Unclassified 794
11 Ga0070689_100042725 3300005340 Bacteria 3481
12 Ga0070689_100731951 3300005340 Bacteria 866
13 Ga0070687_100406513 3300005343 Bacteria 894
14 Ga0070661_100010370 3300005344 Bacteria 6478
15 Ga0070692_10902670 3300005345 Bacteria 611
16 Ga0070668_100008003 3300005347 Bacteria 7853
17 Ga0070671_100410593 3300005355 Bacteria 1159
18 Ga0070673_100239889 3300005364 Bacteria 1576
19 Ga0070673_100564493 3300005364 Bacteria 1035
20 Ga0070713_100167447 3300005436 Bacteria 1966
21 Ga0070701_10351256 3300005438 Bacteria 921
22 Ga0070701_10832730 3300005438 Unclassified 632
23 Ga0070705_100208817 3300005440 Bacteria 1344
24 Ga0070705_101130896 3300005440 Bacteria 642
25 Ga0070700_100081301 3300005441 Bacteria 2093
26 Ga0070700_101081076 3300005441 Bacteria 664
27 Ga0070694_100000186 3300005444 Bacteria 32580
28 Ga0070694_100003330 3300005444 Bacteria 9617
29 Ga0070694_101161628 3300005444 Bacteria 646
30 Ga0070662_100110192 3300005457 Bacteria 2096
31 Ga0068867_100235535 3300005459 Bacteria 1482
32 Ga0068867_100501824 3300005459 Bacteria 1043
33 Ga0070706_101598482 3300005467 Bacteria 595
34 Ga0070707_100402600 3300005468 Unclassified 1329
35 Ga0070698_100123611 3300005471 Bacteria 2545
36 Ga0070679_100943370 3300005530 Bacteria 806
37 Ga0070684_100129218 3300005535 Bacteria 2278
38 Ga0070697_100170267 3300005536 Bacteria 1843
39 Ga0070697_100736521 3300005536 Bacteria 871
40 Ga0070697_100803026 3300005536 Unclassified 833
41 Ga0070672_100063102 3300005543 Bacteria 2926
42 Ga0070686_100090987 3300005544 Bacteria 2041
43 Ga0070695_101192282 3300005545 Bacteria 626
44 Ga0070696_100096641 3300005546 Bacteria 2111
45 Ga0070696_100158590 3300005546 Bacteria 1666
46 Ga0070693_100095211 3300005547 Bacteria 1803
47 Ga0070704_100021156 3300005549 Bacteria 4212
48 Ga0070704_100070134 3300005549 Bacteria 2542
49 Ga0070704_101157699 3300005549 Bacteria 704
50 Ga0068855_100142578 3300005563 Bacteria 2729
51 Ga0070664_100704614 3300005564 Bacteria 941
52 Ga0068854_100082135 3300005578 Bacteria 2382
53 Ga0068854_100622986 3300005578 Bacteria 923
54 Ga0068859_100942628 3300005617 Bacteria 947
55 Ga0068864_100617949 3300005618 Bacteria 1053
56 Ga0068861_100185601 3300005719 Bacteria 1734
57 Ga0068863_101539645 3300005841 Unclassified 674
58 Ga0068858_100079887 3300005842 Bacteria 3038
59 Ga0068858_100656597 3300005842 Bacteria 1019
60 Ga0068860_100383224 3300005843 Bacteria 1388
61 Ga0068860_100567266 3300005843 Bacteria 1138
62 Ga0068860_101503077 3300005843 Unclassified 695
63 Ga0068862_100108334 3300005844 Unclassified 2436
64 Ga0068862_100284905 3300005844 Bacteria 1515
65 Ga0081539_10000037 3300005985 Bacteria 296160
66 Ga0070715_10159997 3300006163 Bacteria 1112
67 Ga0075428_100579315 3300006844 Unclassified 1199
68 Ga0075428_100944511 3300006844 Bacteria 914
69 Ga0075433_10007503 3300006852 Bacteria 8656
70 Ga0075434_100106649 3300006871 Bacteria 2811
71 Ga0075429_100114775 3300006880 Bacteria 2355
72 Ga0075429_100369885 3300006880 Bacteria 1255
73 Ga0075429_100471534 3300006880 Bacteria 1100
74 Ga0068865_101291466 3300006881 Unclassified 649
