F389823

General Info

Members Datasets Scaffolds Average Seq Length
290 162 580 136

Family's Representative Sequence

Representative Sequence 3300027360|Ga0209969_1012488|Ga0209969_10124882
Length 151
Sequence VRYMVIIKATKESEAGILPPEHLLAEMAAYHEELAKAGVLVDGSGLQATSKGWRVRYRGASRTVVDGPFAETKELIAGYTIIKVKTRAEAVEWTRKFPNPTLEGTDCEIEVRQMFELEDFGEDFHVGKAADAGFGQGNAKIGGNRLCQRTI

Samples

Sample ID Description Type Environment
1 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
92 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
95 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
102 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
162 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 0.69
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209969_1012488 3300027360 Bacteria 1226
2 Ga0065715_10888892 3300005293 Bacteria 578
3 Ga0070658_10192654 3300005327 Bacteria 1718
4 Ga0070677_10591617 3300005333 Bacteria 613
5 Ga0070660_100271227 3300005339 Bacteria 1387
6 Ga0070669_100376148 3300005353 Bacteria 1158
7 Ga0070675_100046321 3300005354 Bacteria 3560
8 Ga0070674_101448444 3300005356 Bacteria 616
9 Ga0070673_100245424 3300005364 Bacteria 1559
10 Ga0070673_100342421 3300005364 Bacteria 1325
11 Ga0070705_100975791 3300005440 Bacteria 686
12 Ga0070700_100902937 3300005441 Bacteria 719
13 Ga0070694_101231799 3300005444 Bacteria 628
14 Ga0070678_100189462 3300005456 Bacteria 1690
15 Ga0070698_101234611 3300005471 Bacteria 697
16 Ga0070699_100034989 3300005518 Bacteria 4341
17 Ga0070699_100684944 3300005518 Bacteria 936
18 Ga0070679_100787489 3300005530 Bacteria 894
19 Ga0070684_100392106 3300005535 Bacteria 1280
20 Ga0070696_100006493 3300005546 Bacteria 7813
21 Ga0070696_100085095 3300005546 Bacteria 2244
22 Ga0070704_100045279 3300005549 Bacteria 3060
23 Ga0070704_100134416 3300005549 Bacteria 1922
24 Ga0068855_100042571 3300005563 Bacteria 5380
25 Ga0068859_100077494 3300005617 Bacteria 3365
26 Ga0068859_100286439 3300005617 Bacteria 1740
27 Ga0068859_100296896 3300005617 Bacteria 1709
28 Ga0068861_100111618 3300005719 Bacteria 2191
29 Ga0068861_100831148 3300005719 Bacteria 869
30 Ga0068861_101062124 3300005719 Bacteria 776
31 Ga0068870_10206102 3300005840 Bacteria 1195
32 Ga0068858_101203570 3300005842 Bacteria 745
33 Ga0068862_100348266 3300005844 Bacteria 1374
34 Ga0068862_101075079 3300005844 Bacteria 799
35 Ga0075366_10589466 3300006195 Bacteria 689
36 Ga0097621_100087550 3300006237 Bacteria 2601
37 Ga0097621_100251343 3300006237 Bacteria 1548
38 Ga0097621_100666000 3300006237 Bacteria 956
39 Ga0068871_100244232 3300006358 Bacteria 1562
40 Ga0075428_100001314 3300006844 Bacteria 26330
41 Ga0075430_100004545 3300006846 Bacteria 11682
42 Ga0075430_100014560 3300006846 Bacteria 6700
43 Ga0075430_101224057 3300006846 Bacteria 618
44 Ga0075431_100150076 3300006847 Bacteria 2400
45 Ga0075431_100228656 3300006847 Bacteria 1896
46 Ga0075429_100305950 3300006880 Bacteria 1392
47 Ga0075429_100602602 3300006880 Bacteria 962
48 Ga0075429_100845911 3300006880 Bacteria 801
49 Ga0075436_100539302 3300006914 Bacteria 856
50 Ga0097620_100077493 3300006931 Bacteria 3365
