F388410
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 192 | 278 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100083174|Ga0068869_1000831743 |
| Length | 255 |
| Sequence | MTPSPSRAAPGCAPGLSVRGFTPPLRLADFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEIADYKESLRQRVALLKGVPETALHGVYNERLKLNPGADDLVRACQAAGLKTLLVSGGFTFFTDRIRERLCLDFTRSNVLEIVDGALTGRLVDQPWGDICDGAEKRKMLLETCAQLGIEPAQAIAVGDGANDLPMMGEAGLSVAYHAKPAVRDQAMVSITSGGLDRVLEVLEFPPTGAAAQLRSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 3 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 4 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 5 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 6 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 7 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 8 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 9 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 10 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 73 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 108 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 114 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 115 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 121 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 131 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 132 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 134 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 135 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 136 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 137 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 138 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 175 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 176 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 177 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 178 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 182 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 186 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 187 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 188 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 189 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 190 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 191 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.53 |
| Metatranscriptomes | 0 |
| Isolates | 3.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.79 |
| Nodule | 1.04 |
| Rhizoplane | 3.12 |
| Rhizosphere | 63.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000025 | 3300002705 | Bacteria | 136287 |
| 2 | JGI25154J39366_1000045 | 3300002738 | Bacteria | 136302 |
| 3 | JGI25157J39369_1000034 | 3300002741 | Bacteria | 136301 |
| 4 | JGI25152J39213_1002545 | 3300002773 | Bacteria | 6867 |
| 5 | JGI25150J39212_1012067 | 3300002774 | Bacteria | 1544 |
| 6 | JGI25153J46596_10006072 | 3300003215 | Bacteria | 6204 |
| 7 | Ga0055526_1001166 | 3300003771 | Bacteria | 19062 |
| 8 | Ga0055540_1005721 | 3300003792 | Bacteria | 5133 |
| 9 | Ga0055531_10000584 | 3300003794 | Bacteria | 31840 |
| 10 | Ga0065704_10104615 | 3300005289 | Bacteria | 2135 |
| 11 | Ga0065704_10117649 | 3300005289 | Bacteria | 1830 |
| 12 | Ga0065707_10265848 | 3300005295 | Bacteria | 1085 |
| 13 | Ga0070658_10240920 | 3300005327 | Bacteria | 1533 |
| 14 | Ga0070658_10404580 | 3300005327 | Bacteria | 1173 |
| 15 | Ga0070676_10051058 | 3300005328 | Bacteria | 2427 |
| 16 | Ga0070676_10066063 | 3300005328 | Bacteria | 2160 |
| 17 | Ga0070670_100025635 | 3300005331 | Bacteria | 5072 |
| 18 | Ga0070670_100064014 | 3300005331 | Bacteria | 3155 |
| 19 | Ga0070670_100146556 | 3300005331 | Bacteria | 2042 |
| 20 | Ga0068869_100083174 | 3300005334 | Bacteria | 2393 |
| 21 | Ga0068868_100315078 | 3300005338 | Bacteria | 1332 |
| 22 | Ga0070675_100086887 | 3300005354 | Bacteria | 2614 |
| 23 | Ga0070675_100339158 | 3300005354 | Bacteria | 1331 |
| 24 | Ga0070671_100002733 | 3300005355 | Bacteria | 13699 |
| 25 | Ga0070671_100219902 | 3300005355 | Bacteria | 1611 |
| 26 | Ga0070673_100191785 | 3300005364 | Bacteria | 1755 |
| 27 | Ga0070673_100193843 | 3300005364 | Bacteria | 1747 |
| 28 | Ga0070659_100099184 | 3300005366 | Bacteria | 2343 |
| 29 | Ga0070663_100121720 | 3300005455 | Bacteria | 1972 |
| 30 | Ga0070678_100064228 | 3300005456 | Bacteria | 2719 |
| 31 | Ga0070662_100106068 | 3300005457 | Bacteria | 2134 |
| 32 | Ga0068867_100404928 | 3300005459 | Bacteria | 1152 |
| 33 | Ga0070706_100002204 | 3300005467 | Bacteria | 19824 |