75 Ga0075436_100530281 3300006914 Bacteria 863
76 Ga0097620_100942683 3300006931 Bacteria 947
77 Ga0105240_10088719 3300009093 Bacteria 3783
78 Ga0105240_10776763 3300009093 Unclassified 1039
79 Ga0111539_10010166 3300009094 Bacteria 11858
80 Ga0111539_10449518 3300009094 Bacteria 1500
81 Ga0105243_10824186 3300009148 Bacteria 916
82 Ga0105241_10194133 3300009174 Bacteria 1692
83 Ga0105242_10000317 3300009176 Bacteria 38636
84 Ga0105242_11176649 3300009176 Unclassified 785
85 Ga0105248_10076706 3300009177 Bacteria 3756
86 Ga0105248_11992648 3300009177 Unclassified 660
87 Ga0105237_10837311 3300009545 Unclassified 927
88 Ga0105249_10400403 3300009553 Bacteria 1403
89 Ga0105246_10251865 3300011119 Bacteria 1402
90 Ga0157373_10027087 3300013100 Bacteria 4136
91 Ga0157370_10610707 3300013104 Bacteria 998
92 Ga0157370_10641108 3300013104 Bacteria 971
93 Ga0157369_10775043 3300013105 Bacteria 986
94 Ga0157378_10009993 3300013297 Bacteria 8275
95 Ga0157378_10040571 3300013297 Bacteria 4128
96 Ga0157378_10164862 3300013297 Bacteria 2075
97 Ga0157378_10858271 3300013297 Bacteria 936
98 Ga0157378_11178564 3300013297 Unclassified 805
99 Ga0157378_12318191 3300013297 Unclassified 588
100 Ga0157378_12439496 3300013297 Unclassified 575
101 Ga0163162_10257163 3300013306 Bacteria 1878
102 Ga0163162_11270239 3300013306 Bacteria 836
103 Ga0163162_12068995 3300013306 Bacteria 653
104 Ga0157375_10025252 3300013308 Bacteria 5517
105 Ga0157375_10418280 3300013308 Bacteria 1506
106 Ga0163163_11708781 3300014325 Unclassified 690
107 Ga0163163_12494607 3300014325 Unclassified 575
108 Ga0157377_10741179 3300014745 Bacteria 718
109 Ga0197907_10948308 3300020069 Bacteria 593
110 Ga0207685_10119482 3300025905 Bacteria 1154
111 Ga0207699_10000045 3300025906 Bacteria 112158
112 Ga0207654_10158144 3300025911 Bacteria 1461
113 Ga0207707_10027397 3300025912 Bacteria 4983
114 Ga0207695_10017404 3300025913 Bacteria 8364
115 Ga0207671_10411219 3300025914 Unclassified 1076
116 Ga0207660_10019523 3300025917 Bacteria 4532
117 Ga0207660_10428461 3300025917 Bacteria 1068
118 Ga0207662_10287383 3300025918 Bacteria 1090
119 Ga0207657_10094388 3300025919 Bacteria 2491
120 Ga0207649_10356288 3300025920 Bacteria 1084
121 Ga0207652_10026367 3300025921 Bacteria 4839
122 Ga0207652_10561026 3300025921 Bacteria 1026
123 Ga0207681_10147325 3300025923 Unclassified 1760
124 Ga0207681_10771595 3300025923 Unclassified 802
125 Ga0207650_10393059 3300025925 Bacteria 1146
126 Ga0207664_10041913 3300025929 Bacteria 3569
127 Ga0207644_10799446 3300025931 Bacteria 789
128 Ga0207686_10000167 3300025934 Bacteria 50181
129 Ga0207686_10885130 3300025934 Unclassified 720
130 Ga0207670_10744843 3300025936 Unclassified 813
131 Ga0207691_10003135 3300025940 Bacteria 16151
132 Ga0207689_10111377 3300025942 Bacteria 2250
133 Ga0207667_12015353 3300025949 Bacteria 537
134 Ga0207651_10131349 3300025960 Bacteria 1918
135 Ga0207651_10291703 3300025960 Bacteria 1353
136 Ga0207668_10007012 3300025972 Bacteria 6682
137 Ga0207640_10866458 3300025981 Bacteria 787
138 Ga0207703_10030352 3300026035 Bacteria 4272