51 Ga0097620_100286436 3300006931 Bacteria 1740
52 Ga0097620_100296895 3300006931 Bacteria 1709
53 Ga0075435_101937370 3300007076 Bacteria 517
54 Ga0111539_10016549 3300009094 Bacteria 9141
55 Ga0105245_10431630 3300009098 Bacteria 1322
56 Ga0114129_10093983 3300009147 Bacteria 4153
57 Ga0105243_10306249 3300009148 Bacteria 1442
58 Ga0105248_10276731 3300009177 Bacteria 1890
59 Ga0105248_11019782 3300009177 Bacteria 935
60 Ga0105237_10072227 3300009545 Bacteria 3444
61 Ga0105238_10004073 3300009551 Bacteria 14490
62 Ga0105249_10987393 3300009553 Bacteria 911
63 Ga0157374_10026832 3300013296 Bacteria 5187
64 Ga0163162_10411625 3300013306 Bacteria 1485
65 Ga0157372_10021228 3300013307 Bacteria 7015
66 Ga0163163_11722989 3300014325 Bacteria 687
67 Ga0157380_10007847 3300014326 Bacteria 7599
68 Ga0157380_10021083 3300014326 Bacteria 4883
69 Ga0157379_10541614 3300014968 Bacteria 1082
70 Ga0209675_1001489 3300025291 Bacteria 13442
71 Ga0207705_10180613 3300025909 Bacteria 1592
72 Ga0207657_10183077 3300025919 Bacteria 1692
73 Ga0207681_10276458 3300025923 Bacteria 1320
74 Ga0207659_10794293 3300025926 Bacteria 813
75 Ga0207667_10461271 3300025949 Bacteria 1290
76 Ga0207651_10174280 3300025960 Bacteria 1700
77 Ga0207712_10341044 3300025961 Bacteria 1243
78 Ga0207668_11658522 3300025972 Bacteria 577
79 Ga0207703_10965284 3300026035 Bacteria 817
80 Ga0207639_10050493 3300026041 Bacteria 3159
81 Ga0207708_10700095 3300026075 Bacteria 866
82 Ga0207676_10659202 3300026095 Bacteria 1011
83 Ga0207674_10578528 3300026116 Bacteria 1085
84 Ga0207675_100430524 3300026118 Bacteria 1304
85 Ga0207675_100601242 3300026118 Unclassified 1103
86 Ga0207698_12370461 3300026142 Bacteria 542
87 Ga0209969_1055660 3300027360 Bacteria 623
88 Ga0209967_1014513 3300027364 Bacteria 1123
89 Ga0209967_1014795 3300027364 Bacteria 1114
90 Ga0209981_1017755 3300027378 Bacteria 1006
91 Ga0209996_1015890 3300027395 Bacteria 1030
92 Ga0209996_1025648 3300027395 Bacteria 843
93 Ga0210000_1003060 3300027462 Bacteria 2397
94 Ga0210000_1018936 3300027462 Bacteria 1047
95 Ga0209995_1004733 3300027471 Bacteria 2185
96 Ga0209999_1011115 3300027543 Bacteria 1628
97 Ga0209970_1009631 3300027614 Bacteria 1579
98 Ga0210002_1023406 3300027617 Bacteria 1004
99 Ga0210002_1058168 3300027617 Bacteria 673
100 Ga0209971_1095175 3300027682 Bacteria 728
101 Ga0209971_1102214 3300027682 Bacteria 702
102 Ga0209966_1168331 3300027695 Bacteria 513
103 Ga0209974_10012164 3300027876 Bacteria 2880
104 Ga0209974_10056303 3300027876 Bacteria 1327
105 Ga0207428_10000990 3300027907 Bacteria 31474
106 Ga0268265_11628411 3300028380 Bacteria 651
107 Ga0268264_10594788 3300028381 Bacteria 1090
108 Ga0307515_10704010 3300028794 Bacteria 626
109 Ga0307513_10198508 3300031456 Bacteria 1850
110 Ga0307408_100046770 3300031548 Bacteria 3096
111 Ga0307405_11328960 3300031731 Bacteria 626
112 Ga0307410_10167736 3300031852 Bacteria 1651
113 Ga0307406_10067307 3300031901 Bacteria 2335
114 Ga0307416_100380408 3300032002 Bacteria 1442
115 Ga0307416_102694988 3300032002 Bacteria 594
116 Ga0307416_102974263 3300032002 Bacteria 567
117 Ga0307414_10984703 3300032004 Bacteria 776