| 34 | Ga0070707_100117889 | 3300005468 | Bacteria | 2577 |
| 35 | Ga0068853_100322631 | 3300005539 | Bacteria | 1432 |
| 36 | Ga0070665_100038047 | 3300005548 | Bacteria | 4836 |
| 37 | Ga0070664_100052913 | 3300005564 | Bacteria | 3440 |
| 38 | Ga0068857_100191356 | 3300005577 | Bacteria | 1863 |
| 39 | Ga0068864_100128160 | 3300005618 | Bacteria | 2276 |
| 40 | Ga0068863_100024012 | 3300005841 | Bacteria | 5819 |
| 41 | Ga0068863_100024097 | 3300005841 | Bacteria | 5806 |
| 42 | Ga0068860_100049961 | 3300005843 | Bacteria | 3983 |
| 43 | Ga0068862_100021694 | 3300005844 | Bacteria | 5371 |
| 44 | Ga0068862_100369640 | 3300005844 | Bacteria | 1334 |
| 45 | Ga0081455_10197079 | 3300005937 | Bacteria | 1511 |
| 46 | Ga0075368_10011181 | 3300006042 | Bacteria | 3261 |
| 47 | Ga0075368_10105051 | 3300006042 | Bacteria | 1162 |
| 48 | Ga0075368_10181726 | 3300006042 | Bacteria | 887 |
| 49 | Ga0075363_100012826 | 3300006048 | Bacteria | 4046 |
| 50 | Ga0075364_10021530 | 3300006051 | Bacteria | 4065 |
| 51 | Ga0075432_10002628 | 3300006058 | Bacteria | 6004 |
| 52 | Ga0075362_10110867 | 3300006177 | Bacteria | 1291 |
| 53 | Ga0075362_10115018 | 3300006177 | Bacteria | 1269 |
| 54 | Ga0075367_10067923 | 3300006178 | Bacteria | 2137 |
| 55 | Ga0075366_10001616 | 3300006195 | Bacteria | 11290 |
| 56 | Ga0075366_10001785 | 3300006195 | Bacteria | 10865 |
| 57 | Ga0075366_10012195 | 3300006195 | Bacteria | 4871 |
| 58 | Ga0075366_10136281 | 3300006195 | Bacteria | 1482 |
| 59 | Ga0097621_100055093 | 3300006237 | Bacteria | 3246 |
| 60 | Ga0075370_10000324 | 3300006353 | Bacteria | 17247 |
| 61 | Ga0075370_10004923 | 3300006353 | Bacteria | 6560 |
| 62 | Ga0075370_10006283 | 3300006353 | Bacteria | 5964 |
| 63 | Ga0068871_100413971 | 3300006358 | Bacteria | 1202 |
| 64 | Ga0075430_100162185 | 3300006846 | Bacteria | 1861 |
| 65 | Ga0075429_100209533 | 3300006880 | Bacteria | 1708 |
| 66 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 67 | Ga0105244_10138317 | 3300009036 | Bacteria | 1173 |
| 68 | Ga0105250_10007024 | 3300009092 | Bacteria | 4862 |
| 69 | Ga0105240_10229433 | 3300009093 | Bacteria | 2159 |
| 70 | Ga0105245_10066000 | 3300009098 | Bacteria | 3274 |
| 71 | Ga0105243_10169141 | 3300009148 | Bacteria | 1891 |
| 72 | Ga0105242_10001169 | 3300009176 | Bacteria | 20656 |
| 73 | Ga0105248_10053028 | 3300009177 | Bacteria | 4550 |
| 74 | Ga0105248_10632841 | 3300009177 | Bacteria | 1207 |
| 75 | Ga0105248_11116613 | 3300009177 | Bacteria | 891 |
| 76 | Ga0105237_10001237 | 3300009545 | Bacteria | 34072 |
| 77 | Ga0105237_10027029 | 3300009545 | Bacteria | 5860 |
| 78 | Ga0105249_10346979 | 3300009553 | Bacteria | 1503 |
| 79 | Ga0105249_10456293 | 3300009553 | Bacteria | 1317 |
| 80 | Ga0157374_10206193 | 3300013296 | Bacteria | 1926 |
| 81 | Ga0157375_10069159 | 3300013308 | Bacteria | 3536 |
| 82 | Ga0157376_10215660 | 3300014969 | Bacteria | 1774 |
| 83 | Ga0163161_10044033 | 3300017792 | Bacteria | 3214 |
| 84 | Ga0163161_10186512 | 3300017792 | Bacteria | 1592 |
| 85 | Ga0213872_10022420 | 3300021361 | Bacteria | 2908 |
| 86 | Ga0213872_10043879 | 3300021361 | Bacteria | 2036 |
| 87 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 88 | Ga0207425_1000204 | 3300025245 | Bacteria | 47226 |
| 89 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 90 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 91 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 92 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 93 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 94 | Ga0209758_1000163 | 3300025297 | Bacteria | 151988 |
| 95 | Ga0209051_1000110 | 3300025303 | Bacteria | 153230 |
| 96 | Ga0209051_1041592 | 3300025303 | Bacteria | 1633 |
| 97 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 98 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 99 | Ga0207682_10012282 | 3300025893 | Bacteria | 3344 |
| 100 | Ga0207688_10003462 | 3300025901 | Bacteria | 8613 |
| 101 | Ga0207688_10054564 | 3300025901 | Bacteria | 2242 |
| 102 | Ga0207645_10072239 | 3300025907 | Bacteria | 2208 |
| 103 | Ga0207645_10127803 | 3300025907 | Bacteria | 1653 |
| 104 | Ga0207645_10131283 | 3300025907 | Bacteria | 1630 |
| 105 | Ga0207684_10011063 | 3300025910 | Bacteria | 7902 |
| 106 | Ga0207671_10002731 | 3300025914 | Bacteria | 18453 |
| 107 | Ga0207646_10108096 | 3300025922 | Bacteria | 2495 |
| 108 | Ga0207650_10012971 | 3300025925 | Bacteria | 5762 |
