F389412

General Info

Members Datasets Scaffolds Average Seq Length
289 161 578 371

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0002578|Ga0496126_0002578_163_1488
Length 423
Sequence MSPRSQPRIIVGLSGGVDSAVAALLLKEQGWDVQALFMSNWDAEEDDTYCTAAQDFQDARAVAAEIGIPLHRVSFAAEYRDRVFEYFLREQRAGRTPNPDVLCNREIKFGVALKYVRRLGGTHFATGHYARLLKYSDGTTQLHKAKDGAKDQSYFLHAVATEHLAASLMPLGELEKGEVRERARRAGLPVFDKPDSTGICFIGERPFREFLGKFLDKTPGPIESPEGERLGTHQGLAFYTLGQRGGLQIGGRRGHSEEPWYVAVKDAKRNVLVAVQGHDHPLLTSDALTTGPMHWLAPAPRAAAGDASGQPAGPTNTDQPLAGQPAVAVHGGPICPFRCTAKVRYRQADQPALFVPQPDGTARLIFDQPQRAVTPGQYAVIYDGDRCLGGAVIETVLSQRSARQAVQPAKTTLFDGGVRSIVR

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
159 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
160 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 9.69
Rhizosphere 77.85
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0002578 3300048929 Bacteria 24191
2 Ga0065707_10088038 3300005295 Bacteria 4801
3 Ga0070666_10000800 3300005335 Bacteria 19098
4 Ga0070666_10004073 3300005335 Bacteria 8875
5 Ga0070666_10026508 3300005335 Bacteria 3788
6 Ga0070680_100001195 3300005336 Bacteria 18711
7 Ga0070680_100028087 3300005336 Bacteria 4511
8 Ga0070680_100242054 3300005336 Bacteria 1525
9 Ga0068868_100032335 3300005338 Bacteria 4024
10 Ga0070671_100001184 3300005355 Bacteria 19515
11 Ga0070671_100005739 3300005355 Bacteria 9883
12 Ga0070671_100117258 3300005355 Bacteria 2238
13 Ga0070673_100012378 3300005364 Bacteria 5855
14 Ga0070673_100194751 3300005364 Bacteria 1743
15 Ga0070667_100000028 3300005367 Bacteria 180376
16 Ga0070667_100002165 3300005367 Bacteria 17301
17 Ga0070667_100002191 3300005367 Bacteria 17196
18 Ga0070667_100025048 3300005367 Bacteria 4959
19 Ga0070713_100005573 3300005436 Bacteria 8626
20 Ga0070713_100062060 3300005436 Bacteria 3129
21 Ga0070713_100198043 3300005436 Bacteria 1813
22 Ga0070710_10021410 3300005437 Bacteria 3369
23 Ga0070711_100001238 3300005439 Bacteria 13802
24 Ga0070678_100002485 3300005456 Bacteria 10104
25 Ga0070681_10005509 3300005458 Bacteria 12231
26 Ga0070681_10018214 3300005458 Bacteria 7020
27 Ga0070681_10024554 3300005458 Bacteria 6064
28 Ga0070681_10024641 3300005458 Bacteria 6054
29 Ga0070679_100000770 3300005530 Bacteria 27803
30 Ga0070679_100070006 3300005530 Bacteria 3499
31 Ga0070679_100257835 3300005530 Unclassified 1699
32 Ga0068853_100136912 3300005539 Bacteria 2196
33 Ga0070695_100002920 3300005545 Bacteria 9946
34 Ga0070696_100000057 3300005546 Bacteria 52873
35 Ga0070665_100000660 3300005548 Bacteria 46496
36 Ga0070665_100016384 3300005548 Bacteria 7433
37 Ga0070665_100016567 3300005548 Bacteria 7389
38 Ga0070665_100025870 3300005548 Bacteria 5910
39 Ga0070665_100028152 3300005548 Bacteria 5659
40 Ga0070665_100032097 3300005548 Bacteria 5286
41 Ga0070665_100073258 3300005548 Bacteria 3432
42 Ga0068855_100002561 3300005563 Bacteria 22402