118 Ga0307411_11983849 3300032005 Bacteria 543
119 Ga0373927_0070789 3300035695 Bacteria 2257
120 Ga0373925_0216252 3300037068 Bacteria 1528
121 Ga0439461_0007984 3300041410 Bacteria 1888
122 Ga0439431_0048004 3300041997 Bacteria 1102
123 Ga0439431_0212704 3300041997 Bacteria 566
124 Ga0439433_0198014 3300041999 Bacteria 530
125 Ga0439441_022154 3300042001 Bacteria 1178
126 Ga0439441_029842 3300042001 Bacteria 1051
127 Ga0439443_006801 3300042003 Bacteria 1574
128 Ga0439445_0167982 3300042004 Bacteria 642
129 Ga0439451_048207 3300042009 Bacteria 853
130 Ga0439462_0160317 3300042015 Bacteria 634
131 Ga0439446_0000580 3300042156 Bacteria 7459
132 Ga0439446_0028967 3300042156 Bacteria 1596
133 Ga0439434_0000114 3300042435 Bacteria 21161
134 Ga0439434_0032554 3300042435 Bacteria 1587
135 Ga0439435_0045905 3300042436 Bacteria 1236
136 Ga0439444_0009742 3300042437 Bacteria 1520
137 Ga0439444_0029491 3300042437 Bacteria 1022
138 Ga0439460_0003012 3300042461 Bacteria 4066
139 Ga0439460_0205697 3300042461 Bacteria 671
140 Ga0451577_0000313 3300042876 Bacteria 92642
141 Ga0451577_0666056 3300042876 Bacteria 943
142 Ga0453683_0374508 3300044673 Bacteria 916
143 Ga0453684_0000992 3300044712 Bacteria 92625
144 Ga0466968_0164228 3300044735 Bacteria 1026
145 Ga0495603_0430244 3300046455 Bacteria 756
146 Ga0495590_0115191 3300046457 Bacteria 961
147 Ga0495590_0303553 3300046457 Bacteria 601
148 Ga0495638_0010532 3300046460 Bacteria 6407
149 Ga0495621_0172887 3300046539 Bacteria 859
150 Ga0495668_0226560 3300046616 Bacteria 1024
151 Ga0495636_0670129 3300047318 Bacteria 510
152 Ga0495672_0256552 3300047320 Bacteria 846
153 Ga0495686_0095012 3300047472 Bacteria 1806
154 Ga0495686_0230547 3300047472 Bacteria 1049
155 Ga0495614_0399421 3300048089 Bacteria 646
156 Ga0496102_1537082 3300048905 Bacteria 584
157 Ga0496104_0180898 3300048907 Bacteria 2019
158 Ga0501298_014167 3300049521 Bacteria 1421
159 Ga0501031_0894765 3300049568 Bacteria 568
160 Ga0501033_0747362 3300049570 Bacteria 663
161 Ga0501033_0819073 3300049570 Bacteria 629
162 Ga0501036_0035152 3300049572 Bacteria 4240
163 Ga0501036_0035813 3300049572 Bacteria 4200
164 Ga0501036_0038979 3300049572 Bacteria 4024
165 Ga0501037_0451207 3300049573 Bacteria 877
166 Ga0501038_0003584 3300049574 Bacteria 14447
167 Ga0501038_0030865 3300049574 Bacteria 4738
168 Ga0501038_0153664 3300049574 Bacteria 1875
169 Ga0501039_0001352 3300049575 Bacteria 17953
170 Ga0501039_0013298 3300049575 Bacteria 6294
171 Ga0501039_0085563 3300049575 Bacteria 2456
172 Ga0501039_0378228 3300049575 Bacteria 1112
173 Ga0501039_0449662 3300049575 Bacteria 1012
174 Ga0501039_0577027 3300049575 Bacteria 882
175 Ga0501039_0669654 3300049575 Bacteria 812
176 Ga0501040_0020138 3300049576 Bacteria 4444
177 Ga0501040_0072764 3300049576 Bacteria 2374
178 Ga0501040_0134608 3300049576 Bacteria 1739
179 Ga0501040_0307085 3300049576 Bacteria 1134
180 Ga0501041_0001023 3300049577 Bacteria 15290
181 Ga0501041_0015950 3300049577 Bacteria 4464
182 Ga0501041_0244626 3300049577 Bacteria 1127
183 Ga0501042_0002171 3300049578 Bacteria 11947
184 Ga0501042_0063901 3300049578 Bacteria 2630
185 Ga0501042_0624117 3300049578 Bacteria 784
