F392127

General Info

Members Datasets Scaffolds Average Seq Length
294 172 588 140

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10942523|Ga0207669_109425231
Length 148
Sequence MLRTMLKSKIHRATVTRADLHYVGSLTVDEDLLDAADLLPGERVAVVDVTNGARLETYVIAAAHLVHPGDLVIVISYGVMDNAEAAGYRPKVVFVDGDNRVVTAGADAGHVPPGFGLRDGRSDSTEPELPAAETADAARLDALLSTES

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
94 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
95 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
161 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2558860280 Kutzneria sp. 744 Isolate Unclassified
164 2643221576 Nocardioides sp. Root614 Isolate Unclassified
165 2643221590 Nocardioides sp. Root682 Isolate Unclassified
166 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
167 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
168 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
169 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
170 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
171 2891562705 Microbispora tritici MT50 Isolate Unclassified
172 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 3.06
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0.34
Rhizoplane 5.78
Rhizosphere 74.15
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10942523 3300025937 Bacteria 723
2 Ga0070658_10045715 3300005327 Bacteria 3540
3 Ga0070658_10050004 3300005327 Bacteria 3388
4 Ga0070666_10629871 3300005335 Bacteria 784
5 Ga0070680_100004568 3300005336 Bacteria 10406
6 Ga0070680_100070481 3300005336 Bacteria 2871
7 Ga0070680_100466739 3300005336 Bacteria 1079
8 Ga0070660_100023250 3300005339 Bacteria 4592
9 Ga0070660_100092513 3300005339 Bacteria 2387
10 Ga0070660_100190551 3300005339 Bacteria 1661
11 Ga0070660_101352143 3300005339 Bacteria 605
12 Ga0070659_100091538 3300005366 Bacteria 2438
13 Ga0070714_101565078 3300005435 Bacteria 644
14 Ga0070713_100137612 3300005436 Bacteria 2159
15 Ga0070681_10000038 3300005458 Bacteria 94717
16 Ga0070681_10099672 3300005458 Bacteria 2851
17 Ga0070681_10341726 3300005458 Bacteria 1407
18 Ga0070679_100000016 3300005530 Bacteria 139454
19 Ga0070679_100005863 3300005530 Bacteria 11406
20 Ga0070679_100022448 3300005530 Bacteria 6167
21 Ga0070679_100264632 3300005530 Bacteria 1674
22 Ga0070679_100530577 3300005530 Bacteria 1121
23 Ga0070684_100057761 3300005535 Bacteria 3389
24 Ga0070665_100693675 3300005548 Bacteria 1031
25 Ga0068855_101944594 3300005563 Bacteria 595
26 Ga0068856_100662938 3300005614 Bacteria 1064
27 Ga0068856_101892226 3300005614 Bacteria 608
28 Ga0068852_102436589 3300005616 Bacteria 544
29 Ga0068863_102628476 3300005841 Bacteria 512
30 Ga0075365_10005015 3300006038 Bacteria 7095
31 Ga0075365_10015349 3300006038 Bacteria 4632
32 Ga0075365_10019653 3300006038 Bacteria 4174
33 Ga0075365_10049695 3300006038 Bacteria 2763
34 Ga0075365_10069397 3300006038 Bacteria 2369
35 Ga0075365_10327785 3300006038 Bacteria 1078
36 Ga0075365_11226417 3300006038 Bacteria 527