43 Ga0068855_100033623 3300005563 Bacteria 6117
44 Ga0068856_100015888 3300005614 Bacteria 7277
45 Ga0068856_100139076 3300005614 Bacteria 2435
46 Ga0068852_100121000 3300005616 Bacteria 2396
47 Ga0068859_100000500 3300005617 Bacteria 38692
48 Ga0068859_100076549 3300005617 Bacteria 3387
49 Ga0068859_100317942 3300005617 Bacteria 1650
50 Ga0068863_100011238 3300005841 Bacteria 8676
51 Ga0068863_100024827 3300005841 Bacteria 5717
52 Ga0068863_100048985 3300005841 Bacteria 4006
53 Ga0068858_100000540 3300005842 Bacteria 39342
54 Ga0068858_100000794 3300005842 Bacteria 32985
55 Ga0068858_100017056 3300005842 Bacteria 6816
56 Ga0068860_100001963 3300005843 Bacteria 21751
57 Ga0068860_100014484 3300005843 Bacteria 7720
58 Ga0068860_100146603 3300005843 Bacteria 2271
59 Ga0068862_100191699 3300005844 Bacteria 1839
60 Ga0070717_10087834 3300006028 Bacteria 2619
61 Ga0070715_10001263 3300006163 Bacteria 7253
62 Ga0070716_100000366 3300006173 Bacteria 18560
63 Ga0070712_100002477 3300006175 Bacteria 11374
64 Ga0070712_100023358 3300006175 Bacteria 4084
65 Ga0097621_100026393 3300006237 Bacteria 4556
66 Ga0068871_100039552 3300006358 Bacteria 3774
67 Ga0068865_100000565 3300006881 Bacteria 20635
68 Ga0097620_100000500 3300006931 Bacteria 38692
69 Ga0097620_100076546 3300006931 Bacteria 3387
70 Ga0097620_100317947 3300006931 Bacteria 1650
71 Ga0099795_10000027 3300007788 Bacteria 42524
72 Ga0105240_10001472 3300009093 Bacteria 40169
73 Ga0105240_10005681 3300009093 Bacteria 18515
74 Ga0105240_10019233 3300009093 Bacteria 9129
75 Ga0105240_10054602 3300009093 Bacteria 5006
76 Ga0105240_10057011 3300009093 Bacteria 4884
77 Ga0105240_10186052 3300009093 Bacteria 2446
78 Ga0105245_10001674 3300009098 Bacteria 20187
79 Ga0105247_10000226 3300009101 Bacteria 53777
80 Ga0105247_10029864 3300009101 Bacteria 3305
81 Ga0105247_10046206 3300009101 Bacteria 2672
82 Ga0105241_10013926 3300009174 Bacteria 5893
83 Ga0105242_10004912 3300009176 Bacteria 10349
84 Ga0105248_10020153 3300009177 Bacteria 7389
85 Ga0105248_10068288 3300009177 Bacteria 3991
86 Ga0105237_10023315 3300009545 Bacteria 6343
87 Ga0105237_10084893 3300009545 Bacteria 3156
88 Ga0105237_10094131 3300009545 Bacteria 2985
89 Ga0105237_10188898 3300009545 Bacteria 2060
90 Ga0105238_10046754 3300009551 Bacteria 4365
91 Ga0105238_10117350 3300009551 Bacteria 2641
92 Ga0105238_10243454 3300009551 Bacteria 1776
93 Ga0105249_10020240 3300009553 Bacteria 5948
94 Ga0105249_10112585 3300009553 Bacteria 2574
95 Ga0099796_10000022 3300010159 Bacteria 39465
96 Ga0099796_10013330 3300010159 Bacteria 2345
97 Ga0105239_10013746 3300010375 Bacteria 8986
98 Ga0105246_10247998 3300011119 Bacteria 1412
99 Ga0157370_10004149 3300013104 Bacteria 16774
100 Ga0157369_10006843 3300013105 Bacteria 13153
101 Ga0157369_10038696 3300013105 Bacteria 5215
102 Ga0157369_10122603 3300013105 Bacteria 2757