186 Ga0501042_0640860 3300049578 Bacteria 772
187 Ga0501043_0048778 3300049579 Bacteria 3328
188 Ga0501046_0012053 3300049580 Bacteria 7371
189 Ga0501046_0215945 3300049580 Bacteria 1422
190 Ga0501046_0543850 3300049580 Bacteria 828
191 Ga0501046_0609074 3300049580 Bacteria 774
192 Ga0501046_0626296 3300049580 Bacteria 762
193 Ga0501046_0830712 3300049580 Bacteria 646
194 Ga0501048_0064094 3300049582 Bacteria 2599
195 Ga0501048_0169663 3300049582 Bacteria 1545
196 Ga0501048_0202620 3300049582 Bacteria 1407
197 Ga0501069_0982769 3300049585 Bacteria 515
198 Ga0501071_0049094 3300049587 Bacteria 3037
199 Ga0501071_0096569 3300049587 Bacteria 2175
200 Ga0501071_0170304 3300049587 Bacteria 1630
201 Ga0501071_0478980 3300049587 Bacteria 954
202 Ga0501071_0660770 3300049587 Bacteria 804
203 Ga0501072_0004209 3300049588 Bacteria 10912
204 Ga0501072_0010463 3300049588 Bacteria 7065
205 Ga0501072_0063125 3300049588 Bacteria 2922
206 Ga0501072_0080891 3300049588 Bacteria 2575
207 Ga0501072_0084234 3300049588 Bacteria 2521
208 Ga0501072_0273041 3300049588 Bacteria 1345
209 Ga0501073_0172798 3300049589 Bacteria 1496
210 Ga0501073_0563446 3300049589 Bacteria 787
211 Ga0501074_0168613 3300049590 Bacteria 1563
212 Ga0501074_0202964 3300049590 Bacteria 1413
213 Ga0501074_0224905 3300049590 Bacteria 1336
214 Ga0501074_0823600 3300049590 Bacteria 654
215 Ga0501075_0017102 3300049591 Bacteria 5234
216 Ga0501075_0022444 3300049591 Bacteria 4610
217 Ga0501075_0171416 3300049591 Bacteria 1656
218 Ga0501075_0187136 3300049591 Bacteria 1579
219 Ga0501075_0223260 3300049591 Bacteria 1437
220 Ga0501075_1135120 3300049591 Bacteria 593
221 Ga0501076_0001909 3300049592 Bacteria 14227
222 Ga0501076_0031548 3300049592 Bacteria 4133
223 Ga0501076_0147415 3300049592 Bacteria 1914
224 Ga0501076_0361048 3300049592 Bacteria 1193
225 Ga0501076_0555519 3300049592 Bacteria 947
226 Ga0501077_0001466 3300049593 Bacteria 14190
227 Ga0501077_0075743 3300049593 Bacteria 2131
228 Ga0501077_0620846 3300049593 Bacteria 694
229 Ga0501077_1012075 3300049593 Bacteria 535
230 Ga0501079_0008559 3300049741 Bacteria 7762
231 Ga0501079_0145084 3300049741 Bacteria 1850
232 Ga0501079_0250178 3300049741 Bacteria 1385
233 Ga0501079_0504328 3300049741 Bacteria 951
234 Ga0501079_0608090 3300049741 Bacteria 860
235 Ga0501080_0014827 3300049742 Bacteria 7177
236 Ga0501080_0044097 3300049742 Bacteria 4152
237 Ga0501080_1118534 3300049742 Bacteria 679
238 Ga0501080_1179003 3300049742 Unclassified 659
239 Ga0501080_1757092 3300049742 Bacteria 522
240 Ga0501081_0001080 3300049743 Bacteria 16434
241 Ga0501081_0104748 3300049743 Bacteria 2003
242 Ga0501081_0204322 3300049743 Bacteria 1433
243 Ga0501081_0265938 3300049743 Bacteria 1254
244 Ga0501035_0938375 3300049822 Bacteria 683
245 Ga0501035_1525235 3300049822 Unclassified 509
246 Ga0501045_0016473 3300049824 Bacteria 5251
247 Ga0501045_0020812 3300049824 Bacteria 4688
248 Ga0501045_0027788 3300049824 Bacteria 4079
249 Ga0501045_0147502 3300049824 Bacteria 1750
250 Ga0501045_0581713 3300049824 Bacteria 830
251 Ga0501045_0711620 3300049824 Bacteria 741
252 Ga0501045_1172811 3300049824 Bacteria 561