139 Ga0207703_10456891 3300026035 Bacteria 1194
140 Ga0207708_10268021 3300026075 Bacteria 1380
141 Ga0207641_10214471 3300026088 Bacteria 1782
142 Ga0207648_10072414 3300026089 Bacteria 3003
143 Ga0209974_10017603 3300027876 Bacteria 2370
144 Ga0268265_10355931 3300028380 Bacteria 1338
145 Ga0268264_12452563 3300028381 Unclassified 527
146 Ga0316182_1074338 3300030745 Bacteria 2260
147 Ga0307408_100276733 3300031548 Bacteria 1396
148 Ga0307408_100412076 3300031548 Bacteria 1163
149 Ga0307408_101259945 3300031548 Unclassified 692
150 Ga0316576_10031246 3300031727 Unclassified 3778
151 Ga0307410_10274777 3300031852 Bacteria 1319
152 Ga0307406_11811045 3300031901 Unclassified 543
153 Ga0307407_10210591 3300031903 Unclassified 1308
154 Ga0307412_10107126 3300031911 Bacteria 1988
155 Ga0307412_10183741 3300031911 Unclassified 1575
156 Ga0307409_100165380 3300031995 Bacteria 1940
157 Ga0307416_102404934 3300032002 Bacteria 626
158 Ga0307411_10231004 3300032005 Bacteria 1442
159 Ga0307411_10339253 3300032005 Bacteria 1220
160 Ga0307415_100311448 3300032126 Bacteria 1308
161 Ga0373926_0011340 3300035083 Bacteria 2998
162 Ga0373923_0066113 3300035111 Bacteria 1545
163 Ga0373923_0200725 3300035111 Bacteria 922
164 Ga0373936_0383950 3300035113 Bacteria 643
165 Ga0373945_0023631 3300035116 Bacteria 2125
166 Ga0373953_0568457 3300035117 Bacteria 505
167 Ga0373954_0380885 3300035118 Bacteria 697
168 Ga0373943_0007138 3300035170 Bacteria 5012
169 Ga0373943_0031631 3300035170 Bacteria 2512
170 Ga0373946_0009262 3300035171 Bacteria 3623
171 Ga0373935_0099988 3300035692 Unclassified 1910
172 Ga0373935_0310913 3300035692 Bacteria 1116
173 Ga0373927_0020869 3300035695 Bacteria 4293
174 Ga0373933_1125446 3300035724 Bacteria 517
175 Ga0373947_0010717 3300035725 Bacteria 5262
176 Ga0373947_0010734 3300035725 Bacteria 5257
177 Ga0373937_0071415 3300036401 Bacteria 3202
178 Ga0373937_0094696 3300036401 Bacteria 2769
179 Ga0373925_0000471 3300037068 Bacteria 40194
180 Ga0395900_0623768 3300037418 Bacteria 1017
181 Ga0395905_0027208 3300037471 Bacteria 5393
182 Ga0395901_0611222 3300038443 Archaea 1098
183 Ga0395901_1291626 3300038443 Bacteria 692
184 Ga0436360_0680840 3300039438 Unclassified 891
185 Ga0439436_0076862 3300041404 Bacteria 930
186 Ga0439433_0006717 3300041999 Bacteria 2477
187 Ga0439457_097435 3300042014 Bacteria 684
188 Ga0439462_0020013 3300042015 Bacteria 1744
189 Ga0439435_0178736 3300042436 Bacteria 692
190 Ga0453684_0215024 3300044712 Bacteria 2231
191 Ga0453684_0573355 3300044712 Unclassified 1240
192 Ga0453684_2111809 3300044712 Bacteria 565
193 Ga0466970_0915014 3300044765 Bacteria 516
194 Ga0451576_0136971 3300045051 Bacteria 2553
195 Ga0451576_0228627 3300045051 Bacteria 1942
196 Ga0495603_0363353 3300046455 Bacteria 830
197 Ga0495629_0000003 3300046459 Bacteria 529162
198 Ga0495629_0000032 3300046459 Bacteria 123692
199 Ga0495580_0325869 3300046472 Unclassified 1044
200 Ga0495580_0421297 3300046472 Bacteria 898
201 Ga0495582_0034344 3300046473 Bacteria 2788
202 Ga0495582_0218851 3300046473 Bacteria 1089
