F391222

General Info

Members Datasets Scaffolds Average Seq Length
292 205 584 97

Family's Representative Sequence

Representative Sequence 3300053161|Ga0500634_0000590|Ga0500634_0000590_7736_8071
Length 111
Sequence VILFNKFFLHQRKLTMAKAYWIAAYRAITDPAALAEYGKLAGPAIQAGGGRFLARGLPSAIYEAAVNERTVLIEFDSAEQAIATHDSSAYQAALEALGNGAERDIRIIEGI

Samples

Sample ID Description Type Environment
1 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 4.79
Rhizosphere 86.99
Stem 0
Stem Tuber 0
Unclassified 29.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500634_0000590 3300053161 Bacteria 12066
2 rootH2_10319847 3300003320 Unclassified 2263
3 Ga0065715_10150888 3300005293 Unclassified 1730
4 Ga0065707_10513799 3300005295 Unclassified 744
5 Ga0070658_10318328 3300005327 Bacteria 1328
6 Ga0070689_100580791 3300005340 Bacteria 969
7 Ga0070661_100052790 3300005344 Bacteria 2975
8 Ga0070661_100300404 3300005344 Bacteria 1250
9 Ga0070692_10336394 3300005345 Unclassified 933
10 Ga0070669_100519409 3300005353 Unclassified 990
11 Ga0070675_100898836 3300005354 Bacteria 812
12 Ga0070671_100315042 3300005355 Bacteria 1333
13 Ga0070709_10145018 3300005434 Unclassified 1635
14 Ga0070709_10741950 3300005434 Unclassified 767
15 Ga0070709_11017698 3300005434 Unclassified 660
16 Ga0070709_11686362 3300005434 Unclassified 517
17 Ga0070714_100257775 3300005435 Bacteria 1614
18 Ga0070713_100036784 3300005436 Bacteria 3954
19 Ga0070713_100104523 3300005436 Unclassified 2459
20 Ga0070713_100302705 3300005436 Bacteria 1472
21 Ga0070713_100772832 3300005436 Unclassified 920
22 Ga0070713_101583465 3300005436 Bacteria 636
23 Ga0070713_101607770 3300005436 Bacteria 631
24 Ga0070710_10012217 3300005437 Bacteria 4258
25 Ga0070711_100023842 3300005439 Bacteria 3985
26 Ga0070711_100065933 3300005439 Bacteria 2535
27 Ga0070694_101013507 3300005444 Bacteria 690
28 Ga0070708_100446888 3300005445 Bacteria 1219
29 Ga0070708_100561849 3300005445 Bacteria 1076
30 Ga0070678_100658352 3300005456 Bacteria 940
31 Ga0070662_101365579 3300005457 Unclassified 610
32 Ga0070706_100064323 3300005467 Bacteria 3390
33 Ga0070706_100631709 3300005467 Bacteria 994
34 Ga0070706_100751617 3300005467 Bacteria 903
35 Ga0070707_100181288 3300005468 Bacteria 2053
36 Ga0070707_100668172 3300005468 Bacteria 1002
37 Ga0070698_101685672 3300005471 Unclassified 586
38 Ga0070665_100009016 3300005548 Bacteria 10103
39 Ga0068855_100755909 3300005563 Bacteria 1036
40 Ga0068855_101236888 3300005563 Bacteria 775
41 Ga0068855_102253046 3300005563 Unclassified 546
42 Ga0070664_100839563 3300005564 Bacteria 860
43 Ga0070664_101773083 3300005564 Bacteria 585
44 Ga0068857_101370409 3300005577 Bacteria 687
45 Ga0068854_100552616 3300005578 Bacteria 977
46 Ga0068854_101877997 3300005578 Unclassified 550
47 Ga0068859_100332763 3300005617 Bacteria 1613
48 Ga0068864_100213455 3300005618 Bacteria 1778
49 Ga0068861_101597377 3300005719 Bacteria 642
50 Ga0068858_100008062 3300005842 Bacteria 10144
51 Ga0068858_100062858 3300005842 Bacteria 3434
52 Ga0068858_101841191 3300005842 Unclassified 598
53 Ga0068860_100540753 3300005843 Unclassified 1166
54 Ga0068860_100881648 3300005843 Unclassified 910
55 Ga0068862_100175649 3300005844 Unclassified 1920