253 nmdc:mga05p37_262603_c1 3300050507 Bacteria 2066
254 nmdc:mga05p37_460126_c1 3300050507 Bacteria 1470
255 nmdc:mga09592_310116_c1 3300050508 Bacteria 1368
256 nmdc:mga09592_373545_c1 3300050508 Bacteria 1233
257 nmdc:mga09592_544317_c1 3300050508 Bacteria 997
258 nmdc:mga0qj67_1078153_c1 3300050509 Bacteria 628
259 nmdc:mga0qj67_287122_c1 3300050509 Bacteria 1333
260 nmdc:mga06r32_158609_c1 3300050510 Bacteria 2244
261 nmdc:mga06r32_616824_c1 3300050510 Bacteria 1055
262 nmdc:mga06r32_84966_c1 3300050510 Bacteria 3085
263 nmdc:mga08y16_102346_c1 3300050511 Bacteria 2982
264 nmdc:mga08y16_1317134_c1 3300050511 Bacteria 688
265 nmdc:mga08y16_19342_c1 3300050511 Bacteria 7179
266 nmdc:mga08x19_31064_c1 3300050514 Bacteria 3358
267 Ga0500610_0027250 3300053079 Bacteria 2868
268 Ga0500646_0052908 3300053090 Bacteria 1176
269 Ga0500562_159890 3300053108 Bacteria 613
270 Ga0500658_0449548 3300053134 Bacteria 587
271 Ga0500588_0223776 3300053146 Bacteria 702
272 Ga0500604_0053947 3300053151 Bacteria 1247
273 Ga0501084_0026403 3300054114 Bacteria 4846
274 Ga0501084_0114201 3300054114 Bacteria 2270
275 Ga0501084_0184734 3300054114 Bacteria 1760
276 Ga0501084_0398170 3300054114 Bacteria 1164
277 Ga0501084_0827563 3300054114 Bacteria 779
278 Ga0501084_1137230 3300054114 Bacteria 655
279 Ga0590077_063317 3300059426 Unclassified 840
280 Ga0501082_0030995 3300060353 Bacteria 4609
281 Ga0501082_0036029 3300060353 Bacteria 4263
282 Ga0501082_0131735 3300060353 Bacteria 2170
283 Ga0501082_0480242 3300060353 Bacteria 1086
284 Ga0501082_0774986 3300060353 Bacteria 839
285 Ga0530510_0000422 3300061734 Bacteria 27352
286 Ga0530510_0005817 3300061734 Bacteria 8544
287 Ga0530510_0536800 3300061734 Bacteria 888
288 Ga0530510_0667160 3300061734 Unclassified 792
289 2644031636 2643221603 Bacteria 6147767
290 8003401992 8003400568 Bacteria 5535898
291 Ga0209969_1012488
292 Ga0065715_10888892
293 Ga0070658_10192654
294 Ga0070677_10591617
295 Ga0070660_100271227
296 Ga0070669_100376148
297 Ga0070675_100046321
298 Ga0070674_101448444
299 Ga0070673_100245424
300 Ga0070673_100342421
301 Ga0070705_100975791
302 Ga0070700_100902937
303 Ga0070694_101231799
304 Ga0070678_100189462
305 Ga0070698_101234611
306 Ga0070699_100034989
307 Ga0070699_100684944
308 Ga0070679_100787489
309 Ga0070684_100392106
310 Ga0070696_100006493
311 Ga0070696_100085095
312 Ga0070704_100045279
313 Ga0070704_100134416
314 Ga0068855_100042571
315 Ga0068859_100077494
316 Ga0068859_100286439
317 Ga0068859_100296896
318 Ga0068861_100111618
319 Ga0068861_100831148
320 Ga0068861_101062124
321 Ga0068870_10206102
322 Ga0068858_101203570
323 Ga0068862_100348266
324 Ga0068862_101075079
325 Ga0075366_10589466
326 Ga0097621_100087550
327 Ga0097621_100251343
328 Ga0097621_100666000
329 Ga0068871_100244232
330 Ga0075428_100001314
331 Ga0075430_100004545
332 Ga0075430_100014560
333 Ga0075430_101224057
334 Ga0075431_100150076
335 Ga0075431_100228656
336 Ga0075429_100305950
337 Ga0075429_100602602
338 Ga0075429_100845911
339 Ga0075436_100539302
340 Ga0097620_100077493
341 Ga0097620_100286436
342 Ga0097620_100296895
343 Ga0075435_101937370
344 Ga0111539_10016549