37 Ga0075368_10001233 3300006042 Bacteria 8088
38 Ga0075363_100163957 3300006048 Bacteria 1259
39 Ga0075363_100270999 3300006048 Bacteria 980
40 Ga0075364_10026197 3300006051 Bacteria 3718
41 Ga0075364_10029860 3300006051 Bacteria 3497
42 Ga0075364_10077498 3300006051 Bacteria 2194
43 Ga0075364_10080994 3300006051 Bacteria 2146
44 Ga0075364_10305719 3300006051 Bacteria 1083
45 Ga0075367_10060688 3300006178 Bacteria 2255
46 Ga0075370_10003568 3300006353 Bacteria 7437
47 Ga0075370_10323553 3300006353 Bacteria 919
48 Ga0075431_100002337 3300006847 Bacteria 18208
49 Ga0075431_100224925 3300006847 Unclassified 1913
50 Ga0075431_100613923 3300006847 Bacteria 1070
51 Ga0075433_10282439 3300006852 Bacteria 1470
52 Ga0075434_100143001 3300006871 Bacteria 2412
53 Ga0075434_100859625 3300006871 Bacteria 922
54 Ga0075429_100084444 3300006880 Bacteria 2767
55 Ga0105240_10538016 3300009093 Bacteria 1294
56 Ga0111539_10021952 3300009094 Bacteria 7846
57 Ga0105245_10605750 3300009098 Bacteria 1122
58 Ga0114129_10468566 3300009147 Bacteria 1650
59 Ga0105243_10533437 3300009148 Bacteria 1118
60 Ga0105242_10095764 3300009176 Bacteria 2507
61 Ga0105242_10478907 3300009176 Bacteria 1179
62 Ga0105237_10026878 3300009545 Bacteria 5881
63 Ga0105239_10263208 3300010375 Bacteria 1938
64 Ga0105239_12286543 3300010375 Bacteria 629
65 Ga0157317_1028418 3300012475 Bacteria 534
66 Ga0157371_10005042 3300013102 Bacteria 11298
67 Ga0157370_10091197 3300013104 Bacteria 2861
68 Ga0157370_11151361 3300013104 Bacteria 700
69 Ga0157369_10001452 3300013105 Bacteria 29085
70 Ga0157369_10025736 3300013105 Bacteria 6528
71 Ga0157369_10069628 3300013105 Bacteria 3780
72 Ga0157369_10149260 3300013105 Bacteria 2471
73 Ga0157369_12259361 3300013105 Bacteria 551
74 Ga0157378_11621635 3300013297 Bacteria 693
75 Ga0157372_10121717 3300013307 Bacteria 2998
76 Ga0157372_10584226 3300013307 Bacteria 1302
77 Ga0157372_10702151 3300013307 Bacteria 1177
78 Ga0157372_11011116 3300013307 Bacteria 963
79 Ga0157372_12995819 3300013307 Bacteria 540
80 Ga0157375_10276513 3300013308 Bacteria 1842
81 Ga0163163_10678769 3300014325 Bacteria 1094
82 Ga0197907_10226394 3300020069 Bacteria 648
83 Ga0206354_10157694 3300020081 Bacteria 3250
84 Ga0206353_11266382 3300020082 Bacteria 936
85 Ga0224712_10009729 3300022467 Bacteria 2911
86 Ga0224712_10199073 3300022467 Bacteria 910
87 Ga0224712_10283437 3300022467 Bacteria 772
88 Ga0224712_10415947 3300022467 Bacteria 642
89 Ga0207680_10371728 3300025903 Bacteria 1007
90 Ga0207705_10041680 3300025909 Bacteria 3294
91 Ga0207705_10253991 3300025909 Bacteria 1341
92 Ga0207705_10381150 3300025909 Bacteria 1089
93 Ga0207705_10422362 3300025909 Bacteria 1032
94 Ga0207705_11443874 3300025909 Bacteria 522
95 Ga0207707_10000085 3300025912 Bacteria 94740
96 Ga0207707_10025922 3300025912 Bacteria 5127
97 Ga0207707_10190260 3300025912 Bacteria 1790
98 Ga0207695_11083989 3300025913 Bacteria 681
99 Ga0207671_10015346 3300025914 Bacteria 6001