| 109 | Ga0207650_10130043 | 3300025925 | Bacteria | 1969 |
| 110 | Ga0207650_10213986 | 3300025925 | Bacteria | 1549 |
| 111 | Ga0207659_10013212 | 3300025926 | Bacteria | 5283 |
| 112 | Ga0207659_10099658 | 3300025926 | Bacteria | 2188 |
| 113 | Ga0207659_10156860 | 3300025926 | Bacteria | 1783 |
| 114 | Ga0207644_10030860 | 3300025931 | Bacteria | 3730 |
| 115 | Ga0207644_10542219 | 3300025931 | Bacteria | 962 |
| 116 | Ga0207690_10116659 | 3300025932 | Bacteria | 1931 |
| 117 | Ga0207706_10088619 | 3300025933 | Bacteria | 2720 |
| 118 | Ga0207706_10237494 | 3300025933 | Bacteria | 1594 |
| 119 | Ga0207686_10004358 | 3300025934 | Bacteria | 7587 |
| 120 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 121 | Ga0207709_10024197 | 3300025935 | Bacteria | 3465 |
| 122 | Ga0207709_10222506 | 3300025935 | Bacteria | 1362 |
| 123 | Ga0207704_10297464 | 3300025938 | Bacteria | 1235 |
| 124 | Ga0207691_10172117 | 3300025940 | Bacteria | 1896 |
| 125 | Ga0207711_10003157 | 3300025941 | Bacteria | 14362 |
| 126 | Ga0207711_10056660 | 3300025941 | Bacteria | 3368 |
| 127 | Ga0207711_10682579 | 3300025941 | Bacteria | 958 |
| 128 | Ga0207651_10128065 | 3300025960 | Bacteria | 1938 |
| 129 | Ga0207651_10164593 | 3300025960 | Bacteria | 1742 |
| 130 | Ga0207651_10497317 | 3300025960 | Bacteria | 1053 |
| 131 | Ga0207712_10259660 | 3300025961 | Bacteria | 1408 |
| 132 | Ga0207677_10303555 | 3300026023 | Bacteria | 1320 |
| 133 | Ga0207641_10201460 | 3300026088 | Bacteria | 1835 |
| 134 | Ga0207648_10326677 | 3300026089 | Bacteria | 1379 |
| 135 | Ga0207674_10186364 | 3300026116 | Bacteria | 2025 |
| 136 | Ga0207683_10080608 | 3300026121 | Bacteria | 2888 |
| 137 | Ga0207683_10087200 | 3300026121 | Bacteria | 2775 |
| 138 | Ga0207683_10770329 | 3300026121 | Bacteria | 893 |
| 139 | Ga0207698_10998972 | 3300026142 | Bacteria | 847 |
| 140 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 141 | Ga0209996_1014330 | 3300027395 | Bacteria | 1076 |
| 142 | Ga0209968_1000656 | 3300027526 | Bacteria | 5336 |
| 143 | Ga0209971_1004459 | 3300027682 | Bacteria | 3323 |
| 144 | Ga0209966_1000027 | 3300027695 | Bacteria | 65242 |
| 145 | Ga0268264_10058477 | 3300028381 | Bacteria | 3229 |
| 146 | Ga0307517_10137665 | 3300028786 | Bacteria | 1729 |
| 147 | Ga0307517_10244883 | 3300028786 | Bacteria | 1059 |
| 148 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 149 | Ga0307515_10015986 | 3300028794 | Bacteria | 13777 |
| 150 | Ga0307515_10169972 | 3300028794 | Bacteria | 2178 |
| 151 | Ga0307512_10176299 | 3300030522 | Bacteria | 1212 |
| 152 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 153 | Ga0307513_10000272 | 3300031456 | Bacteria | 75284 |
| 154 | Ga0307513_10000610 | 3300031456 | Bacteria | 51110 |
| 155 | Ga0307513_10025203 | 3300031456 | Bacteria | 6898 |
| 156 | Ga0307513_10077346 | 3300031456 | Bacteria | 3446 |
| 157 | Ga0307513_10178547 | 3300031456 | Bacteria | 1990 |
| 158 | Ga0307509_10207043 | 3300031507 | Bacteria | 1791 |
| 159 | Ga0307509_10268582 | 3300031507 | Bacteria | 1475 |
| 160 | Ga0307408_100072390 | 3300031548 | Bacteria | 2551 |
| 161 | Ga0307514_10000780 | 3300031649 | Bacteria | 52828 |
| 162 | Ga0307516_10001377 | 3300031730 | Bacteria | 33649 |
| 163 | Ga0307516_10003661 | 3300031730 | Bacteria | 19536 |
| 164 | Ga0307516_10010534 | 3300031730 | Bacteria | 10154 |
| 165 | Ga0307516_10269585 | 3300031730 | Bacteria | 1389 |
| 166 | Ga0307416_100344617 | 3300032002 | Bacteria | 1505 |
| 167 | Ga0307416_100567622 | 3300032002 | Bacteria | 1210 |
| 168 | Ga0307416_100920761 | 3300032002 | Bacteria | 975 |
| 169 | Ga0307510_10004655 | 3300033180 | Bacteria | 16184 |
| 170 | Ga0307510_10226179 | 3300033180 | Bacteria | 1378 |
| 171 | Ga0395899_0094628 | 3300037312 | Bacteria | 2161 |
| 172 | Ga0395900_0027847 | 3300037418 | Bacteria | 5789 |
| 173 | Ga0395900_0977296 | 3300037418 | Bacteria | 767 |
| 174 | Ga0395898_0017491 | 3300037466 | Bacteria | 7319 |
| 175 | Ga0395905_0005478 | 3300037471 | Bacteria | 12947 |
| 176 | Ga0395905_0228151 | 3300037471 | Bacteria | 1742 |
| 177 | Ga0395905_0421793 | 3300037471 | Bacteria | 1230 |
| 178 | Ga0395905_0682276 | 3300037471 | Bacteria | 929 |
| 179 | Ga0395901_0044161 | 3300038443 | Bacteria | 4622 |
| 180 | Ga0395901_0658745 | 3300038443 | Bacteria | 1049 |
| 181 | Ga0436361_0415932 | 3300039447 | Bacteria | 6019 |
| 182 | Ga0436361_0438505 | 3300039447 | Bacteria | 3917 |
| 183 | Ga0439436_0025568 | 3300041404 | Bacteria | 1734 |