56 Ga0068862_100326703 3300005844 Bacteria 1417
57 Ga0068862_100659895 3300005844 Bacteria 1010
58 Ga0070717_10318301 3300006028 Bacteria 1386
59 Ga0070716_100000354 3300006173 Bacteria 18784
60 Ga0070712_100336623 3300006175 Unclassified 1231
61 Ga0075366_10269332 3300006195 Bacteria 1040
62 Ga0097621_100335376 3300006237 Unclassified 1342
63 Ga0097621_100878019 3300006237 Unclassified 834
64 Ga0068871_101089308 3300006358 Bacteria 747
65 Ga0075428_101904431 3300006844 Bacteria 618
66 Ga0075430_100496749 3300006846 Bacteria 1007
67 Ga0075431_100999007 3300006847 Unclassified 804
68 Ga0075433_11643586 3300006852 Bacteria 554
69 Ga0075434_101060091 3300006871 Bacteria 824
70 Ga0075429_100186799 3300006880 Bacteria 1816
71 Ga0075429_101208889 3300006880 Bacteria 660
72 Ga0075436_100210560 3300006914 Unclassified 1378
73 Ga0097620_100332754 3300006931 Bacteria 1613
74 Ga0099794_10420319 3300007265 Unclassified 699
75 Ga0111539_10022033 3300009094 Bacteria 7830
76 Ga0105245_10474930 3300009098 Bacteria 1263
77 Ga0105245_11527910 3300009098 Bacteria 719
78 Ga0105247_10020253 3300009101 Bacteria 4000
79 Ga0114129_10043604 3300009147 Bacteria 6311
80 Ga0114129_10085331 3300009147 Bacteria 4380
81 Ga0114129_11544949 3300009147 Unclassified 814
82 Ga0105248_10332188 3300009177 Unclassified 1712
83 Ga0105248_11558733 3300009177 Unclassified 748
84 Ga0105249_10520881 3300009553 Bacteria 1236
85 Ga0105239_10929945 3300010375 Bacteria 998
86 Ga0105239_11021310 3300010375 Bacteria 951
87 Ga0105239_11297296 3300010375 Bacteria 840
88 Ga0157374_12224229 3300013296 Unclassified 575
89 Ga0157375_10949708 3300013308 Bacteria 1002
90 Ga0163163_10706396 3300014325 Bacteria 1072
91 Ga0157380_11897941 3300014326 Bacteria 656
92 Ga0157377_10156580 3300014745 Unclassified 1413
93 Ga0157379_10072458 3300014968 Unclassified 3082
94 Ga0157376_11097052 3300014969 Unclassified 821
95 Ga0157376_12300915 3300014969 Unclassified 578
96 Ga0213876_10033238 3300021384 Bacteria 2719
97 Ga0207692_10010824 3300025898 Bacteria 3859
98 Ga0207710_10021603 3300025900 Unclassified 2760
99 Ga0207688_10314944 3300025901 Bacteria 959
100 Ga0207685_10471802 3300025905 Bacteria 656
101 Ga0207685_10483279 3300025905 Unclassified 649
102 Ga0207699_10100295 3300025906 Unclassified 1836
103 Ga0207699_10954911 3300025906 Bacteria 633
104 Ga0207699_10968669 3300025906 Unclassified 628
105 Ga0207684_10027079 3300025910 Unclassified 4889
106 Ga0207684_10117486 3300025910 Bacteria 2279
107 Ga0207684_10263290 3300025910 Bacteria 1488
108 Ga0207684_10790095 3300025910 Unclassified 803
109 Ga0207663_10082209 3300025916 Unclassified 2112
110 Ga0207649_10191405 3300025920 Bacteria 1439
111 Ga0207649_11533495 3300025920 Unclassified 527
112 Ga0207652_10616625 3300025921 Bacteria 972
113 Ga0207652_10688084 3300025921 Unclassified 913
114 Ga0207646_10398357 3300025922 Unclassified 1243
115 Ga0207646_10625337 3300025922 Bacteria 966
116 Ga0207650_10108744 3300025925 Bacteria 2143
117 Ga0207659_11230031 3300025926 Unclassified 643
118 Ga0207700_10016635 3300025928 Unclassified 4892
119 Ga0207700_10086617 3300025928 Unclassified 2462
120 Ga0207700_10315310 3300025928 Unclassified 1354
121 Ga0207700_11533504 3300025928 Unclassified 591
