F389886

General Info

Members Datasets Scaffolds Average Seq Length
290 193 278 156

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0200591|Ga0395901_0200591_244_708
Length 154
Sequence MASHATAPTWRTPFEFMARAASTLLPTSLLLLVQRLGIAAVFFMSGRTKIAEGSWLTISDSAFELFRTDYALPFIAPVSATYAATVSEHLFPLLLVLGLFTRFAATALLIMTLVIEIFVYPDAWPTHLSWAGLLLPLIALGGGKVSLDRLLKIA

Samples

Sample ID Description Type Environment
1 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
2 2738543013 Variovorax sp. BT01 Isolate Unclassified
3 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
4 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
5 2842677519 Variovorax sp. R-72495 Isolate Unclassified
6 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
7 2904456579 Variovorax sp. 2002 Isolate Unclassified
8 2929520902 Variovorax beijingensis 502 Isolate Unclassified
9 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
10 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
11 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
12 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
111 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.24
Nodule 1.38
Rhizoplane 4.14
Rhizosphere 65.52
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003810 3300001904 Bacteria 2602
2 JGI24739J22299_10063116 3300001989 Bacteria 1167
3 JGI24737J22298_10021138 3300001990 Bacteria 2076
4 JGI24735J21928_10000561 3300002067 Bacteria 13060
5 JGI24735J21928_10004691 3300002067 Bacteria 4567
6 Ga0055533_1004323 3300003756 Bacteria 2582
7 Ga0055537_1000010 3300003773 Bacteria 138059
8 Ga0055524_1000061 3300003775 Bacteria 135241
9 Ga0055534_1000015 3300003784 Bacteria 148531
10 Ga0055534_1003463 3300003784 Bacteria 4950
11 Ga0055528_1000311 3300003790 Bacteria 41165
12 Ga0055530_10000645 3300003791 Bacteria 30022
13 Ga0055540_1000340 3300003792 Bacteria 40048
14 Ga0055531_10009005 3300003794 Bacteria 5162
15 Ga0065165_1021836 3300005262 Bacteria 2212
16 Ga0065704_10000555 3300005289 Bacteria 20066
17 Ga0065704_10168707 3300005289 Bacteria 1305
18 Ga0065707_10009476 3300005295 Bacteria 3153
19 Ga0070658_10039469 3300005327 Bacteria 3809
20 Ga0068869_100165723 3300005334 Bacteria 1723
21 Ga0070660_100014686 3300005339 Bacteria 5650
22 Ga0070661_100167772 3300005344 Bacteria 1666
23 Ga0070669_100220047 3300005353 Bacteria 1501
24 Ga0070669_100723674 3300005353 Bacteria 842
25 Ga0070671_100013780 3300005355 Bacteria 6523
26 Ga0070671_100121824 3300005355 Bacteria 2195
27 Ga0070671_101178989 3300005355 Bacteria 674
28 Ga0070659_100223159 3300005366 Bacteria 1556
29 Ga0070708_100887533 3300005445 Bacteria 837
30 Ga0068855_100027158 3300005563 Bacteria 6849
31 Ga0070664_100442781 3300005564 Bacteria 1192
32 Ga0070664_101191048 3300005564 Bacteria 718
33 Ga0068857_100271824 3300005577 Bacteria 1557
34 Ga0068857_100540290 3300005577 Bacteria 1097
35 Ga0068856_100014202 3300005614 Bacteria 7698
36 Ga0068856_100533953 3300005614 Bacteria 1194
37 Ga0068859_100000153 3300005617 Bacteria 65765
38 Ga0068864_100666310 3300005618 Bacteria 1014
39 Ga0068861_100000022 3300005719 Bacteria 72916
40 Ga0068870_10603361 3300005840 Bacteria 746
41 Ga0068863_100136124 3300005841 Bacteria 2347
42 Ga0068862_100158826 3300005844 Bacteria 2017
43 Ga0075365_10001676 3300006038 Bacteria 10235
44 Ga0075363_100072392 3300006048 Bacteria 1874
45 Ga0075364_10402787 3300006051 Bacteria 934
46 Ga0075432_10009416 3300006058 Bacteria 3326
47 Ga0075362_10003723 3300006177 Bacteria 5390
48 Ga0075362_10063670 3300006177 Bacteria 1673
49 Ga0075362_10134880 3300006177 Bacteria 1176
50 Ga0075369_10129563 3300006186 Bacteria 1145
51 Ga0075366_10032770 3300006195 Bacteria 3059
52 Ga0075370_10001131 3300006353 Bacteria 11189
53 Ga0097620_100000153 3300006931 Bacteria 65765
54 Ga0079104_1000093 3300006946 Bacteria 130633
55 Ga0099826_10001107 3300006948 Bacteria 15391
56 Ga0105244_10000071 3300009036 Bacteria 117110
57 Ga0105240_10000115 3300009093 Bacteria 165594
58 Ga0105247_10003813 3300009101 Bacteria 9758
59 Ga0105243_10021284 3300009148 Bacteria 4923
60 Ga0105248_10002210 3300009177 Bacteria 21556
61 Ga0105237_10005418 3300009545 Bacteria 14405
62 Ga0105237_11101394 3300009545 Bacteria 801