| 184 | Ga0439461_0027238 | 3300041410 | Bacteria | 1171 |
| 185 | Ga0451791_0565996 | 3300041451 | Bacteria | 1585 |
| 186 | Ga0451791_1144200 | 3300041451 | Bacteria | 921 |
| 187 | Ga0451851_0133743 | 3300041507 | Bacteria | 1878 |
| 188 | Ga0439449_0001718 | 3300042007 | Bacteria | 8601 |
| 189 | Ga0439457_015124 | 3300042014 | Bacteria | 1724 |
| 190 | Ga0439462_0006909 | 3300042015 | Bacteria | 2832 |
| 191 | Ga0450890_010358 | 3300042127 | Bacteria | 1199 |
| 192 | Ga0450898_047390 | 3300042134 | Bacteria | 824 |
| 193 | Ga0451577_0000257 | 3300042876 | Bacteria | 104746 |
| 194 | Ga0451577_0384965 | 3300042876 | Bacteria | 1273 |
| 195 | Ga0451577_0401360 | 3300042876 | Bacteria | 1244 |
| 196 | Ga0451577_0746242 | 3300042876 | Bacteria | 886 |
| 197 | Ga0466969_0060823 | 3300044656 | Bacteria | 1835 |
| 198 | Ga0453683_0004158 | 3300044673 | Bacteria | 10362 |
| 199 | Ga0453683_0052865 | 3300044673 | Bacteria | 2542 |
| 200 | Ga0466966_0018890 | 3300044684 | Bacteria | 4541 |
| 201 | Ga0466961_0009834 | 3300044693 | Bacteria | 6089 |
| 202 | Ga0466963_0068632 | 3300044694 | Bacteria | 2381 |
| 203 | Ga0466964_0021411 | 3300044706 | Bacteria | 2500 |
| 204 | Ga0453684_0001024 | 3300044712 | Bacteria | 89721 |
| 205 | Ga0453684_0006580 | 3300044712 | Bacteria | 21987 |
| 206 | Ga0453684_0050817 | 3300044712 | Bacteria | 5446 |
| 207 | Ga0453684_0396747 | 3300044712 | Bacteria | 1546 |
| 208 | Ga0466971_0058325 | 3300044719 | Bacteria | 1742 |
| 209 | Ga0466970_0094987 | 3300044765 | Bacteria | 1620 |
| 210 | Ga0466970_0123615 | 3300044765 | Bacteria | 1418 |
| 211 | Ga0466960_0030576 | 3300044901 | Bacteria | 2479 |
| 212 | Ga0466959_0000159 | 3300045049 | Bacteria | 44154 |
| 213 | Ga0451576_0000798 | 3300045051 | Bacteria | 61660 |
| 214 | Ga0451576_0008491 | 3300045051 | Bacteria | 12052 |
| 215 | Ga0451576_0032924 | 3300045051 | Bacteria | 5512 |
| 216 | Ga0466967_0283155 | 3300045976 | Bacteria | 1591 |
| 217 | Ga0466967_0495353 | 3300045976 | Bacteria | 1198 |
| 218 | Ga0495650_0003635 | 3300046471 | Bacteria | 11087 |
| 219 | Ga0495610_0028781 | 3300046512 | Bacteria | 2934 |
| 220 | Ga0495620_0050764 | 3300046515 | Bacteria | 1768 |
| 221 | Ga0495632_0008036 | 3300046519 | Bacteria | 6546 |
| 222 | Ga0495632_0032105 | 3300046519 | Bacteria | 2708 |
| 223 | Ga0495597_0028401 | 3300046542 | Bacteria | 2560 |
| 224 | Ga0495633_0000678 | 3300046558 | Bacteria | 31374 |
| 225 | Ga0495625_0002261 | 3300046660 | Bacteria | 21166 |
| 226 | Ga0495625_0076105 | 3300046660 | Bacteria | 2347 |
| 227 | Ga0495649_0006247 | 3300046694 | Bacteria | 7426 |
| 228 | Ga0495687_000232 | 3300047443 | Bacteria | 77572 |
| 229 | Ga0495687_042654 | 3300047443 | Bacteria | 1980 |
| 230 | Ga0495615_0041873 | 3300048090 | Bacteria | 1146 |
| 231 | Ga0495626_0014255 | 3300048091 | Bacteria | 4105 |
| 232 | Ga0495626_0103475 | 3300048091 | Bacteria | 1239 |
| 233 | Ga0496104_0763675 | 3300048907 | Bacteria | 873 |
| 234 | Ga0496105_0503017 | 3300048908 | Bacteria | 951 |
| 235 | Ga0496109_0123902 | 3300048912 | Bacteria | 2409 |
| 236 | Ga0496109_0608150 | 3300048912 | Bacteria | 1029 |
| 237 | Ga0496109_0972780 | 3300048912 | Bacteria | 786 |
| 238 | Ga0496112_0193398 | 3300048915 | Bacteria | 1995 |
| 239 | Ga0496113_0042744 | 3300048916 | Bacteria | 3350 |
| 240 | Ga0496122_0111524 | 3300048925 | Bacteria | 1794 |
| 241 | Ga0496125_0115339 | 3300048928 | Bacteria | 1932 |
| 242 | Ga0496125_0154947 | 3300048928 | Bacteria | 1567 |
| 243 | Ga0501037_0119995 | 3300049573 | Bacteria | 1891 |
| 244 | Ga0501039_0696141 | 3300049575 | Bacteria | 795 |
| 245 | Ga0501067_0137863 | 3300049583 | Bacteria | 1358 |
| 246 | Ga0501198_000004 | 3300049649 | Bacteria | 175146 |
| 247 | Ga0501222_000011 | 3300049662 | Bacteria | 100553 |
| 248 | nmdc:mga03683_186021_c1 | 3300050489 | Bacteria | 949 |
| 249 | nmdc:mga03683_86845_c1 | 3300050489 | Bacteria | 1359 |
| 250 | nmdc:mga03683_95087_c1 | 3300050489 | Bacteria | 1304 |
| 251 | nmdc:mga00v17_244335_c1 | 3300050491 | Bacteria | 1164 |
| 252 | nmdc:mga0yw44_125770_c1 | 3300050492 | Bacteria | 1655 |
| 253 | nmdc:mga0k408_223995_c1 | 3300050493 | Bacteria | 1123 |
| 254 | nmdc:mga0k408_23204_c1 | 3300050493 | Bacteria | 3498 |
| 255 | nmdc:mga0k408_241053_c1 | 3300050493 | Bacteria | 1080 |
| 256 | nmdc:mga0k408_26635_c1 | 3300050493 | Bacteria | 3280 |
| 257 | nmdc:mga0k408_34931_c1 | 3300050493 | Bacteria | 2881 |