122 Ga0207664_10283544 3300025929 Bacteria 1454
123 Ga0207664_10289728 3300025929 Bacteria 1439
124 Ga0207644_10131274 3300025931 Bacteria 1918
125 Ga0207669_11361527 3300025937 Unclassified 604
126 Ga0207669_11809952 3300025937 Unclassified 522
127 Ga0207691_11349079 3300025940 Unclassified 588
128 Ga0207689_10900462 3300025942 Bacteria 746
129 Ga0207679_10167441 3300025945 Bacteria 1806
130 Ga0207667_12132317 3300025949 Bacteria 519
131 Ga0207651_10916136 3300025960 Bacteria 781
132 Ga0207712_10187450 3300025961 Bacteria 1630
133 Ga0207677_10108693 3300026023 Bacteria 2060
134 Ga0207703_10000876 3300026035 Bacteria 29544
135 Ga0207703_10129467 3300026035 Bacteria 2177
136 Ga0207703_11514327 3300026035 Unclassified 645
137 Ga0207678_10100214 3300026067 Bacteria 2474
138 Ga0207708_11474091 3300026075 Bacteria 598
139 Ga0207641_12329895 3300026088 Unclassified 535
140 Ga0207676_10201479 3300026095 Bacteria 1759
141 Ga0207675_102091783 3300026118 Bacteria 583
142 Ga0207683_10543210 3300026121 Bacteria 1074
143 Ga0207698_11227546 3300026142 Unclassified 764
144 Ga0209970_1035448 3300027614 Bacteria 877
145 Ga0207428_10255216 3300027907 Bacteria 1307
146 Ga0268266_10014331 3300028379 Bacteria 6817
147 Ga0268265_10082769 3300028380 Bacteria 2539
148 Ga0268265_10624269 3300028380 Bacteria 1033
149 Ga0268265_10722414 3300028380 Bacteria 964
150 Ga0268264_10649430 3300028381 Unclassified 1044
151 Ga0268264_10697438 3300028381 Unclassified 1008
152 Ga0265325_10167188 3300031241 Bacteria 1031
153 Ga0265339_10162083 3300031249 Unclassified 1125
154 Ga0265316_10759901 3300031344 Unclassified 681
155 Ga0307513_10833194 3300031456 Unclassified 629
156 Ga0307509_10513420 3300031507 Bacteria 881
157 Ga0307408_100064849 3300031548 Bacteria 2677
158 Ga0307408_100627914 3300031548 Bacteria 958
159 Ga0307408_101062472 3300031548 Bacteria 749
160 Ga0307408_101166304 3300031548 Bacteria 717
161 Ga0307405_11323844 3300031731 Bacteria 627
162 Ga0307413_10360057 3300031824 Bacteria 1126
163 Ga0307406_10227797 3300031901 Unclassified 1390
164 Ga0307406_10300556 3300031901 Bacteria 1233
165 Ga0307416_100167932 3300032002 Bacteria 2038
166 Ga0307416_100198687 3300032002 Bacteria 1900
167 Ga0307416_102974084 3300032002 Bacteria 567
168 Ga0307414_10715355 3300032004 Bacteria 908
169 Ga0307411_10658516 3300032005 Bacteria 907
170 Ga0307411_11650951 3300032005 Bacteria 592
171 Ga0307415_100030401 3300032126 Bacteria 3467
172 Ga0307415_101251323 3300032126 Bacteria 701
173 Ga0373929_0197908 3300035085 Bacteria 562
174 Ga0373940_0002570 3300035088 Bacteria 3553
175 Ga0373932_0053132 3300035112 Unclassified 1208
176 Ga0373960_0034445 3300035121 Bacteria 1433
177 Ga0373946_0394774 3300035171 Bacteria 698
178 Ga0373962_0067589 3300035242 Unclassified 1061
179 Ga0373931_0017387 3300035691 Bacteria 3556
180 Ga0373937_0653392 3300036401 Unclassified 997
181 Ga0395905_0535580 3300037471 Bacteria 1072
182 Ga0395905_0809330 3300037471 Unclassified 840
183 Ga0242420_024244 3300038996 Unclassified 1098
184 Ga0436365_0118406 3300039437 Bacteria 957
185 Ga0436365_0210732 3300039437 Bacteria 19424
186 Ga0436365_0685146 3300039437 Bacteria 2836
187 Ga0436365_1787915 3300039437 Bacteria 4835