203 Ga0495639_0000005 3300046475 Bacteria 100787
204 Ga0495662_0129323 3300046476 Bacteria 1241
205 Ga0495662_0347278 3300046476 Bacteria 729
206 Ga0495664_0120744 3300046477 Bacteria 1585
207 Ga0495594_0082818 3300046499 Unclassified 1793
208 Ga0495594_0149385 3300046499 Bacteria 1326
209 Ga0495666_0000166 3300046526 Bacteria 27902
210 Ga0495642_0328654 3300046528 Bacteria 671
211 Ga0495640_0096312 3300046533 Bacteria 1947
212 Ga0495640_0802183 3300046533 Bacteria 561
213 Ga0495586_0000096 3300046535 Bacteria 53659
214 Ga0495621_0006154 3300046539 Bacteria 3488
215 Ga0495668_0000900 3300046616 Bacteria 33461
216 Ga0495634_0136199 3300046642 Bacteria 1562
217 Ga0495635_0002701 3300046663 Bacteria 12141
218 Ga0495635_0410079 3300046663 Bacteria 899
219 Ga0495635_0950598 3300046663 Unclassified 548
220 Ga0495647_0003366 3300046681 Bacteria 5124
221 Ga0495658_0002173 3300046683 Bacteria 9917
222 Ga0495658_0038049 3300046683 Bacteria 2662
223 Ga0495613_0149152 3300046689 Bacteria 1668
224 Ga0495613_0265755 3300046689 Unclassified 1194
225 Ga0495581_0000295 3300047315 Bacteria 24200
226 Ga0495581_0010297 3300047315 Bacteria 5407
227 Ga0495581_0129607 3300047315 Bacteria 1470
228 Ga0495674_0720747 3300047319 Unclassified 781
229 Ga0495676_0022549 3300047321 Bacteria 5476
230 Ga0495676_0158985 3300047321 Unclassified 1600
231 Ga0495676_0319333 3300047321 Unclassified 1044
232 Ga0495680_0000996 3300047322 Bacteria 31538
233 Ga0495680_0020670 3300047322 Bacteria 5531
234 Ga0495680_0383412 3300047322 Bacteria 973
235 Ga0495677_0369781 3300047445 Unclassified 566
236 Ga0495684_0002777 3300047471 Bacteria 13815
237 Ga0495684_0718566 3300047471 Bacteria 660
238 Ga0495686_0547088 3300047472 Bacteria 605
239 Ga0495615_0001100 3300048090 Bacteria 3878
240 Ga0495615_0197398 3300048090 Bacteria 619
241 Ga0496100_0043636 3300048903 Bacteria 2869
242 Ga0496105_0188418 3300048908 Bacteria 1688
243 Ga0496109_0454573 3300048912 Bacteria 1210
244 Ga0496110_0657771 3300048913 Bacteria 948
245 Ga0496125_0343259 3300048928 Bacteria 895
246 Ga0501032_0001848 3300049569 Bacteria 16744
247 Ga0501033_0007901 3300049570 Bacteria 8239
248 Ga0501034_0052380 3300049571 Bacteria 4111
249 Ga0501036_0000291 3300049572 Bacteria 34715
250 Ga0501037_0073678 3300049573 Unclassified 2482
251 Ga0501038_0006848 3300049574 Bacteria 10530
252 Ga0501042_0105341 3300049578 Unclassified 2029
253 Ga0501043_0002471 3300049579 Bacteria 15634
254 Ga0501046_0028272 3300049580 Unclassified 4567
255 Ga0501047_0082098 3300049581 Bacteria 3098
256 Ga0501047_0097022 3300049581 Bacteria 2826
257 Ga0501048_0003554 3300049582 Bacteria 11854
258 Ga0501067_0004533 3300049583 Bacteria 7675
259 Ga0501068_0000373 3300049584 Bacteria 22602
260 Ga0501069_0000660 3300049585 Bacteria 16037
261 Ga0501070_0091420 3300049586 Unclassified 2518
262 Ga0501070_0542240 3300049586 Bacteria 932
263 Ga0501072_0014340 3300049588 Bacteria 6075
264 Ga0501073_0055104 3300049589 Unclassified 2782
265 Ga0501074_0002530 3300049590 Bacteria 12758
266 Ga0501077_0001692 3300049593 Bacteria 13295
267 Ga0501209_012068 3300049656 Unclassified 1831