| 258 | nmdc:mga0k408_4164_c1 | 3300050493 | Bacteria | 7677 |
| 259 | nmdc:mga0k408_63931_c1 | 3300050493 | Bacteria | 2141 |
| 260 | nmdc:mga0k408_80553_c1 | 3300050493 | Bacteria | 1906 |
| 261 | nmdc:mga06z11_102049_c1 | 3300050494 | Bacteria | 1575 |
| 262 | nmdc:mga06z11_304885_c1 | 3300050494 | Bacteria | 947 |
| 263 | nmdc:mga04h51_55272_c1 | 3300050495 | Bacteria | 1344 |
| 264 | nmdc:mga07m45_131_c1 | 3300050496 | Bacteria | 29571 |
| 265 | nmdc:mga07m45_13263_c1 | 3300050496 | Bacteria | 4369 |
| 266 | nmdc:mga07m45_202882_c1 | 3300050496 | Bacteria | 1154 |
| 267 | nmdc:mga07m45_29300_c1 | 3300050496 | Bacteria | 3043 |
| 268 | nmdc:mga09592_150247_c1 | 3300050508 | Bacteria | 2009 |
| 269 | nmdc:mga0sz30_18098_c1 | 3300050516 | Bacteria | 2816 |
| 270 | Ga0500578_0000871 | 3300053086 | Bacteria | 34797 |
| 271 | Ga0500651_0032327 | 3300053093 | Bacteria | 3297 |
| 272 | Ga0500652_091523 | 3300053131 | Bacteria | 1270 |
| 273 | Ga0500568_0005479 | 3300053139 | Bacteria | 6550 |
| 274 | Ga0500637_0229203 | 3300053178 | Bacteria | 1047 |
| 275 | Ga0500645_001464 | 3300053730 | Bacteria | 11877 |
| 276 | Ga0500645_006041 | 3300053730 | Bacteria | 4369 |
| 277 | Ga0590075_007209 | 3300059424 | Bacteria | 2640 |
| 278 | Ga0466962_0056708 | 3300061719 | Bacteria | 1870 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0094628 | Ga0395899_0094628_1505_2137 | 206 |
| 2 | 3300037418 | Ga0395900_0977296 | Ga0395900_0977296_70_750 | 222 |
| 3 | 3300006195 | Ga0075366_10012195 | Ga0075366_100121955 | 227 |
| 4 | 3300006353 | Ga0075370_10000324 | Ga0075370_100003246 | 227 |
| 5 | 3300050493 | nmdc:mga0k408_63931_c1 | nmdc:mga0k408_63931_c1_757_1503 | 227 |
| 6 | 3300050496 | nmdc:mga07m45_131_c1 | nmdc:mga07m45_131_c1_4002_4748 | 227 |
| 7 | 3300032002 | Ga0307416_100344617 | Ga0307416_1003446172 | 230 |
| 8 | 3300006178 | Ga0075367_10067923 | Ga0075367_100679232 | 231 |
| 9 | 3300025935 | Ga0207709_10024197 | Ga0207709_100241972 | 231 |
| 10 | 3300031507 | Ga0307509_10207043 | Ga0307509_102070432 | 231 |
| 11 | iso_pu_bacteria | 2585428062 | 2587757365 | 231 |
| 12 | iso_pu_bacteria | 2932422444 | 2932423570 | 231 |
| 13 | 3300005844 | Ga0068862_100369640 | Ga0068862_1003696402 | 232 |
| 14 | 3300046471 | Ga0495650_0003635 | Ga0495650_0003635_2414_3112 | 232 |
| 15 | iso_pu_bacteria | 2721755523 | 2722884517 | 232 |
| 16 | iso_pu_bacteria | 2839138175 | 2839143113 | 232 |
| 17 | 3300025907 | Ga0207645_10127803 | Ga0207645_101278032 | 233 |
| 18 | iso_pu_bacteria | 2842718218 | 2842721083 | 233 |
| 19 | iso_pu_bacteria | 2894023352 | 2894026594 | 233 |
| 20 | iso_pu_bacteria | 2919704043 | 2919704697 | 233 |
| 21 | iso_pu_bacteria | 2974320154 | 2974323993 | 233 |
| 22 | 3300005338 | Ga0068868_100315078 | Ga0068868_1003150782 | 234 |
| 23 | 3300005459 | Ga0068867_100404928 | Ga0068867_1004049282 | 234 |
| 24 | 3300025940 | Ga0207691_10172117 | Ga0207691_101721172 | 234 |
| 25 | 3300026023 | Ga0207677_10303555 | Ga0207677_103035552 | 234 |
| 26 | 3300031456 | Ga0307513_10178547 | Ga0307513_101785472 | 234 |
| 27 | 3300053086 | Ga0500578_0000871 | Ga0500578_0000871_23666_24370 | 234 |
| 28 | 3300002773 | JGI25152J39213_1002545 | JGI25152J39213_10025453 | 235 |
| 29 | 3300003215 | JGI25153J46596_10006072 | JGI25153J46596_100060727 | 235 |
| 30 | 3300003771 | Ga0055526_1001166 | Ga0055526_100116611 | 235 |
| 31 | 3300005548 | Ga0070665_100038047 | Ga0070665_1000380477 | 235 |
| 32 | 3300005841 | Ga0068863_100024097 | Ga0068863_1000240976 | 235 |
| 33 | 3300005843 | Ga0068860_100049961 | Ga0068860_1000499612 | 235 |
| 34 | 3300006177 | Ga0075362_10110867 | Ga0075362_101108672 | 235 |
| 35 | 3300009098 | Ga0105245_10066000 | Ga0105245_100660002 | 235 |
| 36 | 3300014969 | Ga0157376_10215660 | Ga0157376_102156602 | 235 |
| 37 | 3300021361 | Ga0213872_10022420 | Ga0213872_100224202 | 235 |
| 38 | 3300025245 | Ga0207425_1000204 | Ga0207425_100020442 | 235 |
| 39 | 3300025258 | Ga0209129_1000025 | Ga0209129_1000025279 | 235 |
| 40 | 3300025295 | Ga0209564_1000039 | Ga0209564_1000039279 | 235 |
| 41 | 3300025297 | Ga0209758_1000163 | Ga0209758_100016339 | 235 |
| 42 | 3300025303 | Ga0209051_1041592 | Ga0209051_10415921 | 235 |
| 43 | 3300026121 | Ga0207683_10770329 | Ga0207683_107703291 | 235 |
| 44 | 3300027395 | Ga0209996_1014330 | Ga0209996_10143302 | 235 |
| 45 | 3300027526 | Ga0209968_1000656 | Ga0209968_10006563 | 235 |
| 46 | 3300027695 | Ga0209966_1000027 | Ga0209966_100002768 | 235 |