188 Ga0436361_0946747 3300039447 Bacteria 2561
189 Ga0436363_1217864 3300039450 Bacteria 1935
190 Ga0436363_1429283 3300039450 Bacteria 769
191 Ga0436362_0880408 3300039453 Bacteria 1709
192 Ga0439436_0221936 3300041404 Unclassified 544
193 Ga0439447_000529 3300041407 Bacteria 14138
194 Ga0451800_1235718 3300041459 Unclassified 624
195 Ga0451800_1378886 3300041459 Unclassified 817
196 Ga0439442_006359 3300042002 Bacteria 2372
197 Ga0439452_033627 3300042010 Bacteria 1244
198 Ga0439463_189078 3300042016 Unclassified 534
199 Ga0450914_002124 3300042118 Bacteria 1370
200 Ga0439446_0346626 3300042156 Bacteria 529
201 Ga0439464_0056002 3300042439 Bacteria 1148
202 Ga0451577_0310696 3300042876 Bacteria 1429
203 Ga0466964_0091654 3300044706 Bacteria 1324
204 Ga0466959_0861232 3300045049 Bacteria 605
205 Ga0451576_0129700 3300045051 Bacteria 2628
206 Ga0495638_0418029 3300046460 Bacteria 692
207 Ga0495587_0603848 3300046536 Unclassified 604
208 Ga0495633_0471786 3300046558 Bacteria 566
209 Ga0495656_0003116 3300046615 Bacteria 5576
210 Ga0495656_0154251 3300046615 Bacteria 1111
211 Ga0495656_0537561 3300046615 Unclassified 622
212 Ga0495668_0000681 3300046616 Bacteria 40916
213 Ga0495668_0675786 3300046616 Bacteria 571
214 Ga0495659_0019701 3300046664 Bacteria 2259
215 Ga0495669_0069972 3300046684 Bacteria 1598
216 Ga0495636_0001698 3300047318 Bacteria 8386
217 Ga0495636_0062715 3300047318 Bacteria 1574
218 Ga0495636_0160010 3300047318 Bacteria 1014
219 Ga0495677_0042993 3300047445 Bacteria 1656
220 Ga0496100_0174138 3300048903 Bacteria 1552
221 Ga0496100_1332886 3300048903 Unclassified 566
222 Ga0496101_0194569 3300048904 Bacteria 1566
223 Ga0496104_1225360 3300048907 Unclassified 654
224 Ga0496104_1765523 3300048907 Bacteria 521
225 Ga0496104_1861187 3300048907 Bacteria 504
226 Ga0496106_0267391 3300048909 Bacteria 1369
227 Ga0496108_0360796 3300048911 Bacteria 1268
228 Ga0496112_1178160 3300048915 Bacteria 683
229 Ga0496114_0268097 3300048917 Bacteria 1504
230 Ga0496114_0558099 3300048917 Bacteria 1011
231 Ga0496115_0589396 3300048918 Bacteria 885
232 Ga0496117_0533218 3300048920 Unclassified 562
233 Ga0496118_0315461 3300048921 Unclassified 851
234 Ga0496122_0000074 3300048925 Bacteria 219900
235 Ga0496123_0000062 3300048926 Bacteria 219882
236 Ga0496124_0106942 3300048927 Bacteria 2258
237 Ga0496125_0000533 3300048928 Bacteria 65519
238 Ga0496126_0097133 3300048929 Bacteria 2582
239 Ga0501298_089522 3300049521 Unclassified 688
240 Ga0501031_0064193 3300049568 Bacteria 2391
241 Ga0501032_0009478 3300049569 Bacteria 7059
242 Ga0501033_0048328 3300049570 Bacteria 3160
243 Ga0501033_0144043 3300049570 Bacteria 1722
244 Ga0501034_0080574 3300049571 Bacteria 3258
245 Ga0501036_0026716 3300049572 Bacteria 4876
246 Ga0501036_1180537 3300049572 Bacteria 624
247 Ga0501038_0074303 3300049574 Bacteria 2876
248 Ga0501042_0019298 3300049578 Bacteria 4732
249 Ga0501043_0127234 3300049579 Bacteria 1997
250 Ga0501043_1307205 3300049579 Unclassified 506
251 Ga0501046_0009724 3300049580 Bacteria 8292
252 Ga0501047_0212143 3300049581 Bacteria 1794
253 Ga0501047_0525053 3300049581 Bacteria 1009
254 Ga0501047_1111691 3300049581 Unclassified 604
255 Ga0501048_0050354 3300049582 Bacteria 2966