63 Ga0105238_10039332 3300009551 Bacteria 4796
64 Ga0105239_10000028 3300010375 Bacteria 243470
65 Ga0105239_10002717 3300010375 Bacteria 22262
66 Ga0105239_12189671 3300010375 Bacteria 643
67 Ga0157373_10002345 3300013100 Bacteria 14371
68 Ga0157370_10004573 3300013104 Bacteria 15841
69 Ga0157370_10013842 3300013104 Bacteria 8285
70 Ga0157369_10004644 3300013105 Bacteria 16137
71 Ga0157374_10002490 3300013296 Bacteria 15563
72 Ga0157372_10002285 3300013307 Bacteria 20771
73 Ga0182008_10001658 3300014497 Bacteria 14678
74 Ga0182008_10016702 3300014497 Bacteria 3809
75 Ga0182008_10053081 3300014497 Bacteria 2008
76 Ga0182008_10281894 3300014497 Bacteria 865
77 Ga0182006_1000058 3300015261 Bacteria 167164
78 Ga0182006_1002264 3300015261 Bacteria 10623
79 Ga0182006_1061407 3300015261 Bacteria 1417
80 Ga0182007_10017591 3300015262 Bacteria 2607
81 Ga0183368_1002 3300015687 Bacteria 1865598
82 Ga0209674_100043 3300025226 Bacteria 369728
83 Ga0209672_100469 3300025228 Bacteria 22731
84 Ga0209565_1000025 3300025263 Bacteria 377969
85 Ga0209565_1021748 3300025263 Bacteria 1336
86 Ga0209673_1000149 3300025273 Bacteria 148659
87 Ga0209673_1004323 3300025273 Bacteria 7666
88 Ga0209130_1002334 3300025284 Bacteria 9659
89 Ga0209675_1000017 3300025291 Bacteria 378002
90 Ga0209675_1001316 3300025291 Bacteria 14727
91 Ga0209676_1003779 3300025292 Bacteria 8969
92 Ga0209050_1000228 3300025298 Bacteria 123537
93 Ga0209050_1004501 3300025298 Bacteria 9377
94 Ga0209050_1029946 3300025298 Bacteria 1727
95 Ga0209050_1031544 3300025298 Bacteria 1649
96 Ga0209256_1000030 3300025299 Bacteria 414828
97 Ga0209051_1000004 3300025303 Bacteria 1155596
98 Ga0209051_1000271 3300025303 Bacteria 86541
99 Ga0209051_1046578 3300025303 Bacteria 1490
100 Ga0209257_1000423 3300025304 Bacteria 81354
101 Ga0209257_1022131 3300025304 Bacteria 2278
102 Ga0207696_1000016 3300025711 Bacteria 502467
103 Ga0207655_1000027 3300025728 Bacteria 444552
104 Ga0207713_1088390 3300025735 Bacteria 1095
105 Ga0207647_10000340 3300025904 Bacteria 38070
106 Ga0207647_10013434 3300025904 Bacteria 5675
107 Ga0207643_10549445 3300025908 Bacteria 741
108 Ga0207705_10032055 3300025909 Bacteria 3754
109 Ga0207695_10000116 3300025913 Bacteria 239510
110 Ga0207695_10013807 3300025913 Bacteria 9610
111 Ga0207671_10006016 3300025914 Bacteria 10965
112 Ga0207657_10002294 3300025919 Bacteria 20726
113 Ga0207657_10335977 3300025919 Bacteria 1193
114 Ga0207649_10674350 3300025920 Bacteria 800
115 Ga0207681_11321186 3300025923 Bacteria 605
116 Ga0207650_10401096 3300025925 Bacteria 1135
117 Ga0207644_10035680 3300025931 Bacteria 3486
118 Ga0207644_10112523 3300025931 Bacteria 2060
119 Ga0207644_10448393 3300025931 Bacteria 1060
120 Ga0207709_10007027 3300025935 Bacteria 6293
121 Ga0207709_10525816 3300025935 Bacteria 927
122 Ga0207711_10014495 3300025941 Bacteria 6551
123 Ga0207679_10008006 3300025945 Bacteria 6719
124 Ga0207679_10853524 3300025945 Bacteria 832
125 Ga0207667_10007107 3300025949 Bacteria 13512
126 Ga0207702_10048229 3300026078 Bacteria 3591
127 Ga0207648_10411064 3300026089 Bacteria 1227
128 Ga0207674_10076943 3300026116 Bacteria 3344
129 Ga0207674_10247967 3300026116 Bacteria 1727
130 Ga0207675_100000014 3300026118 Bacteria 133509
131 Ga0209281_1000084 3300027111 Bacteria 254215
132 Ga0209282_1002378 3300027666 Bacteria 10835
133 Ga0207428_10030560 3300027907 Bacteria 4453
134 Ga0316177_1098317 3300030731 Bacteria 4643
135 Ga0316177_1145219 3300030731 Bacteria 923
136 Ga0316176_1031123 3300030732 Bacteria 1177
137 Ga0316180_1046478 3300030736 Bacteria 3281
138 Ga0316183_1088482 3300030742 Bacteria 1759
139 Ga0316183_1120525 3300030742 Bacteria 4867
140 Ga0316183_1159401 3300030742 Bacteria 7526
141 Ga0316182_1144530 3300030745 Bacteria 4846
142 Ga0307513_10150998 3300031456 Bacteria 2232
143 Ga0307408_100007598 3300031548 Bacteria 7168
144 Ga0307408_100028217 3300031548 Bacteria 3876
145 Ga0307408_100032980 3300031548 Bacteria 3614
146 Ga0307408_100116721 3300031548 Bacteria 2060
147 Ga0307408_100372287 3300031548 Bacteria 1218
148 Ga0307514_10143898 3300031649 Bacteria 1614
149 Ga0307405_10001038 3300031731 Bacteria 11254
150 Ga0307405_10035719 3300031731 Bacteria 2971