| 47 | 3300028381 | Ga0268264_10058477 | Ga0268264_100584772 | 235 |
| 48 | 3300028786 | Ga0307517_10137665 | Ga0307517_101376652 | 235 |
| 49 | 3300028794 | Ga0307515_10015986 | Ga0307515_100159863 | 235 |
| 50 | 3300031507 | Ga0307509_10268582 | Ga0307509_102685822 | 235 |
| 51 | 3300031730 | Ga0307516_10001377 | Ga0307516_1000137722 | 235 |
| 52 | 3300031730 | Ga0307516_10010534 | Ga0307516_1001053410 | 235 |
| 53 | 3300033180 | Ga0307510_10004655 | Ga0307510_100046558 | 235 |
| 54 | 3300039447 | Ga0436361_0438505 | Ga0436361_0438505_997_1704 | 235 |
| 55 | 3300041451 | Ga0451791_1144200 | Ga0451791_1144200_16_726 | 235 |
| 56 | 3300041507 | Ga0451851_0133743 | Ga0451851_0133743_167_877 | 235 |
| 57 | 3300042134 | Ga0450898_047390 | Ga0450898_047390_97_807 | 235 |
| 58 | 3300044656 | Ga0466969_0060823 | Ga0466969_0060823_389_1099 | 235 |
| 59 | 3300044684 | Ga0466966_0018890 | Ga0466966_0018890_3430_4140 | 235 |
| 60 | 3300044693 | Ga0466961_0009834 | Ga0466961_0009834_4598_5308 | 235 |
| 61 | 3300044694 | Ga0466963_0068632 | Ga0466963_0068632_1063_1773 | 235 |
| 62 | 3300044706 | Ga0466964_0021411 | Ga0466964_0021411_1154_1864 | 235 |
| 63 | 3300044719 | Ga0466971_0058325 | Ga0466971_0058325_55_765 | 235 |
| 64 | 3300044765 | Ga0466970_0094987 | Ga0466970_0094987_741_1451 | 235 |
| 65 | 3300044901 | Ga0466960_0030576 | Ga0466960_0030576_545_1252 | 235 |
| 66 | 3300045049 | Ga0466959_0000159 | Ga0466959_0000159_22217_22927 | 235 |
| 67 | 3300045976 | Ga0466967_0495353 | Ga0466967_0495353_183_893 | 235 |
| 68 | 3300046512 | Ga0495610_0028781 | Ga0495610_0028781_853_1563 | 235 |
| 69 | 3300046519 | Ga0495632_0008036 | Ga0495632_0008036_2328_3038 | 235 |
| 70 | 3300046660 | Ga0495625_0002261 | Ga0495625_0002261_7708_8418 | 235 |
| 71 | 3300048912 | Ga0496109_0123902 | Ga0496109_0123902_1292_1999 | 235 |
| 72 | 3300048916 | Ga0496113_0042744 | Ga0496113_0042744_2626_3336 | 235 |
| 73 | 3300050493 | nmdc:mga0k408_34931_c1 | nmdc:mga0k408_34931_c1_937_1647 | 235 |
| 74 | 3300050496 | nmdc:mga07m45_202882_c1 | nmdc:mga07m45_202882_c1_49_759 | 235 |
| 75 | 3300053131 | Ga0500652_091523 | Ga0500652_091523_390_1097 | 235 |
| 76 | 3300053178 | Ga0500637_0229203 | Ga0500637_0229203_141_848 | 235 |
| 77 | 3300061719 | Ga0466962_0056708 | Ga0466962_0056708_978_1688 | 235 |
| 78 | iso_pu_bacteria | 2643221660 | 2644339962 | 235 |
| 79 | 3300002705 | JGI25156J39149_1000025 | JGI25156J39149_100002528 | 236 |
| 80 | 3300002738 | JGI25154J39366_1000045 | JGI25154J39366_100004528 | 236 |
| 81 | 3300002741 | JGI25157J39369_1000034 | JGI25157J39369_100003428 | 236 |
| 82 | 3300002774 | JGI25150J39212_1012067 | JGI25150J39212_10120672 | 236 |
| 83 | 3300003792 | Ga0055540_1005721 | Ga0055540_10057214 | 236 |
| 84 | 3300003794 | Ga0055531_10000584 | Ga0055531_1000058425 | 236 |
| 85 | 3300005289 | Ga0065704_10104615 | Ga0065704_101046151 | 236 |
| 86 | 3300005289 | Ga0065704_10117649 | Ga0065704_101176491 | 236 |
| 87 | 3300005295 | Ga0065707_10265848 | Ga0065707_102658482 | 236 |
| 88 | 3300005327 | Ga0070658_10240920 | Ga0070658_102409202 | 236 |
| 89 | 3300005327 | Ga0070658_10404580 | Ga0070658_104045802 | 236 |
| 90 | 3300005328 | Ga0070676_10051058 | Ga0070676_100510582 | 236 |
| 91 | 3300005328 | Ga0070676_10066063 | Ga0070676_100660632 | 236 |
| 92 | 3300005331 | Ga0070670_100025635 | Ga0070670_1000256353 | 236 |
| 93 | 3300005331 | Ga0070670_100064014 | Ga0070670_1000640142 | 236 |
| 94 | 3300005331 | Ga0070670_100146556 | Ga0070670_1001465562 | 236 |
| 95 | 3300005334 | Ga0068869_100083174 | Ga0068869_1000831743 | 236 |
| 96 | 3300005354 | Ga0070675_100086887 | Ga0070675_1000868872 | 236 |
| 97 | 3300005354 | Ga0070675_100339158 | Ga0070675_1003391582 | 236 |
| 98 | 3300005355 | Ga0070671_100002733 | Ga0070671_1000027332 | 236 |
| 99 | 3300005355 | Ga0070671_100219902 | Ga0070671_1002199022 | 236 |
| 100 | 3300005364 | Ga0070673_100191785 | Ga0070673_1001917852 | 236 |
| 101 | 3300005364 | Ga0070673_100193843 | Ga0070673_1001938432 | 236 |
| 102 | 3300005366 | Ga0070659_100099184 | Ga0070659_1000991842 | 236 |
| 103 | 3300005455 | Ga0070663_100121720 | Ga0070663_1001217202 | 236 |
| 104 | 3300005456 | Ga0070678_100064228 | Ga0070678_1000642283 | 236 |
| 105 | 3300005457 | Ga0070662_100106068 | Ga0070662_1001060682 | 236 |
| 106 | 3300005467 | Ga0070706_100002204 | Ga0070706_1000022045 | 236 |
| 107 | 3300005468 | Ga0070707_100117889 | Ga0070707_1001178892 | 236 |