256 Ga0501067_0007190 3300049583 Bacteria 6186
257 Ga0501067_0141193 3300049583 Unclassified 1341
258 Ga0501068_0008858 3300049584 Bacteria 5613
259 Ga0501069_0010724 3300049585 Bacteria 4859
260 Ga0501069_0279354 3300049585 Unclassified 977
261 Ga0501071_0044357 3300049587 Bacteria 3189
262 Ga0501073_0039442 3300049589 Bacteria 3345
263 Ga0501249_086097 3300049679 Bacteria 742
264 Ga0501079_0022115 3300049741 Bacteria 4872
265 Ga0501080_0024010 3300049742 Bacteria 5652
266 Ga0501080_0847511 3300049742 Bacteria 799
267 Ga0501083_0075270 3300049744 Bacteria 2242
268 Ga0501272_038247 3300049769 Unclassified 633
269 Ga0501283_026285 3300049779 Unclassified 957
270 Ga0501035_0039770 3300049822 Bacteria 4255
271 Ga0501044_0011064 3300049823 Bacteria 9787
272 Ga0501044_0134107 3300049823 Bacteria 2468
273 Ga0501044_0456459 3300049823 Bacteria 1184
274 Ga0501044_0705067 3300049823 Bacteria 894
275 Ga0501045_0048388 3300049824 Bacteria 3100
276 nmdc:mga05p37_182262_c1 3300050507 Bacteria 2554
277 nmdc:mga09592_1306431_c1 3300050508 Bacteria 596
278 nmdc:mga09592_179093_c1 3300050508 Bacteria 1833
279 nmdc:mga0qj67_686484_c1 3300050509 Bacteria 815
280 nmdc:mga06r32_1703066_c1 3300050510 Bacteria 567
281 nmdc:mga08y16_43093_c1 3300050511 Bacteria 4728
282 nmdc:mga08y16_785660_c1 3300050511 Bacteria 946
283 nmdc:mga08x19_1012663_c1 3300050514 Bacteria 590
284 Ga0500583_0043869 3300053092 Unclassified 2045
285 Ga0500568_0237307 3300053139 Unclassified 665
286 Ga0500616_0000011 3300053153 Bacteria 732880
287 Ga0500622_0058346 3300053156 Unclassified 1972
288 Ga0500645_000069 3300053730 Bacteria 80827
289 Ga0501084_0017720 3300054114 Bacteria 5926
290 Ga0587084_022132 3300059477 Unclassified 959
291 Ga0587115_035300 3300059626 Bacteria 760
292 Ga0501082_0048488 3300060353 Bacteria 3660
293 Ga0500634_0000590
294 rootH2_10319847
295 Ga0065715_10150888
296 Ga0065707_10513799
297 Ga0070658_10318328
298 Ga0070689_100580791
299 Ga0070661_100052790
300 Ga0070661_100300404
301 Ga0070692_10336394
302 Ga0070669_100519409
303 Ga0070675_100898836
304 Ga0070671_100315042
305 Ga0070709_10145018
306 Ga0070709_10741950
307 Ga0070709_11017698
308 Ga0070709_11686362
309 Ga0070714_100257775
310 Ga0070713_100036784
311 Ga0070713_100104523
312 Ga0070713_100302705
313 Ga0070713_100772832
314 Ga0070713_101583465
315 Ga0070713_101607770
316 Ga0070710_10012217
317 Ga0070711_100023842
318 Ga0070711_100065933
319 Ga0070694_101013507
320 Ga0070708_100446888
321 Ga0070708_100561849
322 Ga0070678_100658352
323 Ga0070662_101365579
324 Ga0070706_100064323
325 Ga0070706_100631709
326 Ga0070706_100751617
327 Ga0070707_100181288
328 Ga0070707_100668172
329 Ga0070698_101685672
330 Ga0070665_100009016
331 Ga0068855_100755909
332 Ga0068855_101236888
333 Ga0068855_102253046
334 Ga0070664_100839563
335 Ga0070664_101773083
336 Ga0068857_101370409
337 Ga0068854_100552616
338 Ga0068854_101877997
339 Ga0068859_100332763
340 Ga0068864_100213455
341 Ga0068861_101597377
342 Ga0068858_100008062
343 Ga0068858_100062858
344 Ga0068858_101841191
345 Ga0068860_100540753
346 Ga0068860_100881648
347 Ga0068862_100175649
348 Ga0068862_100326703
349 Ga0068862_100659895
350 Ga0070717_10318301
351 Ga0070716_100000354