268 Ga0501230_071345 3300049667 Bacteria 715
269 Ga0501242_007420 3300049674 Bacteria 1264
270 Ga0501249_013032 3300049679 Bacteria 1763
271 Ga0501257_011149 3300049686 Unclassified 2049
272 Ga0501079_0092305 3300049741 Unclassified 2345
273 Ga0501080_0000006 3300049742 Bacteria 138444
274 Ga0501083_0055537 3300049744 Unclassified 2654
275 Ga0501263_008146 3300049760 Bacteria 1245
276 Ga0501035_0177501 3300049822 Unclassified 1836
277 Ga0501044_0078071 3300049823 Bacteria 3356
278 Ga0501044_0122032 3300049823 Unclassified 2605
279 Ga0501045_0311452 3300049824 Unclassified 1171
280 nmdc:mga09592_1271031_c1 3300050508 Unclassified 606
281 nmdc:mga09592_25790_c1 3300050508 Bacteria 4867
282 nmdc:mga0qj67_100216_c1 3300050509 Bacteria 2335
283 nmdc:mga0qj67_39736_c1 3300050509 Bacteria 3696
284 nmdc:mga06r32_487047_c1 3300050510 Bacteria 1211
285 nmdc:mga08y16_21340_c1 3300050511 Bacteria 6838
286 nmdc:mga08y16_781208_c1 3300050511 Bacteria 949
287 nmdc:mga0n895_112993_c1 3300050512 Bacteria 2733
288 nmdc:mga0a205_366528_c1 3300050515 Bacteria 1307
289 nmdc:mga0a205_45188_c1 3300050515 Bacteria 4246
290 Ga0495619_0001073 3300053085 Bacteria 17935
291 Ga0501084_0003808 3300054114 Bacteria 12258
292 Ga0501082_0051567 3300060353 Bacteria 3546
293 2729908141 2728369276 Bacteria 5610032
294 8054613143 8054609563 Bacteria 5170090
295 Ga0501031_0002916
296 JGI25406J46586_10001824
297 Ga0065704_10186965
298 Ga0065715_10130417
299 Ga0065707_10022434
300 Ga0070683_100456592
301 Ga0068869_100052541
302 Ga0068869_101765554
303 Ga0070680_100249071
304 Ga0070680_100834870
305 Ga0070689_100042725
306 Ga0070689_100731951
307 Ga0070687_100406513
308 Ga0070661_100010370
309 Ga0070692_10902670
310 Ga0070668_100008003
311 Ga0070671_100410593
312 Ga0070673_100239889
313 Ga0070673_100564493
314 Ga0070713_100167447
315 Ga0070701_10351256
316 Ga0070701_10832730
317 Ga0070705_100208817
318 Ga0070705_101130896
319 Ga0070700_100081301
320 Ga0070700_101081076
321 Ga0070694_100000186
322 Ga0070694_100003330
323 Ga0070694_101161628
324 Ga0070662_100110192
325 Ga0068867_100235535
326 Ga0068867_100501824
327 Ga0070706_101598482
328 Ga0070707_100402600
329 Ga0070698_100123611
330 Ga0070679_100943370
331 Ga0070684_100129218
332 Ga0070697_100170267
333 Ga0070697_100736521
334 Ga0070697_100803026
335 Ga0070672_100063102
336 Ga0070686_100090987
337 Ga0070695_101192282
338 Ga0070696_100096641
339 Ga0070696_100158590
340 Ga0070693_100095211
341 Ga0070704_100021156
342 Ga0070704_100070134
343 Ga0070704_101157699
344 Ga0068855_100142578
345 Ga0070664_100704614
346 Ga0068854_100082135
347 Ga0068854_100622986
348 Ga0068859_100942628
349 Ga0068864_100617949
350 Ga0068861_100185601
351 Ga0068863_101539645
352 Ga0068858_100079887
353 Ga0068858_100656597
354 Ga0068860_100383224
355 Ga0068860_100567266
356 Ga0068860_101503077
357 Ga0068862_100108334
358 Ga0068862_100284905
359 Ga0081539_10000037
360 Ga0070715_10159997
361 Ga0075428_100579315
362 Ga0075428_100944511
363 Ga0075433_10007503
364 Ga0075434_100106649
365 Ga0075429_100114775
366 Ga0075429_100369885