151 Ga0307405_10039739 3300031731 Bacteria 2845
152 Ga0307405_10044322 3300031731 Bacteria 2720
153 Ga0307413_10016924 3300031824 Bacteria 3784
154 Ga0307413_10374189 3300031824 Bacteria 1107
155 Ga0307410_10063236 3300031852 Bacteria 2538
156 Ga0307410_10097997 3300031852 Bacteria 2096
157 Ga0307410_10180234 3300031852 Bacteria 1599
158 Ga0307406_10000418 3300031901 Bacteria 24737
159 Ga0307406_10037677 3300031901 Bacteria 2988
160 Ga0307406_10227082 3300031901 Bacteria 1391
161 Ga0307406_10998069 3300031901 Bacteria 718
162 Ga0307412_10000829 3300031911 Bacteria 17794
163 Ga0307412_10013954 3300031911 Bacteria 4725
164 Ga0307412_10109746 3300031911 Bacteria 1967
165 Ga0307412_10146377 3300031911 Bacteria 1737
166 Ga0307412_10485713 3300031911 Bacteria 1025
167 Ga0307409_100345778 3300031995 Bacteria 1401
168 Ga0307416_100160479 3300032002 Bacteria 2077
169 Ga0307416_100211349 3300032002 Bacteria 1851
170 Ga0307416_100969871 3300032002 Bacteria 952
171 Ga0307414_10251491 3300032004 Bacteria 1469
172 Ga0307414_10440556 3300032004 Bacteria 1140
173 Ga0307414_11538227 3300032004 Bacteria 619
174 Ga0307414_11689019 3300032004 Bacteria 590
175 Ga0307411_10156742 3300032005 Bacteria 1699
176 Ga0307411_10587827 3300032005 Bacteria 955
177 Ga0307411_10605602 3300032005 Bacteria 942
178 Ga0395899_0083802 3300037312 Bacteria 2318
179 Ga0395899_0441544 3300037312 Bacteria 854
180 Ga0395900_0008516 3300037418 Bacteria 10545
181 Ga0395900_0120319 3300037418 Bacteria 2694
182 Ga0395900_0146959 3300037418 Bacteria 2410
183 Ga0395900_1025883 3300037418 Bacteria 744
184 Ga0395898_0008783 3300037466 Bacteria 10648
185 Ga0395898_0495063 3300037466 Bacteria 1163
186 Ga0395905_0004708 3300037471 Bacteria 14097
187 Ga0395905_0039457 3300037471 Bacteria 4429
188 Ga0395905_0090358 3300037471 Bacteria 2871
189 Ga0395901_0082121 3300038443 Bacteria 3367
190 Ga0395901_0200591 3300038443 Bacteria 2091
191 Ga0395901_0327064 3300038443 Bacteria 1585
192 Ga0395901_0907311 3300038443 Bacteria 863
193 Ga0439436_0006540 3300041404 Bacteria 3579
194 Ga0439466_0005006 3300041411 Bacteria 5083
195 Ga0439466_0031415 3300041411 Bacteria 1816
196 Ga0439465_0003874 3300041413 Bacteria 4882
197 Ga0439448_0000098 3300042005 Bacteria 15629
198 Ga0439451_008051 3300042009 Bacteria 2139
199 Ga0439452_051465 3300042010 Bacteria 942
200 Ga0450894_032077 3300042131 Bacteria 735
201 Ga0450906_005938 3300042145 Bacteria 2485
202 Ga0450908_003467 3300042184 Bacteria 3066
203 Ga0439434_0002154 3300042435 Bacteria 5705
204 Ga0450918_002797 3300042531 Bacteria 3275
205 Ga0450893_0064551 3300042532 Bacteria 704
206 Ga0466969_0022033 3300044656 Bacteria 3292
207 Ga0466982_0002463 3300044672 Bacteria 7549
208 Ga0466966_0033929 3300044684 Bacteria 3302
209 Ga0466961_0004143 3300044693 Bacteria 9056
210 Ga0466963_0253537 3300044694 Bacteria 1235
211 Ga0453684_1489422 3300044712 Bacteria 699
212 Ga0466970_0023518 3300044765 Bacteria 3219
213 Ga0466957_0054511 3300044842 Bacteria 2441
214 Ga0466960_0137266 3300044901 Bacteria 1296
215 Ga0466959_0013492 3300045049 Bacteria 5921
216 Ga0451576_0406382 3300045051 Bacteria 1428
217 Ga0466967_0353543 3300045976 Bacteria 1423
218 Ga0495596_0009036 3300046500 Bacteria 4405
219 Ga0495606_0064036 3300046507 Bacteria 2342
220 Ga0495668_0004445 3300046616 Bacteria 9949
221 Ga0495668_0678015 3300046616 Bacteria 570
222 Ga0495625_0000638 3300046660 Bacteria 50402
223 Ga0495660_0000108 3300046810 Bacteria 88833
224 Ga0495673_0000038 3300047469 Bacteria 303785
225 Ga0496101_0005905 3300048904 Bacteria 7840
226 Ga0496104_0019702 3300048907 Bacteria 6177
227 Ga0496104_0490982 3300048907 Bacteria 1139
228 Ga0496105_0004583 3300048908 Bacteria 10415
229 Ga0496108_0410769 3300048911 Bacteria 1182
230 Ga0496108_0985178 3300048911 Bacteria 721
231 Ga0496110_0126927 3300048913 Bacteria 2302
232 Ga0496111_0174087 3300048914 Bacteria 1600
233 Ga0496114_0000674 3300048917 Bacteria 25314
234 Ga0496114_0277018 3300048917 Bacteria 1478
235 Ga0496115_0000044 3300048918 Bacteria 115745
236 Ga0496115_0017372 3300048918 Bacteria 5499
237 Ga0496116_0001035 3300048919 Bacteria 33974
238 Ga0496116_0050612 3300048919 Bacteria 2767
239 Ga0496117_0002250 3300048920 Bacteria 24909