100 Ga0207660_10001339 3300025917 Bacteria 16477
101 Ga0207660_10178892 3300025917 Bacteria 1646
102 Ga0207657_10024841 3300025919 Bacteria 5538
103 Ga0207657_10037247 3300025919 Bacteria 4344
104 Ga0207652_10000015 3300025921 Bacteria 193042
105 Ga0207652_10046720 3300025921 Bacteria 3696
106 Ga0207652_10093290 3300025921 Bacteria 2649
107 Ga0207652_10103962 3300025921 Bacteria 2512
108 Ga0207652_11324464 3300025921 Bacteria 623
109 Ga0207687_10670813 3300025927 Bacteria 878
110 Ga0207700_10181666 3300025928 Bacteria 1762
111 Ga0207664_10246309 3300025929 Bacteria 1558
112 Ga0207664_11591350 3300025929 Bacteria 575
113 Ga0207690_10001435 3300025932 Bacteria 14911
114 Ga0207690_10003630 3300025932 Bacteria 9188
115 Ga0207690_10999938 3300025932 Bacteria 696
116 Ga0207690_11126732 3300025932 Bacteria 654
117 Ga0207686_10250361 3300025934 Bacteria 1294
118 Ga0207686_10724286 3300025934 Bacteria 792
119 Ga0207709_10978281 3300025935 Bacteria 691
120 Ga0207704_11723794 3300025938 Bacteria 539
121 Ga0207665_10880883 3300025939 Bacteria 710
122 Ga0207661_10011250 3300025944 Bacteria 6476
123 Ga0207661_11918867 3300025944 Bacteria 538
124 Ga0207667_11680608 3300025949 Bacteria 602
125 Ga0207677_10222590 3300026023 Bacteria 1514
126 Ga0207702_11178355 3300026078 Bacteria 760
127 Ga0207702_11235947 3300026078 Bacteria 741
128 Ga0207641_12161686 3300026088 Bacteria 557
129 Ga0207674_10063674 3300026116 Bacteria 3722
130 Ga0207683_11044151 3300026121 Bacteria 758
131 Ga0209813_10011601 3300027866 Bacteria 2308
132 Ga0207428_10108043 3300027907 Bacteria 2143
133 Ga0307511_10010018 3300030521 Bacteria 9427
134 Ga0316182_1071428 3300030745 Bacteria 661
135 Ga0307513_10022819 3300031456 Bacteria 7343
136 Ga0307408_100608103 3300031548 Bacteria 972
137 Ga0307405_11175472 3300031731 Bacteria 662
138 Ga0307413_10603029 3300031824 Bacteria 899
139 Ga0307413_10633772 3300031824 Bacteria 879
140 Ga0307518_10231350 3300031838 Bacteria 1196
141 Ga0307410_10130754 3300031852 Bacteria 1844
142 Ga0307412_10190770 3300031911 Bacteria 1549
143 Ga0307412_10379989 3300031911 Bacteria 1143
144 Ga0307409_100009328 3300031995 Bacteria 6022
145 Ga0307409_100245787 3300031995 Bacteria 1632
146 Ga0307409_100596751 3300031995 Bacteria 1091
147 Ga0307416_100000233 3300032002 Bacteria 29604
148 Ga0307416_101103713 3300032002 Bacteria 898
149 Ga0307416_101544143 3300032002 Bacteria 769
150 Ga0307411_10161742 3300032005 Bacteria 1678
151 Ga0307411_10486942 3300032005 Bacteria 1040
152 Ga0307415_100000040 3300032126 Bacteria 56119
153 Ga0307415_100125104 3300032126 Bacteria 1936
154 Ga0373935_0005167 3300035692 Bacteria 7684
155 Ga0395898_0306177 3300037466 Bacteria 1516
156 Ga0395901_0389033 3300038443 Bacteria 1434
157 Ga0395901_0546745 3300038443 Bacteria 1174
158 Ga0436365_0709781 3300039437 Bacteria 17514
159 Ga0436361_0627132 3300039447 Bacteria 1113
160 Ga0436363_1407549 3300039450 Bacteria 5549
161 Ga0451795_1678254 3300041456 Bacteria 624