| 108 | 3300005539 | Ga0068853_100322631 | Ga0068853_1003226312 | 236 |
| 109 | 3300005564 | Ga0070664_100052913 | Ga0070664_1000529132 | 236 |
| 110 | 3300005577 | Ga0068857_100191356 | Ga0068857_1001913562 | 236 |
| 111 | 3300005618 | Ga0068864_100128160 | Ga0068864_1001281602 | 236 |
| 112 | 3300005841 | Ga0068863_100024012 | Ga0068863_1000240122 | 236 |
| 113 | 3300005844 | Ga0068862_100021694 | Ga0068862_1000216943 | 236 |
| 114 | 3300005937 | Ga0081455_10197079 | Ga0081455_101970792 | 236 |
| 115 | 3300006042 | Ga0075368_10011181 | Ga0075368_100111812 | 236 |
| 116 | 3300006042 | Ga0075368_10105051 | Ga0075368_101050512 | 236 |
| 117 | 3300006042 | Ga0075368_10181726 | Ga0075368_101817262 | 236 |
| 118 | 3300006048 | Ga0075363_100012826 | Ga0075363_1000128262 | 236 |
| 119 | 3300006051 | Ga0075364_10021530 | Ga0075364_100215301 | 236 |
| 120 | 3300006058 | Ga0075432_10002628 | Ga0075432_100026282 | 236 |
| 121 | 3300006177 | Ga0075362_10115018 | Ga0075362_101150182 | 236 |
| 122 | 3300006195 | Ga0075366_10001616 | Ga0075366_100016167 | 236 |
| 123 | 3300006195 | Ga0075366_10001785 | Ga0075366_100017853 | 236 |
| 124 | 3300006195 | Ga0075366_10136281 | Ga0075366_101362812 | 236 |
| 125 | 3300006237 | Ga0097621_100055093 | Ga0097621_1000550933 | 236 |
| 126 | 3300006353 | Ga0075370_10004923 | Ga0075370_100049234 | 236 |
| 127 | 3300006353 | Ga0075370_10006283 | Ga0075370_100062837 | 236 |
| 128 | 3300006358 | Ga0068871_100413971 | Ga0068871_1004139712 | 236 |
| 129 | 3300006846 | Ga0075430_100162185 | Ga0075430_1001621852 | 236 |
| 130 | 3300006880 | Ga0075429_100209533 | Ga0075429_1002095332 | 236 |
| 131 | 3300006946 | Ga0079104_1000004 | Ga0079104_100000442 | 236 |
| 132 | 3300009036 | Ga0105244_10138317 | Ga0105244_101383172 | 236 |
| 133 | 3300009092 | Ga0105250_10007024 | Ga0105250_100070242 | 236 |
| 134 | 3300009093 | Ga0105240_10229433 | Ga0105240_102294332 | 236 |
| 135 | 3300009148 | Ga0105243_10169141 | Ga0105243_101691413 | 236 |
| 136 | 3300009176 | Ga0105242_10001169 | Ga0105242_100011694 | 236 |
| 137 | 3300009177 | Ga0105248_10053028 | Ga0105248_100530284 | 236 |
| 138 | 3300009177 | Ga0105248_10632841 | Ga0105248_106328412 | 236 |
| 139 | 3300009177 | Ga0105248_11116613 | Ga0105248_111166131 | 236 |
| 140 | 3300009545 | Ga0105237_10001237 | Ga0105237_1000123719 | 236 |
| 141 | 3300009545 | Ga0105237_10027029 | Ga0105237_100270297 | 236 |
| 142 | 3300009553 | Ga0105249_10346979 | Ga0105249_103469792 | 236 |
| 143 | 3300009553 | Ga0105249_10456293 | Ga0105249_104562931 | 236 |
| 144 | 3300013296 | Ga0157374_10206193 | Ga0157374_102061932 | 236 |
| 145 | 3300013308 | Ga0157375_10069159 | Ga0157375_100691594 | 236 |
| 146 | 3300017792 | Ga0163161_10044033 | Ga0163161_100440333 | 236 |
| 147 | 3300017792 | Ga0163161_10186512 | Ga0163161_101865122 | 236 |
| 148 | 3300021361 | Ga0213872_10043879 | Ga0213872_100438793 | 236 |
| 149 | 3300025206 | Ga0209435_100001 | Ga0209435_100001953 | 236 |
| 150 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011322 | 236 |
| 151 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003953 | 236 |
| 152 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001953 | 236 |
| 153 | 3300025303 | Ga0209051_1000110 | Ga0209051_100011096 | 236 |
| 154 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012905 | 236 |
| 155 | 3300025304 | Ga0209257_1000045 | Ga0209257_1000045311 | 236 |
| 156 | 3300025893 | Ga0207682_10012282 | Ga0207682_100122822 | 236 |
| 157 | 3300025901 | Ga0207688_10003462 | Ga0207688_100034622 | 236 |
| 158 | 3300025901 | Ga0207688_10054564 | Ga0207688_100545642 | 236 |
| 159 | 3300025907 | Ga0207645_10072239 | Ga0207645_100722392 | 236 |
| 160 | 3300025907 | Ga0207645_10131283 | Ga0207645_101312832 | 236 |
| 161 | 3300025910 | Ga0207684_10011063 | Ga0207684_100110634 | 236 |
| 162 | 3300025914 | Ga0207671_10002731 | Ga0207671_100027313 | 236 |
| 163 | 3300025922 | Ga0207646_10108096 | Ga0207646_101080963 | 236 |
| 164 | 3300025925 | Ga0207650_10012971 | Ga0207650_100129713 | 236 |
| 165 | 3300025925 | Ga0207650_10130043 | Ga0207650_101300432 | 236 |
| 166 | 3300025925 | Ga0207650_10213986 | Ga0207650_102139862 | 236 |
| 167 | 3300025926 | Ga0207659_10013212 | Ga0207659_100132122 | 236 |
| 168 | 3300025926 | Ga0207659_10099658 | Ga0207659_100996582 | 236 |
| 169 | 3300025926 | Ga0207659_10156860 | Ga0207659_101568602 | 236 |
| 170 | 3300025931 | Ga0207644_10030860 | Ga0207644_100308602 | 236 |
| 171 | 3300025931 | Ga0207644_10542219 | Ga0207644_105422192 | 236 |