240 Ga0496117_0002420 3300048920 Bacteria 23673
241 Ga0496117_0021862 3300048920 Bacteria 5156
242 Ga0496118_0000933 3300048921 Bacteria 45706
243 Ga0496118_0001577 3300048921 Bacteria 33807
244 Ga0496118_0002056 3300048921 Bacteria 28373
245 Ga0496119_0000030 3300048922 Bacteria 240167
246 Ga0496120_0000033 3300048923 Bacteria 218355
247 Ga0496121_0016468 3300048924 Bacteria 7632
248 Ga0496121_0047507 3300048924 Bacteria 3662
249 Ga0496121_0170368 3300048924 Bacteria 1582
250 Ga0496122_0001374 3300048925 Bacteria 39556
251 Ga0496123_0001146 3300048926 Bacteria 39552
252 Ga0496124_0002707 3300048927 Bacteria 22633
253 Ga0496124_0048266 3300048927 Bacteria 3639
254 Ga0496124_0124453 3300048927 Bacteria 2056
255 Ga0496125_0006415 3300048928 Bacteria 12716
256 Ga0496125_0025008 3300048928 Bacteria 5478
257 Ga0496125_0152541 3300048928 Bacteria 1584
258 Ga0496126_0002071 3300048929 Bacteria 28137
259 Ga0496126_0010843 3300048929 Bacteria 9502
260 Ga0501034_0390753 3300049571 Bacteria 1315
261 Ga0501067_0063553 3300049583 Bacteria 2044
262 Ga0501227_001004 3300049665 Bacteria 6248
263 Ga0501249_120477 3300049679 Bacteria 640
264 Ga0501241_062981 3300049758 Bacteria 747
265 Ga0501262_015210 3300049759 Bacteria 1008
266 Ga0501269_014283 3300049766 Bacteria 973
267 Ga0501226_000487 3300049853 Bacteria 5564
268 nmdc:mga03683_5039_c1 3300050489 Bacteria 4428
269 nmdc:mga03683_8626_c1 3300050489 Bacteria 3590
270 nmdc:mga03n38_16801_c1 3300050490 Bacteria 2855
271 nmdc:mga03n38_605_c1 3300050490 Bacteria 9149
272 nmdc:mga03n38_96279_c1 3300050490 Bacteria 1419
273 nmdc:mga00v17_477260_c1 3300050491 Bacteria 809
274 nmdc:mga0yw44_43472_c1 3300050492 Bacteria 2683
275 nmdc:mga0yw44_691651_c1 3300050492 Bacteria 693
276 nmdc:mga0k408_3559_c1 3300050493 Bacteria 8235
277 nmdc:mga07m45_2490_c1 3300050496 Bacteria 8637
278 nmdc:mga07m45_302555_c1 3300050496 Bacteria 930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049679 Ga0501249_120477 Ga0501249_120477_225_611 128
2 3300005564 Ga0070664_101191048 Ga0070664_1011910482 134
3 3300025920 Ga0207649_10674350 Ga0207649_106743502 134
4 3300026116 Ga0207674_10247967 Ga0207674_102479672 136
5 3300037418 Ga0395900_1025883 Ga0395900_1025883_134_544 136
6 3300037471 Ga0395905_0090358 Ga0395905_0090358_1263_1673 136
7 3300044694 Ga0466963_0253537 Ga0466963_0253537_257_670 137
8 3300005564 Ga0070664_100442781 Ga0070664_1004427812 138
9 3300005614 Ga0068856_100014202 Ga0068856_1000142026 138
10 3300005841 Ga0068863_100136124 Ga0068863_1001361243 138
11 3300009545 Ga0105237_11101394 Ga0105237_111013942 138
12 3300025945 Ga0207679_10853524 Ga0207679_108535241 138
13 3300026078 Ga0207702_10048229 Ga0207702_100482294 138
14 3300041411 Ga0439466_0005006 Ga0439466_0005006_4325_4747 140
15 3300042009 Ga0439451_008051 Ga0439451_008051_529_951 140
16 3300042010 Ga0439452_051465 Ga0439452_051465_443_865 140
17 3300048919 Ga0496116_0001035 Ga0496116_0001035_9989_10444 140
18 3300048925 Ga0496122_0001374 Ga0496122_0001374_11200_11655 140
19 3300048926 Ga0496123_0001146 Ga0496123_0001146_11200_11655 140
20 3300048927 Ga0496124_0002707 Ga0496124_0002707_2216_2671 140
21 3300048928 Ga0496125_0006415 Ga0496125_0006415_5999_6454 140
22 3300049665 Ga0501227_001004 Ga0501227_001004_158_580 140
23 3300049758 Ga0501241_062981 Ga0501241_062981_42_464 140
24 3300049766 Ga0501269_014283 Ga0501269_014283_213_635 140
25 3300049853 Ga0501226_000487 Ga0501226_000487_4965_5387 140
26 3300044672 Ga0466982_0002463 Ga0466982_0002463_2267_2704 143
27 3300044842 Ga0466957_0054511 Ga0466957_0054511_39_476 143
28 3300003775 Ga0055524_1000061 Ga0055524_100006123 144
29 3300003791 Ga0055530_10000645 Ga0055530_1000064510 144
30 3300003792 Ga0055540_1000340 Ga0055540_100034014 144
31 3300003794 Ga0055531_10009005 Ga0055531_100090052 144
32 3300006946 Ga0079104_1000093 Ga0079104_1000093107 144
33 3300025263 Ga0209565_1021748 Ga0209565_10217481 144
34 3300025298 Ga0209050_1000228 Ga0209050_100022892 144
35 3300025298 Ga0209050_1004501 Ga0209050_10045017 144
36 3300025299 Ga0209256_1000030 Ga0209256_100003023 144
37 3300025303 Ga0209051_1000004 Ga0209051_1000004466 144
38 3300025304 Ga0209257_1000423 Ga0209257_100042323 144