162 Ga0451807_1225050 3300041486 Bacteria 547
163 Ga0451807_2771272 3300041486 Bacteria 949
164 Ga0451835_1200845 3300041492 Bacteria 743
165 Ga0451849_1106866 3300041505 Bacteria 724
166 Ga0451855_0912182 3300041511 Bacteria 616
167 Ga0451853_3120108 3300041512 Bacteria 835
168 Ga0439445_0144655 3300042004 Bacteria 690
169 Ga0466965_0012114 3300044683 Bacteria 4050
170 Ga0466965_0949526 3300044683 Bacteria 503
171 Ga0466966_0211454 3300044684 Bacteria 1172
172 Ga0466961_0030591 3300044693 Bacteria 3460
173 Ga0466961_0041925 3300044693 Bacteria 2934
174 Ga0466961_0089501 3300044693 Bacteria 1944
175 Ga0466963_0193236 3300044694 Bacteria 1422
176 Ga0466963_0299007 3300044694 Bacteria 1132
177 Ga0466963_0823870 3300044694 Bacteria 654
178 Ga0466964_0417017 3300044706 Bacteria 705
179 Ga0466971_0029462 3300044719 Bacteria 2455
180 Ga0466970_0016248 3300044765 Bacteria 3835
181 Ga0466970_0114967 3300044765 Bacteria 1471
182 Ga0466970_0120151 3300044765 Bacteria 1439
183 Ga0466957_0092846 3300044842 Bacteria 1893
184 Ga0466957_0173873 3300044842 Bacteria 1404
185 Ga0466957_0260200 3300044842 Bacteria 1156
186 Ga0466957_0672464 3300044842 Bacteria 729
187 Ga0466960_0101724 3300044901 Bacteria 1481
188 Ga0466959_0329579 3300045049 Bacteria 1043
189 Ga0466959_0476655 3300045049 Bacteria 845
190 Ga0466958_0005052 3300045836 Bacteria 7047
191 Ga0466958_0165326 3300045836 Bacteria 1400
192 Ga0466967_0031920 3300045976 Bacteria 4441
193 Ga0466967_0084934 3300045976 Bacteria 2865
194 Ga0466967_0176659 3300045976 Bacteria 2012
195 Ga0466967_0402684 3300045976 Bacteria 1332
196 Ga0466967_0470843 3300045976 Bacteria 1230
197 Ga0466967_0662713 3300045976 Bacteria 1032
198 Ga0466967_0795214 3300045976 Bacteria 939
199 Ga0495651_0278227 3300046462 Bacteria 1132
200 Ga0495594_0031957 3300046499 Bacteria 2856
201 Ga0495635_0348388 3300046663 Bacteria 988
202 Ga0496101_1223826 3300048904 Bacteria 588
203 Ga0496102_0002352 3300048905 Bacteria 16129
204 Ga0496102_0067554 3300048905 Bacteria 3280
205 Ga0496102_0546661 3300048905 Bacteria 1081
206 Ga0496103_0024397 3300048906 Bacteria 3651
207 Ga0496109_0284293 3300048912 Bacteria 1559
208 Ga0496110_0448470 3300048913 Bacteria 1176
209 Ga0496111_1188994 3300048914 Bacteria 541
210 Ga0496112_0381375 3300048915 Bacteria 1351
211 Ga0496112_0479646 3300048915 Bacteria 1180
212 Ga0496113_0671560 3300048916 Bacteria 828
213 Ga0496113_1312637 3300048916 Bacteria 562
214 Ga0496115_0074112 3300048918 Bacteria 2764
215 Ga0496115_0339610 3300048918 Bacteria 1226
216 Ga0496116_0048817 3300048919 Bacteria 2837
217 Ga0496117_0025879 3300048920 Bacteria 4601
218 Ga0496117_0142852 3300048920 Bacteria 1430
219 Ga0496118_0019423 3300048921 Bacteria 6073
220 Ga0496121_0006856 3300048924 Bacteria 13926
221 Ga0501315_039088 3300049531 Bacteria 712
222 Ga0501032_0056694 3300049569 Bacteria 2633
223 Ga0501033_0714426 3300049570 Bacteria 681
224 Ga0501034_0018999 3300049571 Bacteria 7039