352 Ga0070712_100336623
353 Ga0075366_10269332
354 Ga0097621_100335376
355 Ga0097621_100878019
356 Ga0068871_101089308
357 Ga0075428_101904431
358 Ga0075430_100496749
359 Ga0075431_100999007
360 Ga0075433_11643586
361 Ga0075434_101060091
362 Ga0075429_100186799
363 Ga0075429_101208889
364 Ga0075436_100210560
365 Ga0097620_100332754
366 Ga0099794_10420319
367 Ga0111539_10022033
368 Ga0105245_10474930
369 Ga0105245_11527910
370 Ga0105247_10020253
371 Ga0114129_10043604
372 Ga0114129_10085331
373 Ga0114129_11544949
374 Ga0105248_10332188
375 Ga0105248_11558733
376 Ga0105249_10520881
377 Ga0105239_10929945
378 Ga0105239_11021310
379 Ga0105239_11297296
380 Ga0157374_12224229
381 Ga0157375_10949708
382 Ga0163163_10706396
383 Ga0157380_11897941
384 Ga0157377_10156580
385 Ga0157379_10072458
386 Ga0157376_11097052
387 Ga0157376_12300915
388 Ga0213876_10033238
389 Ga0207692_10010824
390 Ga0207710_10021603
391 Ga0207688_10314944
392 Ga0207685_10471802
393 Ga0207685_10483279
394 Ga0207699_10100295
395 Ga0207699_10954911
396 Ga0207699_10968669
397 Ga0207684_10027079
398 Ga0207684_10117486
399 Ga0207684_10263290
400 Ga0207684_10790095
401 Ga0207663_10082209
402 Ga0207649_10191405
403 Ga0207649_11533495
404 Ga0207652_10616625
405 Ga0207652_10688084
406 Ga0207646_10398357
407 Ga0207646_10625337
408 Ga0207650_10108744
409 Ga0207659_11230031
410 Ga0207700_10016635
411 Ga0207700_10086617
412 Ga0207700_10315310
413 Ga0207700_11533504
414 Ga0207664_10283544
415 Ga0207664_10289728
416 Ga0207644_10131274
417 Ga0207669_11361527
418 Ga0207669_11809952
419 Ga0207691_11349079
420 Ga0207689_10900462
421 Ga0207679_10167441
422 Ga0207667_12132317
423 Ga0207651_10916136
424 Ga0207712_10187450
425 Ga0207677_10108693
426 Ga0207703_10000876
427 Ga0207703_10129467
428 Ga0207703_11514327
429 Ga0207678_10100214
430 Ga0207708_11474091
431 Ga0207641_12329895
432 Ga0207676_10201479
433 Ga0207675_102091783
434 Ga0207683_10543210
435 Ga0207698_11227546
436 Ga0209970_1035448
437 Ga0207428_10255216
438 Ga0268266_10014331
439 Ga0268265_10082769
440 Ga0268265_10624269
441 Ga0268265_10722414
442 Ga0268264_10649430
443 Ga0268264_10697438
444 Ga0265325_10167188
445 Ga0265339_10162083
446 Ga0265316_10759901
447 Ga0307513_10833194
448 Ga0307509_10513420
449 Ga0307408_100064849
450 Ga0307408_100627914
451 Ga0307408_101062472
452 Ga0307408_101166304
453 Ga0307405_11323844
454 Ga0307413_10360057
455 Ga0307406_10227797
456 Ga0307406_10300556
457 Ga0307416_100167932
458 Ga0307416_100198687
459 Ga0307416_102974084
460 Ga0307414_10715355
461 Ga0307411_10658516
462 Ga0307411_11650951
463 Ga0307415_100030401
464 Ga0307415_101251323
465 Ga0373929_0197908
466 Ga0373940_0002570
467 Ga0373932_0053132
468 Ga0373960_0034445
469 Ga0373946_0394774
470 Ga0373962_0067589
471 Ga0373931_0017387
472 Ga0373937_0653392
473 Ga0395905_0535580
474 Ga0395905_0809330
475 Ga0242420_024244
476 Ga0436365_0118406
477 Ga0436365_0210732
478 Ga0436365_0685146
479 Ga0436365_1787915
480 Ga0436361_0946747
481 Ga0436363_1217864
482 Ga0436363_1429283
483 Ga0436362_0880408
484 Ga0439436_0221936
485 Ga0439447_000529
486 Ga0451800_1235718
487 Ga0451800_1378886
488 Ga0439442_006359
489 Ga0439452_033627
490 Ga0439463_189078
491 Ga0450914_002124