39 3300027111 Ga0209281_1000084 Ga0209281_1000084215 144
40 3300048917 Ga0496114_0277018 Ga0496114_0277018_143_583 144
41 3300049571 Ga0501034_0390753 Ga0501034_0390753_253_741 144
42 3300044712 Ga0453684_1489422 Ga0453684_1489422_122_568 146
43 3300045051 Ga0451576_0406382 Ga0451576_0406382_300_746 146
44 3300031824 Ga0307413_10016924 Ga0307413_100169242 148
45 3300031852 Ga0307410_10063236 Ga0307410_100632362 148
46 3300048929 Ga0496126_0010843 Ga0496126_0010843_7686_8132 148
47 3300005353 Ga0070669_100220047 Ga0070669_1002200472 150
48 3300005355 Ga0070671_100013780 Ga0070671_1000137805 150
49 3300005355 Ga0070671_100121824 Ga0070671_1001218242 150
50 3300005355 Ga0070671_101178989 Ga0070671_1011789891 150
51 3300005577 Ga0068857_100271824 Ga0068857_1002718243 150
52 3300005614 Ga0068856_100533953 Ga0068856_1005339532 150
53 3300005840 Ga0068870_10603361 Ga0068870_106033612 150
54 3300005844 Ga0068862_100158826 Ga0068862_1001588263 150
55 3300025908 Ga0207643_10549445 Ga0207643_105494452 150
56 3300025919 Ga0207657_10335977 Ga0207657_103359772 150
57 3300025925 Ga0207650_10401096 Ga0207650_104010962 150
58 3300025931 Ga0207644_10035680 Ga0207644_100356802 150
59 3300025931 Ga0207644_10112523 Ga0207644_101125233 150
60 3300025931 Ga0207644_10448393 Ga0207644_104483932 150
61 3300025945 Ga0207679_10008006 Ga0207679_100080065 150
62 3300026116 Ga0207674_10076943 Ga0207674_100769435 150
63 3300031824 Ga0307413_10374189 Ga0307413_103741892 150
64 3300031852 Ga0307410_10180234 Ga0307410_101802343 150
65 3300031901 Ga0307406_10998069 Ga0307406_109980692 150
66 3300031911 Ga0307412_10485713 Ga0307412_104857132 150
67 3300032002 Ga0307416_100211349 Ga0307416_1002113491 150
68 3300032002 Ga0307416_100969871 Ga0307416_1009698711 150
69 3300032004 Ga0307414_10440556 Ga0307414_104405562 150
70 3300032005 Ga0307411_10587827 Ga0307411_105878271 150
71 3300037312 Ga0395899_0083802 Ga0395899_0083802_472_933 150
72 3300037418 Ga0395900_0008516 Ga0395900_0008516_1607_2068 150
73 3300037418 Ga0395900_0120319 Ga0395900_0120319_1467_1928 150
74 3300037466 Ga0395898_0495063 Ga0395898_0495063_681_1142 150
75 3300037471 Ga0395905_0004708 Ga0395905_0004708_2265_2726 150
76 3300037471 Ga0395905_0039457 Ga0395905_0039457_968_1429 150
77 3300038443 Ga0395901_0082121 Ga0395901_0082121_582_1043 150
78 3300038443 Ga0395901_0200591 Ga0395901_0200591_244_708 150
79 3300038443 Ga0395901_0327064 Ga0395901_0327064_982_1443 150
80 3300044901 Ga0466960_0137266 Ga0466960_0137266_326_784 150
81 3300045976 Ga0466967_0353543 Ga0466967_0353543_302_760 150
82 3300046616 Ga0495668_0678015 Ga0495668_0678015_35_493 150
83 3300048911 Ga0496108_0410769 Ga0496108_0410769_712_1170 150
84 3300048911 Ga0496108_0985178 Ga0496108_0985178_156_614 150
85 3300049583 Ga0501067_0063553 Ga0501067_0063553_1292_1750 150
86 3300001989 JGI24739J22299_10063116 JGI24739J22299_100631161 151
87 3300001990 JGI24737J22298_10021138 JGI24737J22298_100211384 151
88 3300002067 JGI24735J21928_10004691 JGI24735J21928_100046915 151
89 3300010375 Ga0105239_12189671 Ga0105239_121896712 151
90 3300025904 Ga0207647_10013434 Ga0207647_100134347 151
91 3300048907 Ga0496104_0490982 Ga0496104_0490982_239_706 151
92 3300048918 Ga0496115_0000044 Ga0496115_0000044_59620_60087 151
93 iso_pu_bacteria 2806310737 2807409031 151
94 iso_pu_bacteria 2806310745 2807457367 151
95 iso_pu_bacteria 3007803356 3007805876 151
96 3300003756 Ga0055533_1004323 Ga0055533_10043234 152
97 3300005617 Ga0068859_100000153 Ga0068859_10000015344 152
98 3300005618 Ga0068864_100666310 Ga0068864_1006663102 152
99 3300005719 Ga0068861_100000022 Ga0068861_10000002216 152
100 3300006931 Ga0097620_100000153 Ga0097620_10000015316 152
101 3300009177 Ga0105248_10002210 Ga0105248_1000221017 152
102 3300015687 Ga0183368_1002 Ga0183368_100262 152
103 3300025226 Ga0209674_100043 Ga0209674_10004348 152
104 3300025941 Ga0207711_10014495 Ga0207711_100144954 152
105 3300026089 Ga0207648_10411064 Ga0207648_104110642 152
106 3300026118 Ga0207675_100000014 Ga0207675_10000001457 152
107 3300046500 Ga0495596_0009036 Ga0495596_0009036_2628_3098 152
108 3300006048 Ga0075363_100072392 Ga0075363_1000723922 153
109 3300050490 nmdc:mga03n38_96279_c1 nmdc:mga03n38_96279_c1_621_1088 153