103 Ga0157374_10034722 3300013296 Bacteria 4609
104 Ga0157374_10036357 3300013296 Bacteria 4510
105 Ga0157378_10014997 3300013297 Bacteria 6785
106 Ga0163162_10018969 3300013306 Bacteria 6744
107 Ga0163162_10121416 3300013306 Bacteria 2717
108 Ga0157375_10014269 3300013308 Bacteria 7082
109 Ga0157375_10016044 3300013308 Bacteria 6719
110 Ga0163163_10000942 3300014325 Bacteria 24708
111 Ga0163163_10002531 3300014325 Bacteria 15468
112 Ga0163163_10226593 3300014325 Bacteria 1918
113 Ga0163163_10350274 3300014325 Bacteria 1533
114 Ga0157379_10000251 3300014968 Bacteria 42123
115 Ga0157379_10011529 3300014968 Bacteria 7714
116 Ga0157379_10069202 3300014968 Bacteria 3156
117 Ga0157379_10159359 3300014968 Bacteria 2037
118 Ga0157376_10014385 3300014969 Bacteria 5939
119 Ga0157376_10097326 3300014969 Bacteria 2563
120 Ga0206356_11380729 3300020070 Bacteria 1718
121 Ga0213874_10047598 3300021377 Bacteria 1305
122 Ga0228598_1010895 3300024227 Bacteria 1810
123 Ga0207692_10026375 3300025898 Bacteria 2725
124 Ga0207710_10000359 3300025900 Bacteria 32244
125 Ga0207710_10015388 3300025900 Bacteria 3232
126 Ga0207710_10023299 3300025900 Bacteria 2660
127 Ga0207680_10004686 3300025903 Bacteria 6497
128 Ga0207685_10009331 3300025905 Bacteria 2845
129 Ga0207699_10006996 3300025906 Bacteria 5494
130 Ga0207707_10000195 3300025912 Bacteria 64061
131 Ga0207707_10020780 3300025912 Bacteria 5734
132 Ga0207707_10032856 3300025912 Bacteria 4541
133 Ga0207707_10055631 3300025912 Bacteria 3441
134 Ga0207707_10064213 3300025912 Bacteria 3196
135 Ga0207707_10207246 3300025912 Bacteria 1708
136 Ga0207695_10004451 3300025913 Bacteria 19092
137 Ga0207695_10039450 3300025913 Bacteria 5076
138 Ga0207695_10040344 3300025913 Bacteria 5007
139 Ga0207695_10047552 3300025913 Bacteria 4539
140 Ga0207695_10067139 3300025913 Bacteria 3680
141 Ga0207695_10077342 3300025913 Bacteria 3380
142 Ga0207695_10217045 3300025913 Bacteria 1821
143 Ga0207671_10062240 3300025914 Bacteria 2771
144 Ga0207671_10075542 3300025914 Bacteria 2520
145 Ga0207671_10092707 3300025914 Bacteria 2277
146 Ga0207693_10000081 3300025915 Bacteria 86034
147 Ga0207660_10002521 3300025917 Bacteria 12030
148 Ga0207660_10025343 3300025917 Bacteria 4024
149 Ga0207652_10000833 3300025921 Bacteria 29375
150 Ga0207652_10169063 3300025921 Unclassified 1961
151 Ga0207694_10024142 3300025924 Bacteria 4617
152 Ga0207694_10078836 3300025924 Bacteria 2583
153 Ga0207694_10184908 3300025924 Bacteria 1691
154 Ga0207687_10007404 3300025927 Bacteria 7226
155 Ga0207700_10021243 3300025928 Bacteria 4428
156 Ga0207700_10056871 3300025928 Bacteria 2947
157 Ga0207700_10082336 3300025928 Bacteria 2516
158 Ga0207700_10279697 3300025928 Bacteria 1435
159 Ga0207644_10002414 3300025931 Bacteria 12039
160 Ga0207644_10028466 3300025931 Bacteria 3868
161 Ga0207665_10007437 3300025939 Bacteria 7244