492 Ga0439446_0346626
493 Ga0439464_0056002
494 Ga0451577_0310696
495 Ga0466964_0091654
496 Ga0466959_0861232
497 Ga0451576_0129700
498 Ga0495638_0418029
499 Ga0495587_0603848
500 Ga0495633_0471786
501 Ga0495656_0003116
502 Ga0495656_0154251
503 Ga0495656_0537561
504 Ga0495668_0000681
505 Ga0495668_0675786
506 Ga0495659_0019701
507 Ga0495669_0069972
508 Ga0495636_0001698
509 Ga0495636_0062715
510 Ga0495636_0160010
511 Ga0495677_0042993
512 Ga0496100_0174138
513 Ga0496100_1332886
514 Ga0496101_0194569
515 Ga0496104_1225360
516 Ga0496104_1765523
517 Ga0496104_1861187
518 Ga0496106_0267391
519 Ga0496108_0360796
520 Ga0496112_1178160
521 Ga0496114_0268097
522 Ga0496114_0558099
523 Ga0496115_0589396
524 Ga0496117_0533218
525 Ga0496118_0315461
526 Ga0496122_0000074
527 Ga0496123_0000062
528 Ga0496124_0106942
529 Ga0496125_0000533
530 Ga0496126_0097133
531 Ga0501298_089522
532 Ga0501031_0064193
533 Ga0501032_0009478
534 Ga0501033_0048328
535 Ga0501033_0144043
536 Ga0501034_0080574
537 Ga0501036_0026716
538 Ga0501036_1180537
539 Ga0501038_0074303
540 Ga0501042_0019298
541 Ga0501043_0127234
542 Ga0501043_1307205
543 Ga0501046_0009724
544 Ga0501047_0212143
545 Ga0501047_0525053
546 Ga0501047_1111691
547 Ga0501048_0050354
548 Ga0501067_0007190
549 Ga0501067_0141193
550 Ga0501068_0008858
551 Ga0501069_0010724
552 Ga0501069_0279354
553 Ga0501071_0044357
554 Ga0501073_0039442
555 Ga0501249_086097
556 Ga0501079_0022115
557 Ga0501080_0024010
558 Ga0501080_0847511
559 Ga0501083_0075270
560 Ga0501272_038247
561 Ga0501283_026285
562 Ga0501035_0039770
563 Ga0501044_0011064
564 Ga0501044_0134107
565 Ga0501044_0456459
566 Ga0501044_0705067
567 Ga0501045_0048388
568 nmdc:mga05p37_182262_c1
569 nmdc:mga09592_1306431_c1
570 nmdc:mga09592_179093_c1
571 nmdc:mga0qj67_686484_c1
572 nmdc:mga06r32_1703066_c1
573 nmdc:mga08y16_43093_c1
574 nmdc:mga08y16_785660_c1
575 nmdc:mga08x19_1012663_c1
576 Ga0500583_0043869
577 Ga0500568_0237307
578 Ga0500616_0000011
579 Ga0500622_0058346
580 Ga0500645_000069
581 Ga0501084_0017720
582 Ga0587084_022132
583 Ga0587115_035300
584 Ga0501082_0048488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

18

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9364 1 96
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9049 3 93
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8606 3 93
1si9-assembly1.cif.gz_A boiling stable protein isolated from populus tremula 0.7415 1 94
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.7312 2 96
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8962 2 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8864 2 93 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8783 2 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8519 2 93 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7409 1 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y9J7Z7-F1-model_v4 Uncharacterized protein (DUF1330 family) 1.003 3 96
AF-A0A6J4NLL1-F1-model_v4 DUF1330 domain-containing protein 1.002 3 96
AF-A0A0A1DNJ0-F1-model_v4 DUF1330 domain-containing protein 1.002 15 96
AF-A0A6M4FJN2-F1-model_v4 DUF1330 domain-containing protein 0.9969 1 96
AF-A0A537FW42-F1-model_v4 DUF1330 domain-containing protein 0.9949 1 96

Map