225 Ga0501034_0467142 3300049571 Bacteria 1178
226 Ga0501036_0015614 3300049572 Bacteria 6344
227 Ga0501037_0024489 3300049573 Bacteria 4464
228 Ga0501037_0084693 3300049573 Bacteria 2296
229 Ga0501042_0027155 3300049578 Bacteria 4024
230 Ga0501043_0001083 3300049579 Bacteria 23963
231 Ga0501043_0488255 3300049579 Bacteria 921
232 Ga0501047_0000554 3300049581 Bacteria 40199
233 Ga0501047_0171983 3300049581 Bacteria 2035
234 Ga0501048_0306269 3300049582 Bacteria 1130
235 Ga0501067_0130649 3300049583 Bacteria 1398
236 Ga0501069_0069755 3300049585 Bacteria 1968
237 Ga0501069_0082405 3300049585 Bacteria 1813
238 Ga0501070_0006001 3300049586 Bacteria 10344
239 Ga0501070_0012434 3300049586 Bacteria 7178
240 Ga0501070_0035365 3300049586 Bacteria 4175
241 Ga0501070_0228672 3300049586 Bacteria 1524
242 Ga0501073_0242396 3300049589 Bacteria 1245
243 Ga0501073_0280753 3300049589 Bacteria 1149
244 Ga0501074_0013464 3300049590 Bacteria 5947
245 Ga0501074_0112461 3300049590 Bacteria 1948
246 Ga0501075_1486724 3300049591 Bacteria 513
247 Ga0501080_0004988 3300049742 Bacteria 11821
248 Ga0501080_0048292 3300049742 Bacteria 3962
249 Ga0501080_0060010 3300049742 Bacteria 3539
250 Ga0501044_0006683 3300049823 Bacteria 12714
251 Ga0501044_0068171 3300049823 Bacteria 3625
252 Ga0501044_0249426 3300049823 Bacteria 1717
253 nmdc:mga03683_525307_c1 3300050489 Bacteria 575
254 nmdc:mga03n38_438911_c1 3300050490 Bacteria 724
255 nmdc:mga03n38_95438_c1 3300050490 Bacteria 1425
256 nmdc:mga00v17_38926_c1 3300050491 Bacteria 2845
257 nmdc:mga00v17_73467_c1 3300050491 Bacteria 2124
258 nmdc:mga0yw44_17897_c1 3300050492 Bacteria 3868
259 nmdc:mga0yw44_21943_c1 3300050492 Bacteria 3571
260 nmdc:mga0yw44_23342_c1 3300050492 Bacteria 3484
261 nmdc:mga0yw44_39249_c1 3300050492 Bacteria 2806
262 nmdc:mga0yw44_53737_c1 3300050492 Bacteria 2447
263 nmdc:mga0yw44_564821_c1 3300050492 Bacteria 773
264 nmdc:mga0yw44_61501_c1 3300050492 Bacteria 2304
265 nmdc:mga0yw44_62370_c1 3300050492 Bacteria 2289
266 nmdc:mga06z11_5807_c1 3300050494 Bacteria 4978
267 nmdc:mga06z11_83170_c1 3300050494 Bacteria 1722
268 nmdc:mga09592_23951_c1 3300050508 Bacteria 5047
269 nmdc:mga09592_72818_c1 3300050508 Bacteria 2918
270 nmdc:mga06r32_1276272_c1 3300050510 Bacteria 679
271 nmdc:mga06r32_169046_c1 3300050510 Bacteria 2170
272 nmdc:mga06r32_185002_c1 3300050510 Bacteria 2070
273 nmdc:mga08y16_57701_c1 3300050511 Bacteria 4056
274 nmdc:mga0n895_801268_c1 3300050512 Bacteria 932
275 nmdc:mga0rr50_1395238_c1 3300050513 Bacteria 593
276 nmdc:mga08x19_927270_c1 3300050514 Bacteria 619
277 nmdc:mga0a205_183346_c1 3300050515 Bacteria 1987
278 Ga0500644_0000100 3300053088 Bacteria 54794
279 Ga0500651_0611001 3300053093 Bacteria 591
280 Ga0500641_0054010 3300053096 Bacteria 1660
281 Ga0500594_0047105 3300053118 Bacteria 1201
282 Ga0500588_0000582 3300053146 Bacteria 5982
283 Ga0587128_108758 3300059630 Bacteria 590
284 Ga0466962_0026812 3300061719 Bacteria 2767