110 iso_pu_bacteria 3007511990 3007512110 153
111 3300009093 Ga0105240_10000115 Ga0105240_1000011557 154
112 3300010375 Ga0105239_10000028 Ga0105239_10000028146 154
113 3300025913 Ga0207695_10000116 Ga0207695_10000116175 154
114 3300048904 Ga0496101_0005905 Ga0496101_0005905_4256_4738 154
115 3300048907 Ga0496104_0019702 Ga0496104_0019702_2769_3251 154
116 3300048908 Ga0496105_0004583 Ga0496105_0004583_7003_7485 154
117 3300048918 Ga0496115_0017372 Ga0496115_0017372_2821_3303 154
118 3300048919 Ga0496116_0050612 Ga0496116_0050612_290_772 154
119 3300048920 Ga0496117_0002250 Ga0496117_0002250_10485_10967 154
120 3300048920 Ga0496117_0021862 Ga0496117_0021862_1803_2285 154
121 3300048921 Ga0496118_0001577 Ga0496118_0001577_609_1091 154
122 3300048921 Ga0496118_0002056 Ga0496118_0002056_8734_9216 154
123 3300048922 Ga0496119_0000030 Ga0496119_0000030_82835_83317 154
124 3300048923 Ga0496120_0000033 Ga0496120_0000033_156859_157341 154
125 3300048924 Ga0496121_0016468 Ga0496121_0016468_6563_7045 154
126 3300048924 Ga0496121_0170368 Ga0496121_0170368_588_1070 154
127 3300048929 Ga0496126_0002071 Ga0496126_0002071_8717_9199 154
128 3300005289 Ga0065704_10000555 Ga0065704_100005553 155
129 3300005295 Ga0065707_10009476 Ga0065707_100094763 155
130 3300005344 Ga0070661_100167772 Ga0070661_1001677722 155
131 3300005353 Ga0070669_100723674 Ga0070669_1007236741 155
132 3300005445 Ga0070708_100887533 Ga0070708_1008875331 155
133 3300009036 Ga0105244_10000071 Ga0105244_1000007158 155
134 3300009101 Ga0105247_10003813 Ga0105247_100038137 155
135 3300009148 Ga0105243_10021284 Ga0105243_100212846 155
136 3300013104 Ga0157370_10013842 Ga0157370_100138422 155
137 3300014497 Ga0182008_10016702 Ga0182008_100167022 155
138 3300014497 Ga0182008_10281894 Ga0182008_102818942 155
139 3300015261 Ga0182006_1000058 Ga0182006_1000058105 155
140 3300015262 Ga0182007_10017591 Ga0182007_100175914 155
141 3300025711 Ga0207696_1000016 Ga0207696_1000016117 155
142 3300025728 Ga0207655_1000027 Ga0207655_1000027305 155
143 3300025735 Ga0207713_1088390 Ga0207713_10883902 155
144 3300025923 Ga0207681_11321186 Ga0207681_113211861 155
145 3300025935 Ga0207709_10007027 Ga0207709_100070272 155
146 3300030742 Ga0316183_1159401 Ga0316183_11594012 155
147 3300031548 Ga0307408_100028217 Ga0307408_1000282176 155
148 3300031548 Ga0307408_100032980 Ga0307408_1000329802 155
149 3300031731 Ga0307405_10001038 Ga0307405_100010382 155
150 3300031731 Ga0307405_10039739 Ga0307405_100397392 155
151 3300031901 Ga0307406_10037677 Ga0307406_100376775 155
152 3300031901 Ga0307406_10227082 Ga0307406_102270822 155
153 3300031911 Ga0307412_10000829 Ga0307412_100008292 155
154 3300031911 Ga0307412_10013954 Ga0307412_100139544 155
155 3300031995 Ga0307409_100345778 Ga0307409_1003457782 155
156 3300032004 Ga0307414_11689019 Ga0307414_116890191 155
157 3300032005 Ga0307411_10156742 Ga0307411_101567421 155
158 3300032005 Ga0307411_10605602 Ga0307411_106056022 155
159 3300044656 Ga0466969_0022033 Ga0466969_0022033_895_1368 155
160 3300044684 Ga0466966_0033929 Ga0466966_0033929_2122_2595 155
161 3300044693 Ga0466961_0004143 Ga0466961_0004143_5269_5742 155
162 3300044765 Ga0466970_0023518 Ga0466970_0023518_1453_1926 155
163 3300045049 Ga0466959_0013492 Ga0466959_0013492_3123_3596 155
164 3300046507 Ga0495606_0064036 Ga0495606_0064036_608_1105 155
165 3300046616 Ga0495668_0004445 Ga0495668_0004445_770_1267 155
166 3300046810 Ga0495660_0000108 Ga0495660_0000108_44943_45440 155
167 3300047469 Ga0495673_0000038 Ga0495673_0000038_252705_253202 155
168 3300048913 Ga0496110_0126927 Ga0496110_0126927_122_595 155
169 3300048914 Ga0496111_0174087 Ga0496111_0174087_34_507 155
170 3300048917 Ga0496114_0000674 Ga0496114_0000674_18586_19053 155
171 3300048920 Ga0496117_0002420 Ga0496117_0002420_13188_13661 155
172 3300048921 Ga0496118_0000933 Ga0496118_0000933_9900_10373 155
173 3300048924 Ga0496121_0047507 Ga0496121_0047507_1024_1491 155
174 3300048927 Ga0496124_0048266 Ga0496124_0048266_1079_1552 155
175 3300048927 Ga0496124_0124453 Ga0496124_0124453_10_477 155
176 3300048928 Ga0496125_0025008 Ga0496125_0025008_4903_5376 155
177 3300048928 Ga0496125_0152541 Ga0496125_0152541_136_603 155