345 Ga0105245_10431630
346 Ga0114129_10093983
347 Ga0105243_10306249
348 Ga0105248_10276731
349 Ga0105248_11019782
350 Ga0105237_10072227
351 Ga0105238_10004073
352 Ga0105249_10987393
353 Ga0157374_10026832
354 Ga0163162_10411625
355 Ga0157372_10021228
356 Ga0163163_11722989
357 Ga0157380_10007847
358 Ga0157380_10021083
359 Ga0157379_10541614
360 Ga0209675_1001489
361 Ga0207705_10180613
362 Ga0207657_10183077
363 Ga0207681_10276458
364 Ga0207659_10794293
365 Ga0207667_10461271
366 Ga0207651_10174280
367 Ga0207712_10341044
368 Ga0207668_11658522
369 Ga0207703_10965284
370 Ga0207639_10050493
371 Ga0207708_10700095
372 Ga0207676_10659202
373 Ga0207674_10578528
374 Ga0207675_100430524
375 Ga0207675_100601242
376 Ga0207698_12370461
377 Ga0209969_1055660
378 Ga0209967_1014513
379 Ga0209967_1014795
380 Ga0209981_1017755
381 Ga0209996_1015890
382 Ga0209996_1025648
383 Ga0210000_1003060
384 Ga0210000_1018936
385 Ga0209995_1004733
386 Ga0209999_1011115
387 Ga0209970_1009631
388 Ga0210002_1023406
389 Ga0210002_1058168
390 Ga0209971_1095175
391 Ga0209971_1102214
392 Ga0209966_1168331
393 Ga0209974_10012164
394 Ga0209974_10056303
395 Ga0207428_10000990
396 Ga0268265_11628411
397 Ga0268264_10594788
398 Ga0307515_10704010
399 Ga0307513_10198508
400 Ga0307408_100046770
401 Ga0307405_11328960
402 Ga0307410_10167736
403 Ga0307406_10067307
404 Ga0307416_100380408
405 Ga0307416_102694988
406 Ga0307416_102974263
407 Ga0307414_10984703
408 Ga0307411_11983849
409 Ga0373927_0070789
410 Ga0373925_0216252
411 Ga0439461_0007984
412 Ga0439431_0048004
413 Ga0439431_0212704
414 Ga0439433_0198014
415 Ga0439441_022154
416 Ga0439441_029842
417 Ga0439443_006801
418 Ga0439445_0167982
419 Ga0439451_048207
420 Ga0439462_0160317
421 Ga0439446_0000580
422 Ga0439446_0028967
423 Ga0439434_0000114
424 Ga0439434_0032554
425 Ga0439435_0045905
426 Ga0439444_0009742
427 Ga0439444_0029491
428 Ga0439460_0003012
429 Ga0439460_0205697
430 Ga0451577_0000313
431 Ga0451577_0666056
432 Ga0453683_0374508
433 Ga0453684_0000992
434 Ga0466968_0164228
435 Ga0495603_0430244
436 Ga0495590_0115191
437 Ga0495590_0303553
438 Ga0495638_0010532
439 Ga0495621_0172887
440 Ga0495668_0226560
441 Ga0495636_0670129
442 Ga0495672_0256552
443 Ga0495686_0095012
444 Ga0495686_0230547
445 Ga0495614_0399421
446 Ga0496102_1537082
447 Ga0496104_0180898
448 Ga0501298_014167
449 Ga0501031_0894765
450 Ga0501033_0747362
451 Ga0501033_0819073
452 Ga0501036_0035152
453 Ga0501036_0035813
454 Ga0501036_0038979
455 Ga0501037_0451207
456 Ga0501038_0003584
457 Ga0501038_0030865
458 Ga0501038_0153664
459 Ga0501039_0001352
460 Ga0501039_0013298
461 Ga0501039_0085563
462 Ga0501039_0378228
463 Ga0501039_0449662
464 Ga0501039_0577027
465 Ga0501039_0669654
466 Ga0501040_0020138
467 Ga0501040_0072764
468 Ga0501040_0134608
469 Ga0501040_0307085
470 Ga0501041_0001023
471 Ga0501041_0015950
472 Ga0501041_0244626
473 Ga0501042_0002171
474 Ga0501042_0063901
475 Ga0501042_0624117
476 Ga0501042_0640860
477 Ga0501043_0048778
478 Ga0501046_0012053
479 Ga0501046_0215945
480 Ga0501046_0543850
481 Ga0501046_0609074
482 Ga0501046_0626296
483 Ga0501046_0830712
484 Ga0501048_0064094