285 2559425076 2558860280 Bacteria 11429938
286 2643892788 2643221576 Bacteria 5214352
287 2643962237 2643221590 Bacteria 5214697
288 2676485879 2675903059 Bacteria 8644972
289 2785372091 2784746768 Bacteria 10036182
290 2816423528 2816332119 Bacteria 8120218
291 2819745940 2818991472 Bacteria 10089953
292 2873315621 2873314349 Bacteria 8512634
293 2891567820 2891562705 Bacteria 8039471
294 8054614251 8054609563 Bacteria 5170090
295 Ga0207669_10942523
296 Ga0070658_10045715
297 Ga0070658_10050004
298 Ga0070666_10629871
299 Ga0070680_100004568
300 Ga0070680_100070481
301 Ga0070680_100466739
302 Ga0070660_100023250
303 Ga0070660_100092513
304 Ga0070660_100190551
305 Ga0070660_101352143
306 Ga0070659_100091538
307 Ga0070714_101565078
308 Ga0070713_100137612
309 Ga0070681_10000038
310 Ga0070681_10099672
311 Ga0070681_10341726
312 Ga0070679_100000016
313 Ga0070679_100005863
314 Ga0070679_100022448
315 Ga0070679_100264632
316 Ga0070679_100530577
317 Ga0070684_100057761
318 Ga0070665_100693675
319 Ga0068855_101944594
320 Ga0068856_100662938
321 Ga0068856_101892226
322 Ga0068852_102436589
323 Ga0068863_102628476
324 Ga0075365_10005015
325 Ga0075365_10015349
326 Ga0075365_10019653
327 Ga0075365_10049695
328 Ga0075365_10069397
329 Ga0075365_10327785
330 Ga0075365_11226417
331 Ga0075368_10001233
332 Ga0075363_100163957
333 Ga0075363_100270999
334 Ga0075364_10026197
335 Ga0075364_10029860
336 Ga0075364_10077498
337 Ga0075364_10080994
338 Ga0075364_10305719
339 Ga0075367_10060688
340 Ga0075370_10003568
341 Ga0075370_10323553
342 Ga0075431_100002337
343 Ga0075431_100224925
344 Ga0075431_100613923
345 Ga0075433_10282439
346 Ga0075434_100143001
347 Ga0075434_100859625
348 Ga0075429_100084444
349 Ga0105240_10538016
350 Ga0111539_10021952
351 Ga0105245_10605750
352 Ga0114129_10468566
353 Ga0105243_10533437
354 Ga0105242_10095764
355 Ga0105242_10478907
356 Ga0105237_10026878
357 Ga0105239_10263208
358 Ga0105239_12286543
359 Ga0157317_1028418
360 Ga0157371_10005042
361 Ga0157370_10091197
362 Ga0157370_11151361
363 Ga0157369_10001452
364 Ga0157369_10025736
365 Ga0157369_10069628
366 Ga0157369_10149260
367 Ga0157369_12259361
368 Ga0157378_11621635
369 Ga0157372_10121717
370 Ga0157372_10584226
371 Ga0157372_10702151
372 Ga0157372_11011116
373 Ga0157372_12995819
374 Ga0157375_10276513
375 Ga0163163_10678769
376 Ga0197907_10226394
377 Ga0206354_10157694
378 Ga0206353_11266382
379 Ga0224712_10009729
380 Ga0224712_10199073
381 Ga0224712_10283437
382 Ga0224712_10415947
383 Ga0207680_10371728
384 Ga0207705_10041680
385 Ga0207705_10253991
386 Ga0207705_10381150
387 Ga0207705_10422362
388 Ga0207705_11443874
389 Ga0207707_10000085
390 Ga0207707_10025922
391 Ga0207707_10190260
392 Ga0207695_11083989
393 Ga0207671_10015346
394 Ga0207660_10001339
395 Ga0207660_10178892
396 Ga0207657_10024841
397 Ga0207657_10037247
398 Ga0207652_10000015
399 Ga0207652_10046720
400 Ga0207652_10093290
401 Ga0207652_10103962
402 Ga0207652_11324464
403 Ga0207687_10670813
404 Ga0207700_10181666