162 Ga0207711_10000776 3300025941 Bacteria 31415
163 Ga0207667_10011551 3300025949 Bacteria 10255
164 Ga0207667_10141515 3300025949 Bacteria 2477
165 Ga0207651_10206511 3300025960 Bacteria 1578
166 Ga0207712_10200052 3300025961 Bacteria 1584
167 Ga0207658_10000054 3300025986 Bacteria 125062
168 Ga0207658_10013938 3300025986 Bacteria 5501
169 Ga0207658_10014280 3300025986 Bacteria 5438
170 Ga0207658_10021748 3300025986 Bacteria 4456
171 Ga0207677_10041679 3300026023 Bacteria 3038
172 Ga0207703_10000852 3300026035 Bacteria 29895
173 Ga0207703_10002025 3300026035 Bacteria 17894
174 Ga0207703_10079591 3300026035 Bacteria 2727
175 Ga0207702_10124378 3300026078 Bacteria 2313
176 Ga0207641_10000210 3300026088 Bacteria 75487
177 Ga0207641_10175982 3300026088 Bacteria 1956
178 Ga0207641_10223453 3300026088 Bacteria 1747
179 Ga0207683_10003886 3300026121 Bacteria 12957
180 Ga0209179_1000023 3300027512 Bacteria 39721
181 Ga0268266_10002606 3300028379 Bacteria 19106
182 Ga0268266_10010022 3300028379 Bacteria 8315
183 Ga0268266_10014962 3300028379 Bacteria 6661
184 Ga0268266_10026699 3300028379 Bacteria 4913
185 Ga0268264_10000373 3300028381 Bacteria 65793
186 Ga0268264_10081102 3300028381 Bacteria 2772
187 Ga0268264_10329565 3300028381 Bacteria 1446
188 Ga0265319_1007744 3300028563 Bacteria 4788
189 Ga0265334_10000192 3300028573 Bacteria 35702
190 Ga0307515_10020925 3300028794 Bacteria 11627
191 Ga0307515_10102803 3300028794 Bacteria 3433
192 Ga0265338_10031912 3300028800 Bacteria 5153
193 Ga0265338_10042736 3300028800 Bacteria 4215
194 Ga0307511_10004585 3300030521 Bacteria 14096
195 Ga0307511_10034906 3300030521 Bacteria 4402
196 Ga0265332_10003384 3300031238 Bacteria 7719
197 Ga0265328_10013194 3300031239 Bacteria 3275
198 Ga0265325_10007368 3300031241 Bacteria 6590
199 Ga0265329_10003740 3300031242 Bacteria 6550
200 Ga0265340_10006704 3300031247 Bacteria 6310
201 Ga0307513_10111903 3300031456 Unclassified 2722
202 Ga0307509_10000001 3300031507 Bacteria 629324
203 Ga0307412_10019512 3300031911 Bacteria 4108
204 Ga0307510_10000015 3300033180 Bacteria 258937
205 Ga0373954_0028144 3300035118 Bacteria 2582
206 Ga0373937_0002532 3300036401 Bacteria 15174
207 Ga0373925_0202954 3300037068 Bacteria 1577
208 Ga0395900_0160909 3300037418 Bacteria 2290
209 Ga0395898_0007139 3300037466 Bacteria 11859
210 Ga0436365_0813656 3300039437 Bacteria 2097
211 Ga0436360_0389645 3300039438 Bacteria 1230
212 Ga0436360_1188600 3300039438 Bacteria 17858
213 Ga0436363_0610101 3300039450 Bacteria 6073
214 Ga0436363_0767189 3300039450 Bacteria 19975
215 Ga0451791_0057271 3300041451 Bacteria 2658
216 Ga0466969_0011958 3300044656 Bacteria 4589
217 Ga0466969_0013863 3300044656 Bacteria 4243
218 Ga0466966_0000227 3300044684 Bacteria 37516
219 Ga0466966_0100475 3300044684 Bacteria 1789
220 Ga0466961_0001167 3300044693 Bacteria 16171
221 Ga0466964_0002095 3300044706 Bacteria 7022