178 3300049759 Ga0501262_015210 Ga0501262_015210_428_901 155
179 iso_pu_bacteria 2738543013 2739250450 155
180 iso_pu_bacteria 2643221628 2644159186 156
181 iso_pu_bacteria 2842677519 2842681714 156
182 iso_pu_bacteria 2904449895 2904453415 156
183 iso_pu_bacteria 2904456579 2904459384 156
184 iso_pu_bacteria 2929520902 2929523132 156
185 iso_pu_bacteria 2945972063 2945972179 156
186 iso_pu_bacteria 2954767861 2954772162 157
187 3300001904 JGI24736J21556_1003810 JGI24736J21556_10038103 159
188 3300002067 JGI24735J21928_10000561 JGI24735J21928_100005614 159
189 3300003773 Ga0055537_1000010 Ga0055537_100001066 159
190 3300003784 Ga0055534_1000015 Ga0055534_100001564 159
191 3300003784 Ga0055534_1003463 Ga0055534_10034632 159
192 3300003790 Ga0055528_1000311 Ga0055528_100031126 159
193 3300005262 Ga0065165_1021836 Ga0065165_10218362 159
194 3300005289 Ga0065704_10168707 Ga0065704_101687072 159
195 3300005327 Ga0070658_10039469 Ga0070658_100394695 159
196 3300005334 Ga0068869_100165723 Ga0068869_1001657233 159
197 3300005339 Ga0070660_100014686 Ga0070660_1000146863 159
198 3300005366 Ga0070659_100223159 Ga0070659_1002231593 159
199 3300005563 Ga0068855_100027158 Ga0068855_1000271588 159
200 3300005577 Ga0068857_100540290 Ga0068857_1005402902 159
201 3300006038 Ga0075365_10001676 Ga0075365_100016769 159
202 3300006051 Ga0075364_10402787 Ga0075364_104027871 159
203 3300006058 Ga0075432_10009416 Ga0075432_100094162 159
204 3300006177 Ga0075362_10003723 Ga0075362_100037236 159
205 3300006177 Ga0075362_10063670 Ga0075362_100636702 159
206 3300006177 Ga0075362_10134880 Ga0075362_101348802 159
207 3300006186 Ga0075369_10129563 Ga0075369_101295632 159
208 3300006195 Ga0075366_10032770 Ga0075366_100327702 159
209 3300006353 Ga0075370_10001131 Ga0075370_100011315 159
210 3300006948 Ga0099826_10001107 Ga0099826_100011073 159
211 3300009545 Ga0105237_10005418 Ga0105237_1000541816 159
212 3300009551 Ga0105238_10039332 Ga0105238_100393323 159
213 3300010375 Ga0105239_10002717 Ga0105239_1000271713 159
214 3300013100 Ga0157373_10002345 Ga0157373_1000234511 159
215 3300013104 Ga0157370_10004573 Ga0157370_1000457313 159
216 3300013105 Ga0157369_10004644 Ga0157369_1000464412 159
217 3300013296 Ga0157374_10002490 Ga0157374_1000249020 159
218 3300013307 Ga0157372_10002285 Ga0157372_1000228513 159
219 3300014497 Ga0182008_10001658 Ga0182008_1000165813 159
220 3300014497 Ga0182008_10053081 Ga0182008_100530812 159
221 3300015261 Ga0182006_1002264 Ga0182006_10022648 159
222 3300015261 Ga0182006_1061407 Ga0182006_10614072 159
223 3300025228 Ga0209672_100469 Ga0209672_10046924 159
224 3300025263 Ga0209565_1000025 Ga0209565_1000025130 159
225 3300025273 Ga0209673_1000149 Ga0209673_100014917 159
226 3300025273 Ga0209673_1004323 Ga0209673_10043237 159
227 3300025284 Ga0209130_1002334 Ga0209130_100233412 159
228 3300025291 Ga0209675_1000017 Ga0209675_1000017244 159
229 3300025291 Ga0209675_1001316 Ga0209675_10013164 159
230 3300025292 Ga0209676_1003779 Ga0209676_100377911 159
231 3300025298 Ga0209050_1029946 Ga0209050_10299462 159
232 3300025298 Ga0209050_1031544 Ga0209050_10315443 159
233 3300025303 Ga0209051_1000271 Ga0209051_100027148 159
234 3300025303 Ga0209051_1046578 Ga0209051_10465782 159
235 3300025304 Ga0209257_1022131 Ga0209257_10221313 159
236 3300025904 Ga0207647_10000340 Ga0207647_1000034013 159
237 3300025909 Ga0207705_10032055 Ga0207705_100320555 159
238 3300025913 Ga0207695_10013807 Ga0207695_1001380711 159
239 3300025914 Ga0207671_10006016 Ga0207671_1000601610 159
240 3300025919 Ga0207657_10002294 Ga0207657_100022947 159
241 3300025935 Ga0207709_10525816 Ga0207709_105258162 159
242 3300025949 Ga0207667_10007107 Ga0207667_100071075 159
243 3300027666 Ga0209282_1002378 Ga0209282_10023783 159
244 3300027907 Ga0207428_10030560 Ga0207428_100305605 159
245 3300030731 Ga0316177_1098317 Ga0316177_10983172 159
246 3300030731 Ga0316177_1145219 Ga0316177_11452192 159
247 3300030732 Ga0316176_1031123 Ga0316176_10311232 159
248 3300030736 Ga0316180_1046478 Ga0316180_10464782 159
249 3300030742 Ga0316183_1088482 Ga0316183_10884823 159
250 3300030742 Ga0316183_1120525 Ga0316183_11205252 159
251 3300030745 Ga0316182_1144530 Ga0316182_11445303 159