367 Ga0075429_100471534
368 Ga0068865_101291466
369 Ga0075436_100530281
370 Ga0097620_100942683
371 Ga0105240_10088719
372 Ga0105240_10776763
373 Ga0111539_10010166
374 Ga0111539_10449518
375 Ga0105243_10824186
376 Ga0105241_10194133
377 Ga0105242_10000317
378 Ga0105242_11176649
379 Ga0105248_10076706
380 Ga0105248_11992648
381 Ga0105237_10837311
382 Ga0105249_10400403
383 Ga0105246_10251865
384 Ga0157373_10027087
385 Ga0157370_10610707
386 Ga0157370_10641108
387 Ga0157369_10775043
388 Ga0157378_10009993
389 Ga0157378_10040571
390 Ga0157378_10164862
391 Ga0157378_10858271
392 Ga0157378_11178564
393 Ga0157378_12318191
394 Ga0157378_12439496
395 Ga0163162_10257163
396 Ga0163162_11270239
397 Ga0163162_12068995
398 Ga0157375_10025252
399 Ga0157375_10418280
400 Ga0163163_11708781
401 Ga0163163_12494607
402 Ga0157377_10741179
403 Ga0197907_10948308
404 Ga0207685_10119482
405 Ga0207699_10000045
406 Ga0207654_10158144
407 Ga0207707_10027397
408 Ga0207695_10017404
409 Ga0207671_10411219
410 Ga0207660_10019523
411 Ga0207660_10428461
412 Ga0207662_10287383
413 Ga0207657_10094388
414 Ga0207649_10356288
415 Ga0207652_10026367
416 Ga0207652_10561026
417 Ga0207681_10147325
418 Ga0207681_10771595
419 Ga0207650_10393059
420 Ga0207664_10041913
421 Ga0207644_10799446
422 Ga0207686_10000167
423 Ga0207686_10885130
424 Ga0207670_10744843
425 Ga0207691_10003135
426 Ga0207689_10111377
427 Ga0207667_12015353
428 Ga0207651_10131349
429 Ga0207651_10291703
430 Ga0207668_10007012
431 Ga0207640_10866458
432 Ga0207703_10030352
433 Ga0207703_10456891
434 Ga0207708_10268021
435 Ga0207641_10214471
436 Ga0207648_10072414
437 Ga0209974_10017603
438 Ga0268265_10355931
439 Ga0268264_12452563
440 Ga0316182_1074338
441 Ga0307408_100276733
442 Ga0307408_100412076
443 Ga0307408_101259945
444 Ga0316576_10031246
445 Ga0307410_10274777
446 Ga0307406_11811045
447 Ga0307407_10210591
448 Ga0307412_10107126
449 Ga0307412_10183741
450 Ga0307409_100165380
451 Ga0307416_102404934
452 Ga0307411_10231004
453 Ga0307411_10339253
454 Ga0307415_100311448
455 Ga0373926_0011340
456 Ga0373923_0066113
457 Ga0373923_0200725
458 Ga0373936_0383950
459 Ga0373945_0023631
460 Ga0373953_0568457
461 Ga0373954_0380885
462 Ga0373943_0007138
463 Ga0373943_0031631
464 Ga0373946_0009262
465 Ga0373935_0099988
466 Ga0373935_0310913
467 Ga0373927_0020869
468 Ga0373933_1125446
469 Ga0373947_0010717
470 Ga0373947_0010734
471 Ga0373937_0071415
472 Ga0373937_0094696
473 Ga0373925_0000471
474 Ga0395900_0623768
475 Ga0395905_0027208
476 Ga0395901_0611222
477 Ga0395901_1291626
478 Ga0436360_0680840
479 Ga0439436_0076862
480 Ga0439433_0006717
481 Ga0439457_097435
482 Ga0439462_0020013
483 Ga0439435_0178736
484 Ga0453684_0215024
485 Ga0453684_0573355
486 Ga0453684_2111809
487 Ga0466970_0915014
488 Ga0451576_0136971
489 Ga0451576_0228627
490 Ga0495603_0363353
491 Ga0495629_0000003
492 Ga0495629_0000032
493 Ga0495580_0325869
494 Ga0495580_0421297
495 Ga0495582_0034344
496 Ga0495582_0218851
497 Ga0495639_0000005
498 Ga0495662_0129323
499 Ga0495662_0347278
500 Ga0495664_0120744
501 Ga0495594_0082818
502 Ga0495594_0149385