405 Ga0207664_10246309
406 Ga0207664_11591350
407 Ga0207690_10001435
408 Ga0207690_10003630
409 Ga0207690_10999938
410 Ga0207690_11126732
411 Ga0207686_10250361
412 Ga0207686_10724286
413 Ga0207709_10978281
414 Ga0207704_11723794
415 Ga0207665_10880883
416 Ga0207661_10011250
417 Ga0207661_11918867
418 Ga0207667_11680608
419 Ga0207677_10222590
420 Ga0207702_11178355
421 Ga0207702_11235947
422 Ga0207641_12161686
423 Ga0207674_10063674
424 Ga0207683_11044151
425 Ga0209813_10011601
426 Ga0207428_10108043
427 Ga0307511_10010018
428 Ga0316182_1071428
429 Ga0307513_10022819
430 Ga0307408_100608103
431 Ga0307405_11175472
432 Ga0307413_10603029
433 Ga0307413_10633772
434 Ga0307518_10231350
435 Ga0307410_10130754
436 Ga0307412_10190770
437 Ga0307412_10379989
438 Ga0307409_100009328
439 Ga0307409_100245787
440 Ga0307409_100596751
441 Ga0307416_100000233
442 Ga0307416_101103713
443 Ga0307416_101544143
444 Ga0307411_10161742
445 Ga0307411_10486942
446 Ga0307415_100000040
447 Ga0307415_100125104
448 Ga0373935_0005167
449 Ga0395898_0306177
450 Ga0395901_0389033
451 Ga0395901_0546745
452 Ga0436365_0709781
453 Ga0436361_0627132
454 Ga0436363_1407549
455 Ga0451795_1678254
456 Ga0451807_1225050
457 Ga0451807_2771272
458 Ga0451835_1200845
459 Ga0451849_1106866
460 Ga0451855_0912182
461 Ga0451853_3120108
462 Ga0439445_0144655
463 Ga0466965_0012114
464 Ga0466965_0949526
465 Ga0466966_0211454
466 Ga0466961_0030591
467 Ga0466961_0041925
468 Ga0466961_0089501
469 Ga0466963_0193236
470 Ga0466963_0299007
471 Ga0466963_0823870
472 Ga0466964_0417017
473 Ga0466971_0029462
474 Ga0466970_0016248
475 Ga0466970_0114967
476 Ga0466970_0120151
477 Ga0466957_0092846
478 Ga0466957_0173873
479 Ga0466957_0260200
480 Ga0466957_0672464
481 Ga0466960_0101724
482 Ga0466959_0329579
483 Ga0466959_0476655
484 Ga0466958_0005052
485 Ga0466958_0165326
486 Ga0466967_0031920
487 Ga0466967_0084934
488 Ga0466967_0176659
489 Ga0466967_0402684
490 Ga0466967_0470843
491 Ga0466967_0662713
492 Ga0466967_0795214
493 Ga0495651_0278227
494 Ga0495594_0031957
495 Ga0495635_0348388
496 Ga0496101_1223826
497 Ga0496102_0002352
498 Ga0496102_0067554
499 Ga0496102_0546661
500 Ga0496103_0024397
501 Ga0496109_0284293
502 Ga0496110_0448470
503 Ga0496111_1188994
504 Ga0496112_0381375
505 Ga0496112_0479646
506 Ga0496113_0671560
507 Ga0496113_1312637
508 Ga0496115_0074112
509 Ga0496115_0339610
510 Ga0496116_0048817
511 Ga0496117_0025879
512 Ga0496117_0142852
513 Ga0496118_0019423
514 Ga0496121_0006856
515 Ga0501315_039088
516 Ga0501032_0056694
517 Ga0501033_0714426
518 Ga0501034_0018999
519 Ga0501034_0467142
520 Ga0501036_0015614
521 Ga0501037_0024489
522 Ga0501037_0084693
523 Ga0501042_0027155
524 Ga0501043_0001083
525 Ga0501043_0488255
526 Ga0501047_0000554
527 Ga0501047_0171983
528 Ga0501048_0306269
529 Ga0501067_0130649
530 Ga0501069_0069755
531 Ga0501069_0082405
532 Ga0501070_0006001
533 Ga0501070_0012434
534 Ga0501070_0035365
535 Ga0501070_0228672
536 Ga0501073_0242396