252 3300031456 Ga0307513_10150998 Ga0307513_101509983 159
253 3300031548 Ga0307408_100007598 Ga0307408_1000075985 159
254 3300031548 Ga0307408_100116721 Ga0307408_1001167211 159
255 3300031548 Ga0307408_100372287 Ga0307408_1003722872 159
256 3300031649 Ga0307514_10143898 Ga0307514_101438981 159
257 3300031731 Ga0307405_10035719 Ga0307405_100357194 159
258 3300031731 Ga0307405_10044322 Ga0307405_100443223 159
259 3300031852 Ga0307410_10097997 Ga0307410_100979972 159
260 3300031901 Ga0307406_10000418 Ga0307406_100004188 159
261 3300031911 Ga0307412_10109746 Ga0307412_101097462 159
262 3300031911 Ga0307412_10146377 Ga0307412_101463772 159
263 3300032002 Ga0307416_100160479 Ga0307416_1001604792 159
264 3300032004 Ga0307414_10251491 Ga0307414_102514913 159
265 3300032004 Ga0307414_11538227 Ga0307414_115382272 159
266 3300037312 Ga0395899_0441544 Ga0395899_0441544_116_607 159
267 3300037418 Ga0395900_0146959 Ga0395900_0146959_128_619 159
268 3300037466 Ga0395898_0008783 Ga0395898_0008783_4772_5263 159
269 3300038443 Ga0395901_0907311 Ga0395901_0907311_164_655 159
270 3300041404 Ga0439436_0006540 Ga0439436_0006540_2992_3477 159
271 3300041411 Ga0439466_0031415 Ga0439466_0031415_924_1409 159
272 3300041413 Ga0439465_0003874 Ga0439465_0003874_2851_3336 159
273 3300042005 Ga0439448_0000098 Ga0439448_0000098_6329_6820 159
274 3300042131 Ga0450894_032077 Ga0450894_032077_164_649 159
275 3300042145 Ga0450906_005938 Ga0450906_005938_1443_1928 159
276 3300042184 Ga0450908_003467 Ga0450908_003467_488_973 159
277 3300042435 Ga0439434_0002154 Ga0439434_0002154_757_1242 159
278 3300042531 Ga0450918_002797 Ga0450918_002797_2366_2851 159
279 3300042532 Ga0450893_0064551 Ga0450893_0064551_117_602 159
280 3300046660 Ga0495625_0000638 Ga0495625_0000638_29120_29605 159
281 3300050489 nmdc:mga03683_5039_c1 nmdc:mga03683_5039_c1_1688_2173 159
282 3300050489 nmdc:mga03683_8626_c1 nmdc:mga03683_8626_c1_2700_3185 159
283 3300050490 nmdc:mga03n38_16801_c1 nmdc:mga03n38_16801_c1_1082_1567 159
284 3300050490 nmdc:mga03n38_605_c1 nmdc:mga03n38_605_c1_5076_5561 159
285 3300050491 nmdc:mga00v17_477260_c1 nmdc:mga00v17_477260_c1_66_551 159
286 3300050492 nmdc:mga0yw44_43472_c1 nmdc:mga0yw44_43472_c1_845_1330 159
287 3300050492 nmdc:mga0yw44_691651_c1 nmdc:mga0yw44_691651_c1_183_668 159
288 3300050493 nmdc:mga0k408_3559_c1 nmdc:mga0k408_3559_c1_7136_7621 159
289 3300050496 nmdc:mga07m45_2490_c1 nmdc:mga07m45_2490_c1_6421_6906 159
290 3300050496 nmdc:mga07m45_302555_c1 nmdc:mga07m45_302555_c1_191_676 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

30

121

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jb2-assembly1.cif.gz_A crystal structure of chicken lgp2 with 5'ppp 10-mer dsrna and adp-alf4-mg2+ at 2.2 a resolution. 0.4946 41 158
8d74-assembly1.cif.gz_D cryo-em structure of human cntf signaling complex: model containing the interaction core region 0.4263 24 159
5jb2-assembly1.cif.gz_A crystal structure of chicken lgp2 with 5'ppp 10-mer dsrna and adp-alf4-mg2+ at 2.2 a resolution. 0.3962 41 158
5y6p-assembly1.cif.gz_b2 structure of the phycobilisome from the red alga griffithsia pacifica 0.3741 24 149
4i1s-assembly1.cif.gz_A melanoma differentiation associated protein-5 helicase domain complex with inhibitor non-structural protein v 0.3701 37 144
ID Description Score Start End Superfamily
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.674 17 146 1.20.120.550
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6252 39 146 1.20.120.550
af_P76180_6_144_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5854 36 147 1.20.1250.20
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5836 41 140 1.20.120.550
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5626 17 146 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A0P7VF06-F1-model_v4 DoxX family protein 0.8609 35 157 GO:0016020
AF-B9TIU8-F1-model_v4 DoxX family protein 0.8377 18 159 GO:0005886
AF-A0A2T5LJ49-F1-model_v4 Putative oxidoreductase 0.8374 16 159 GO:0005886
AF-A0A521SP87-F1-model_v4 deleted 0.8361 17 157
AF-W0A6L9-F1-model_v4 DoxX family protein 0.8358 16 157 GO:0005886

Feature Viewer

pLDDT pTM Quality
86.8 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map