503 Ga0495666_0000166
504 Ga0495642_0328654
505 Ga0495640_0096312
506 Ga0495640_0802183
507 Ga0495586_0000096
508 Ga0495621_0006154
509 Ga0495668_0000900
510 Ga0495634_0136199
511 Ga0495635_0002701
512 Ga0495635_0410079
513 Ga0495635_0950598
514 Ga0495647_0003366
515 Ga0495658_0002173
516 Ga0495658_0038049
517 Ga0495613_0149152
518 Ga0495613_0265755
519 Ga0495581_0000295
520 Ga0495581_0010297
521 Ga0495581_0129607
522 Ga0495674_0720747
523 Ga0495676_0022549
524 Ga0495676_0158985
525 Ga0495676_0319333
526 Ga0495680_0000996
527 Ga0495680_0020670
528 Ga0495680_0383412
529 Ga0495677_0369781
530 Ga0495684_0002777
531 Ga0495684_0718566
532 Ga0495686_0547088
533 Ga0495615_0001100
534 Ga0495615_0197398
535 Ga0496100_0043636
536 Ga0496105_0188418
537 Ga0496109_0454573
538 Ga0496110_0657771
539 Ga0496125_0343259
540 Ga0501032_0001848
541 Ga0501033_0007901
542 Ga0501034_0052380
543 Ga0501036_0000291
544 Ga0501037_0073678
545 Ga0501038_0006848
546 Ga0501042_0105341
547 Ga0501043_0002471
548 Ga0501046_0028272
549 Ga0501047_0082098
550 Ga0501047_0097022
551 Ga0501048_0003554
552 Ga0501067_0004533
553 Ga0501068_0000373
554 Ga0501069_0000660
555 Ga0501070_0091420
556 Ga0501070_0542240
557 Ga0501072_0014340
558 Ga0501073_0055104
559 Ga0501074_0002530
560 Ga0501077_0001692
561 Ga0501209_012068
562 Ga0501230_071345
563 Ga0501242_007420
564 Ga0501249_013032
565 Ga0501257_011149
566 Ga0501079_0092305
567 Ga0501080_0000006
568 Ga0501083_0055537
569 Ga0501263_008146
570 Ga0501035_0177501
571 Ga0501044_0078071
572 Ga0501044_0122032
573 Ga0501045_0311452
574 nmdc:mga09592_1271031_c1
575 nmdc:mga09592_25790_c1
576 nmdc:mga0qj67_100216_c1
577 nmdc:mga0qj67_39736_c1
578 nmdc:mga06r32_487047_c1
579 nmdc:mga08y16_21340_c1
580 nmdc:mga08y16_781208_c1
581 nmdc:mga0n895_112993_c1
582 nmdc:mga0a205_366528_c1
583 nmdc:mga0a205_45188_c1
584 Ga0495619_0001073
585 Ga0501084_0003808
586 Ga0501082_0051567
587 2729908141
588 8054613143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

35

154

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9702 2 127
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9622 2 127
6izh-assembly1.cif.gz_F crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9503 17 126
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9476 18 126
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9431 18 126
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9702 2 127 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9622 2 127 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9595 18 126 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9476 18 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9371 19 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A382AF47-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9933 42 127 GO:0016779
AF-A0A381V5Z9-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9881 36 125 GO:0005525
GO:0006777
GO:0016779
AF-A0A2N1URX0-F1-model_v4 Enamine deaminase RidA 0.9875 2 126
AF-A0A2V7BSY2-F1-model_v4 RidA family protein 0.9871 2 127
AF-A0A4R4R3J9-F1-model_v4 RidA family protein 0.9871 2 127

Map