537 Ga0501073_0280753
538 Ga0501074_0013464
539 Ga0501074_0112461
540 Ga0501075_1486724
541 Ga0501080_0004988
542 Ga0501080_0048292
543 Ga0501080_0060010
544 Ga0501044_0006683
545 Ga0501044_0068171
546 Ga0501044_0249426
547 nmdc:mga03683_525307_c1
548 nmdc:mga03n38_438911_c1
549 nmdc:mga03n38_95438_c1
550 nmdc:mga00v17_38926_c1
551 nmdc:mga00v17_73467_c1
552 nmdc:mga0yw44_17897_c1
553 nmdc:mga0yw44_21943_c1
554 nmdc:mga0yw44_23342_c1
555 nmdc:mga0yw44_39249_c1
556 nmdc:mga0yw44_53737_c1
557 nmdc:mga0yw44_564821_c1
558 nmdc:mga0yw44_61501_c1
559 nmdc:mga0yw44_62370_c1
560 nmdc:mga06z11_5807_c1
561 nmdc:mga06z11_83170_c1
562 nmdc:mga09592_23951_c1
563 nmdc:mga09592_72818_c1
564 nmdc:mga06r32_1276272_c1
565 nmdc:mga06r32_169046_c1
566 nmdc:mga06r32_185002_c1
567 nmdc:mga08y16_57701_c1
568 nmdc:mga0n895_801268_c1
569 nmdc:mga0rr50_1395238_c1
570 nmdc:mga08x19_927270_c1
571 nmdc:mga0a205_183346_c1
572 Ga0500644_0000100
573 Ga0500651_0611001
574 Ga0500641_0054010
575 Ga0500594_0047105
576 Ga0500588_0000582
577 Ga0587128_108758
578 Ga0466962_0026812
579 2559425076
580 2643892788
581 2643962237
582 2676485879
583 2785372091
584 2816423528
585 2819745940
586 2873315621
587 2891567820
588 8054614251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02261

Asp_decarbox

Aspartate decarboxylase

1

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz8-assembly1.cif.gz_D crystal structure of mtb aspartate decarboxylase in active form 0.985 27 116
6p1y-assembly1.cif.gz_B crystal structure of mtb aspartate decarboxylase mutant m117i 0.984 27 124
1pt1-assembly1.cif.gz_A unprocessed pyruvoyl dependent aspartate decarboxylase with histidine 11 mutated to alanine 0.9835 1 115
1pyq-assembly1.cif.gz_A unprocessed aspartate decarboxylase mutant, with alanine inserted at position 24 0.9834 1 115
2c45-assembly1.cif.gz_C native precursor of pyruvoyl dependent aspartate decarboxylase 0.9825 1 112
ID Description Score Start End Superfamily
2c45C00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9825 1 112 2.40.40.20
2eeoB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9798 27 120 2.40.40.20
4aonE00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9766 25 115 2.40.40.20
4aonE00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9662 25 115 2.40.40.20
3plxB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9657 27 117 2.40.40.20
ID Description Score Start End GO Terms
AF-E6W3Q9-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] 0.9976 1 115 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A1Y0BY55-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] 0.9968 1 124 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A3N5S5B0-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] 0.9968 1 115 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-X8ALW7-F1-model_v4 deleted 0.9965 1 100
AF-A0A1G1KF57-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] 0.9953 1 117 GO:0004068
GO:0005829
GO:0006523
GO:0015940

Map