485 Ga0501048_0169663
486 Ga0501048_0202620
487 Ga0501069_0982769
488 Ga0501071_0049094
489 Ga0501071_0096569
490 Ga0501071_0170304
491 Ga0501071_0478980
492 Ga0501071_0660770
493 Ga0501072_0004209
494 Ga0501072_0010463
495 Ga0501072_0063125
496 Ga0501072_0080891
497 Ga0501072_0084234
498 Ga0501072_0273041
499 Ga0501073_0172798
500 Ga0501073_0563446
501 Ga0501074_0168613
502 Ga0501074_0202964
503 Ga0501074_0224905
504 Ga0501074_0823600
505 Ga0501075_0017102
506 Ga0501075_0022444
507 Ga0501075_0171416
508 Ga0501075_0187136
509 Ga0501075_0223260
510 Ga0501075_1135120
511 Ga0501076_0001909
512 Ga0501076_0031548
513 Ga0501076_0147415
514 Ga0501076_0361048
515 Ga0501076_0555519
516 Ga0501077_0001466
517 Ga0501077_0075743
518 Ga0501077_0620846
519 Ga0501077_1012075
520 Ga0501079_0008559
521 Ga0501079_0145084
522 Ga0501079_0250178
523 Ga0501079_0504328
524 Ga0501079_0608090
525 Ga0501080_0014827
526 Ga0501080_0044097
527 Ga0501080_1118534
528 Ga0501080_1179003
529 Ga0501080_1757092
530 Ga0501081_0001080
531 Ga0501081_0104748
532 Ga0501081_0204322
533 Ga0501081_0265938
534 Ga0501035_0938375
535 Ga0501035_1525235
536 Ga0501045_0016473
537 Ga0501045_0020812
538 Ga0501045_0027788
539 Ga0501045_0147502
540 Ga0501045_0581713
541 Ga0501045_0711620
542 Ga0501045_1172811
543 nmdc:mga05p37_262603_c1
544 nmdc:mga05p37_460126_c1
545 nmdc:mga09592_310116_c1
546 nmdc:mga09592_373545_c1
547 nmdc:mga09592_544317_c1
548 nmdc:mga0qj67_1078153_c1
549 nmdc:mga0qj67_287122_c1
550 nmdc:mga06r32_158609_c1
551 nmdc:mga06r32_616824_c1
552 nmdc:mga06r32_84966_c1
553 nmdc:mga08y16_102346_c1
554 nmdc:mga08y16_1317134_c1
555 nmdc:mga08y16_19342_c1
556 nmdc:mga08x19_31064_c1
557 Ga0500610_0027250
558 Ga0500646_0052908
559 Ga0500562_159890
560 Ga0500658_0449548
561 Ga0500588_0223776
562 Ga0500604_0053947
563 Ga0501084_0026403
564 Ga0501084_0114201
565 Ga0501084_0184734
566 Ga0501084_0398170
567 Ga0501084_0827563
568 Ga0501084_1137230
569 Ga0590077_063317
570 Ga0501082_0030995
571 Ga0501082_0036029
572 Ga0501082_0131735
573 Ga0501082_0480242
574 Ga0501082_0774986
575 Ga0530510_0000422
576 Ga0530510_0005817
577 Ga0530510_0536800
578 Ga0530510_0667160
579 2644031636
580 8003401992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7872 1 115
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7302 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6835 1 115
2bj1-assembly1.cif.gz_B-2 nikr in open conformation and nickel bound to high-affinity sites 0.6613 2 112
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.656 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7872 1 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7302 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7064 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6878 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6768 1 120 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7X7PU01-F1-model_v4 YciI family protein 0.9843 1 119
AF-A0A6N6SX07-F1-model_v4 YciI family protein 0.9808 1 119
AF-A0A2M8U086-F1-model_v4 Dehydrogenase 0.9729 1 121
AF-A0A7W1SK36-F1-model_v4 YciI family protein 0.9718 1 119
AF-A0A259QS09-F1-model_v4 deleted 0.971 1 119

Map