222 Ga0453684_0072703 3300044712 Bacteria 4340
223 Ga0466971_0000177 3300044719 Bacteria 23913
224 Ga0466970_0000417 3300044765 Bacteria 20826
225 Ga0466957_0003013 3300044842 Bacteria 9146
226 Ga0466960_0048524 3300044901 Bacteria 2041
227 Ga0466959_0001027 3300045049 Bacteria 16661
228 Ga0466959_0002223 3300045049 Bacteria 12358
229 Ga0466959_0013269 3300045049 Bacteria 5968
230 Ga0451576_0076093 3300045051 Bacteria 3493
231 Ga0495651_0251799 3300046462 Bacteria 1206
232 Ga0495580_0000167 3300046472 Bacteria 48832
233 Ga0495582_0180943 3300046473 Bacteria 1201
234 Ga0495587_0165392 3300046536 Bacteria 1258
235 Ga0495656_0013918 3300046615 Bacteria 3005
236 Ga0495674_0057771 3300047319 Bacteria 3395
237 Ga0496100_0034197 3300048903 Bacteria 3187
238 Ga0496101_0022794 3300048904 Bacteria 4315
239 Ga0496102_0007037 3300048905 Bacteria 9603
240 Ga0496104_0037949 3300048907 Bacteria 4505
241 Ga0496104_0093601 3300048907 Bacteria 2874
242 Ga0496105_0008197 3300048908 Bacteria 8121
243 Ga0496105_0031992 3300048908 Bacteria 4314
244 Ga0496105_0347184 3300048908 Bacteria 1186
245 Ga0496106_0014866 3300048909 Bacteria 5757
246 Ga0496106_0200011 3300048909 Bacteria 1590
247 Ga0496107_0014840 3300048910 Bacteria 5454
248 Ga0496108_0005581 3300048911 Bacteria 10176
249 Ga0496108_0038196 3300048911 Bacteria 4000
250 Ga0496108_0183462 3300048911 Bacteria 1812
251 Ga0496109_0089299 3300048912 Bacteria 2849
252 Ga0496109_0089787 3300048912 Bacteria 2841
253 Ga0496109_0295887 3300048912 Bacteria 1526
254 Ga0496110_0023799 3300048913 Bacteria 5212
255 Ga0496110_0083044 3300048913 Bacteria 2857
256 Ga0496111_0002751 3300048914 Bacteria 10696
257 Ga0496111_0035436 3300048914 Bacteria 3566
258 Ga0496112_0024425 3300048915 Bacteria 5787
259 Ga0496113_0101859 3300048916 Bacteria 2226
260 Ga0496113_0241889 3300048916 Bacteria 1440
261 Ga0496114_0010736 3300048917 Bacteria 7290
262 Ga0496114_0220609 3300048917 Bacteria 1664
263 Ga0496115_0148397 3300048918 Bacteria 1936
264 Ga0496117_0000208 3300048920 Bacteria 113931
265 Ga0496117_0076092 3300048920 Bacteria 2227
266 Ga0496118_0000005 3300048921 Bacteria 697350
267 Ga0496118_0017604 3300048921 Bacteria 6493
268 Ga0496119_0010448 3300048922 Bacteria 7814
269 Ga0496119_0018911 3300048922 Bacteria 5102
270 Ga0496120_0001635 3300048923 Bacteria 25979
271 Ga0496120_0094299 3300048923 Bacteria 1593
272 Ga0496121_0000903 3300048924 Bacteria 53531
273 Ga0496121_0082343 3300048924 Bacteria 2544
274 Ga0496125_0002552 3300048928 Bacteria 23455
275 Ga0496126_0119899 3300048929 Bacteria 2283
276 Ga0496126_0220464 3300048929 Bacteria 1593
277 Ga0501042_0156278 3300049578 Bacteria 1645
278 Ga0500646_0014802 3300053090 Bacteria 2027
279 Ga0500583_0038264 3300053092 Bacteria 2159
280 Ga0500583_0061567 3300053092 Bacteria 1772
281 Ga0500556_0001863 3300053104 Bacteria 7597
282 Ga0500595_022406 3300053119 Bacteria 2238
283 Ga0500655_013978 3300053133 Bacteria 1468
284 Ga0500616_0000016 3300053153 Bacteria 627087
285 Ga0500622_0004119 3300053156 Bacteria 9306
286 Ga0500630_078047 3300053159 Bacteria 1554
287 Ga0500639_073420 3300053163 Bacteria 1738
288 Ga0500637_0027605 3300053178 Bacteria 3134
289 Ga0466962_0005144 3300061719 Bacteria 6293
290 Ga0496126_0002578
291 Ga0065707_10088038
292 Ga0070666_10000800
293 Ga0070666_10004073
294 Ga0070666_10026508
295 Ga0070680_100001195
296 Ga0070680_100028087
297 Ga0070680_100242054
298 Ga0068868_100032335
299 Ga0070671_100001184
300 Ga0070671_100005739
301 Ga0070671_100117258
302 Ga0070673_100012378
303 Ga0070673_100194751
304 Ga0070667_100000028
305 Ga0070667_100002165
306 Ga0070667_100002191
307 Ga0070667_100025048
308 Ga0070713_100005573
309 Ga0070713_100062060
310 Ga0070713_100198043
311 Ga0070710_10021410
312 Ga0070711_100001238
313 Ga0070678_100002485
314 Ga0070681_10005509
315 Ga0070681_10018214
316 Ga0070681_10024554
317 Ga0070681_10024641
318 Ga0070679_100000770
319 Ga0070679_100070006
320 Ga0070679_100257835
321 Ga0068853_100136912
322 Ga0070695_100002920
323 Ga0070696_100000057
324 Ga0070665_100000660
325 Ga0070665_100016384
326 Ga0070665_100016567
327 Ga0070665_100025870
328 Ga0070665_100028152
329 Ga0070665_100032097
330 Ga0070665_100073258
331 Ga0068855_100002561
332 Ga0068855_100033623
333 Ga0068856_100015888
334 Ga0068856_100139076
335 Ga0068852_100121000
336 Ga0068859_100000500
337 Ga0068859_100076549
338 Ga0068859_100317942
339 Ga0068863_100011238
340 Ga0068863_100024827
341 Ga0068863_100048985
342 Ga0068858_100000540
343 Ga0068858_100000794
344 Ga0068858_100017056
345 Ga0068860_100001963
346 Ga0068860_100014484
347 Ga0068860_100146603
348 Ga0068862_100191699
349 Ga0070717_10087834
350 Ga0070715_10001263
351 Ga0070716_100000366
352 Ga0070712_100002477
353 Ga0070712_100023358
354 Ga0097621_100026393
355 Ga0068871_100039552
356 Ga0068865_100000565
357 Ga0097620_100000500
358 Ga0097620_100076546
359 Ga0097620_100317947
360 Ga0099795_10000027
361 Ga0105240_10001472
362 Ga0105240_10005681
363 Ga0105240_10019233
364 Ga0105240_10054602
365 Ga0105240_10057011
366 Ga0105240_10186052
367 Ga0105245_10001674
368 Ga0105247_10000226
369 Ga0105247_10029864
370 Ga0105247_10046206
371 Ga0105241_10013926
372 Ga0105242_10004912
373 Ga0105248_10020153
374 Ga0105248_10068288
375 Ga0105237_10023315
376 Ga0105237_10084893
377 Ga0105237_10094131
378 Ga0105237_10188898
379 Ga0105238_10046754
380 Ga0105238_10117350
381 Ga0105238_10243454
382 Ga0105249_10020240
383 Ga0105249_10112585
384 Ga0099796_10000022
385 Ga0099796_10013330
386 Ga0105239_10013746
387 Ga0105246_10247998
388 Ga0157370_10004149
389 Ga0157369_10006843
390 Ga0157369_10038696
391 Ga0157369_10122603
392 Ga0157374_10034722
393 Ga0157374_10036357
394 Ga0157378_10014997
395 Ga0163162_10018969
396 Ga0163162_10121416
397 Ga0157375_10014269
398 Ga0157375_10016044
399 Ga0163163_10000942
400 Ga0163163_10002531
401 Ga0163163_10226593
402 Ga0163163_10350274
403 Ga0157379_10000251
404 Ga0157379_10011529
405 Ga0157379_10069202
406 Ga0157379_10159359
407 Ga0157376_10014385
408 Ga0157376_10097326
409 Ga0206356_11380729
410 Ga0213874_10047598
411 Ga0228598_1010895
412 Ga0207692_10026375
413 Ga0207710_10000359
414 Ga0207710_10015388
415 Ga0207710_10023299
416 Ga0207680_10004686
417 Ga0207685_10009331
418 Ga0207699_10006996
419 Ga0207707_10000195
420 Ga0207707_10020780
421 Ga0207707_10032856
422 Ga0207707_10055631
423 Ga0207707_10064213
424 Ga0207707_10207246
425 Ga0207695_10004451
426 Ga0207695_10039450
427 Ga0207695_10040344
428 Ga0207695_10047552
429 Ga0207695_10067139
430 Ga0207695_10077342
431 Ga0207695_10217045
432 Ga0207671_10062240
433 Ga0207671_10075542
434 Ga0207671_10092707
435 Ga0207693_10000081
436 Ga0207660_10002521
437 Ga0207660_10025343
438 Ga0207652_10000833
439 Ga0207652_10169063
440 Ga0207694_10024142
441 Ga0207694_10078836
442 Ga0207694_10184908
443 Ga0207687_10007404
444 Ga0207700_10021243
445 Ga0207700_10056871
446 Ga0207700_10082336
447 Ga0207700_10279697
448 Ga0207644_10002414
449 Ga0207644_10028466
450 Ga0207665_10007437
451 Ga0207711_10000776
452 Ga0207667_10011551
453 Ga0207667_10141515
454 Ga0207651_10206511
455 Ga0207712_10200052
456 Ga0207658_10000054
457 Ga0207658_10013938
458 Ga0207658_10014280
459 Ga0207658_10021748
460 Ga0207677_10041679
461 Ga0207703_10000852
462 Ga0207703_10002025
463 Ga0207703_10079591
464 Ga0207702_10124378
465 Ga0207641_10000210
466 Ga0207641_10175982
467 Ga0207641_10223453
468 Ga0207683_10003886
469 Ga0209179_1000023
470 Ga0268266_10002606
471 Ga0268266_10010022
472 Ga0268266_10014962
473 Ga0268266_10026699
474 Ga0268264_10000373
475 Ga0268264_10081102
476 Ga0268264_10329565
477 Ga0265319_1007744
478 Ga0265334_10000192
479 Ga0307515_10020925
480 Ga0307515_10102803
481 Ga0265338_10031912
482 Ga0265338_10042736
483 Ga0307511_10004585
484 Ga0307511_10034906
485 Ga0265332_10003384
486 Ga0265328_10013194
487 Ga0265325_10007368
488 Ga0265329_10003740
489 Ga0265340_10006704
490 Ga0307513_10111903
491 Ga0307509_10000001
492 Ga0307412_10019512
493 Ga0307510_10000015
494 Ga0373954_0028144
495 Ga0373937_0002532
496 Ga0373925_0202954
497 Ga0395900_0160909
498 Ga0395898_0007139
499 Ga0436365_0813656
500 Ga0436360_0389645
501 Ga0436360_1188600
502 Ga0436363_0610101
503 Ga0436363_0767189
504 Ga0451791_0057271
505 Ga0466969_0011958
506 Ga0466969_0013863
507 Ga0466966_0000227
508 Ga0466966_0100475
509 Ga0466961_0001167
510 Ga0466964_0002095
511 Ga0453684_0072703
512 Ga0466971_0000177
513 Ga0466970_0000417
514 Ga0466957_0003013
515 Ga0466960_0048524
516 Ga0466959_0001027
517 Ga0466959_0002223
518 Ga0466959_0013269
519 Ga0451576_0076093
520 Ga0495651_0251799
521 Ga0495580_0000167
522 Ga0495582_0180943
523 Ga0495587_0165392
524 Ga0495656_0013918
525 Ga0495674_0057771
526 Ga0496100_0034197
527 Ga0496101_0022794
528 Ga0496102_0007037
529 Ga0496104_0037949
530 Ga0496104_0093601
531 Ga0496105_0008197
532 Ga0496105_0031992
533 Ga0496105_0347184
534 Ga0496106_0014866
535 Ga0496106_0200011
536 Ga0496107_0014840
537 Ga0496108_0005581
538 Ga0496108_0038196
539 Ga0496108_0183462
540 Ga0496109_0089299
541 Ga0496109_0089787
542 Ga0496109_0295887
543 Ga0496110_0023799
544 Ga0496110_0083044
545 Ga0496111_0002751
546 Ga0496111_0035436
547 Ga0496112_0024425
548 Ga0496113_0101859
549 Ga0496113_0241889
550 Ga0496114_0010736
551 Ga0496114_0220609
552 Ga0496115_0148397
553 Ga0496117_0000208
554 Ga0496117_0076092
555 Ga0496118_0000005
556 Ga0496118_0017604
557 Ga0496119_0010448
558 Ga0496119_0018911
559 Ga0496120_0001635
560 Ga0496120_0094299
561 Ga0496121_0000903
562 Ga0496121_0082343
563 Ga0496125_0002552
564 Ga0496126_0119899
565 Ga0496126_0220464
566 Ga0501042_0156278
567 Ga0500646_0014802
568 Ga0500583_0038264
569 Ga0500583_0061567
570 Ga0500556_0001863
571 Ga0500595_022406
572 Ga0500655_013978
573 Ga0500616_0000016
574 Ga0500622_0004119
575 Ga0500630_078047
576 Ga0500639_073420
577 Ga0500637_0027605
578 Ga0466962_0005144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

7

204

0.99

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

325

393

0.97

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

208

276

0.96

PF02540

NAD_synthase

NAD synthase

3

161

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.9618 5 362
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.9558 5 362
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.951 3 363
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.9451 5 362
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.9438 5 362
ID Description Score Start End Superfamily
af_O75648_300_387_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9606 279 360 2.40.30.10
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9525 5 184 3.40.50.620
af_Q503J2_4_234_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9518 5 207 3.40.50.620
af_Q9W5B6_2_218_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9481 5 207 3.40.50.620
2hmaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9414 3 208 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A356QGJ6-F1-model_v4 tRNA 2-thiouridine(34) synthase MnmA (EC 2.8.1.-) 0.9833 60 172 GO:0002143
GO:0016740
AF-A0A432TGZ9-F1-model_v4 tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13) 0.9793 67 360 GO:0000049
GO:0002143
GO:0005524
GO:0103016
AF-A0A645DJJ7-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9785 70 361 GO:0000049
GO:0002143
GO:0005524
GO:0103016
AF-A0A2E1SQ25-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9728 1 362 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A0A354VZ97-F1-model_v4 deleted 0.9728 205 361

Map