| 172 | 3300025932 | Ga0207690_10116659 | Ga0207690_101166592 | 236 |
| 173 | 3300025933 | Ga0207706_10088619 | Ga0207706_100886193 | 236 |
| 174 | 3300025933 | Ga0207706_10237494 | Ga0207706_102374942 | 236 |
| 175 | 3300025934 | Ga0207686_10004358 | Ga0207686_100043583 | 236 |
| 176 | 3300025935 | Ga0207709_10000019 | Ga0207709_10000019106 | 236 |
| 177 | 3300025935 | Ga0207709_10222506 | Ga0207709_102225062 | 236 |
| 178 | 3300025938 | Ga0207704_10297464 | Ga0207704_102974642 | 236 |
| 179 | 3300025941 | Ga0207711_10003157 | Ga0207711_100031572 | 236 |
| 180 | 3300025941 | Ga0207711_10056660 | Ga0207711_100566601 | 236 |
| 181 | 3300025941 | Ga0207711_10682579 | Ga0207711_106825791 | 236 |
| 182 | 3300025960 | Ga0207651_10128065 | Ga0207651_101280652 | 236 |
| 183 | 3300025960 | Ga0207651_10164593 | Ga0207651_101645932 | 236 |
| 184 | 3300025960 | Ga0207651_10497317 | Ga0207651_104973171 | 236 |
| 185 | 3300025961 | Ga0207712_10259660 | Ga0207712_102596602 | 236 |
| 186 | 3300026088 | Ga0207641_10201460 | Ga0207641_102014602 | 236 |
| 187 | 3300026089 | Ga0207648_10326677 | Ga0207648_103266772 | 236 |
| 188 | 3300026116 | Ga0207674_10186364 | Ga0207674_101863642 | 236 |
| 189 | 3300026121 | Ga0207683_10080608 | Ga0207683_100806081 | 236 |
| 190 | 3300026121 | Ga0207683_10087200 | Ga0207683_100872003 | 236 |
| 191 | 3300026142 | Ga0207698_10998972 | Ga0207698_109989722 | 236 |
| 192 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005243 | 236 |
| 193 | 3300027682 | Ga0209971_1004459 | Ga0209971_10044594 | 236 |
| 194 | 3300028786 | Ga0307517_10244883 | Ga0307517_102448832 | 236 |
| 195 | 3300028794 | Ga0307515_10000022 | Ga0307515_10000022307 | 236 |
| 196 | 3300028794 | Ga0307515_10169972 | Ga0307515_101699722 | 236 |
| 197 | 3300030522 | Ga0307512_10176299 | Ga0307512_101762992 | 236 |
| 198 | 3300031238 | Ga0265332_10000003 | Ga0265332_10000003384 | 236 |
| 199 | 3300031456 | Ga0307513_10000272 | Ga0307513_1000027219 | 236 |
| 200 | 3300031456 | Ga0307513_10000610 | Ga0307513_1000061039 | 236 |
| 201 | 3300031456 | Ga0307513_10025203 | Ga0307513_100252033 | 236 |
| 202 | 3300031456 | Ga0307513_10077346 | Ga0307513_100773465 | 236 |
| 203 | 3300031548 | Ga0307408_100072390 | Ga0307408_1000723902 | 236 |
| 204 | 3300031649 | Ga0307514_10000780 | Ga0307514_1000078024 | 236 |
| 205 | 3300031730 | Ga0307516_10003661 | Ga0307516_1000366117 | 236 |
| 206 | 3300031730 | Ga0307516_10269585 | Ga0307516_102695851 | 236 |
| 207 | 3300032002 | Ga0307416_100567622 | Ga0307416_1005676222 | 236 |
| 208 | 3300032002 | Ga0307416_100920761 | Ga0307416_1009207612 | 236 |
| 209 | 3300033180 | Ga0307510_10226179 | Ga0307510_102261792 | 236 |
| 210 | 3300037418 | Ga0395900_0027847 | Ga0395900_0027847_646_1371 | 236 |
| 211 | 3300037466 | Ga0395898_0017491 | Ga0395898_0017491_3942_4664 | 236 |
| 212 | 3300037471 | Ga0395905_0005478 | Ga0395905_0005478_3262_3981 | 236 |
| 213 | 3300037471 | Ga0395905_0228151 | Ga0395905_0228151_761_1483 | 236 |
| 214 | 3300037471 | Ga0395905_0421793 | Ga0395905_0421793_41_766 | 236 |
| 215 | 3300037471 | Ga0395905_0682276 | Ga0395905_0682276_55_777 | 236 |
| 216 | 3300038443 | Ga0395901_0044161 | Ga0395901_0044161_3565_4287 | 236 |
| 217 | 3300038443 | Ga0395901_0658745 | Ga0395901_0658745_211_936 | 236 |
| 218 | 3300039447 | Ga0436361_0415932 | Ga0436361_0415932_280_990 | 236 |
| 219 | 3300041404 | Ga0439436_0025568 | Ga0439436_0025568_289_1056 | 236 |
| 220 | 3300041410 | Ga0439461_0027238 | Ga0439461_0027238_174_896 | 236 |
| 221 | 3300041451 | Ga0451791_0565996 | Ga0451791_0565996_427_1137 | 236 |
| 222 | 3300042007 | Ga0439449_0001718 | Ga0439449_0001718_3693_4460 | 236 |
| 223 | 3300042014 | Ga0439457_015124 | Ga0439457_015124_436_1161 | 236 |
| 224 | 3300042015 | Ga0439462_0006909 | Ga0439462_0006909_1117_1884 | 236 |
| 225 | 3300042127 | Ga0450890_010358 | Ga0450890_010358_366_1097 | 236 |
| 226 | 3300042876 | Ga0451577_0000257 | Ga0451577_0000257_73496_74248 | 236 |
| 227 | 3300042876 | Ga0451577_0384965 | Ga0451577_0384965_154_867 | 236 |
| 228 | 3300042876 | Ga0451577_0401360 | Ga0451577_0401360_491_1219 | 236 |
| 229 | 3300042876 | Ga0451577_0746242 | Ga0451577_0746242_24_740 | 236 |
| 230 | 3300044673 | Ga0453683_0004158 | Ga0453683_0004158_202_924 | 236 |
| 231 | 3300044673 | Ga0453683_0052865 | Ga0453683_0052865_55_765 | 236 |
| 232 | 3300044712 | Ga0453684_0001024 | Ga0453684_0001024_30479_31231 | 236 |
| 233 | 3300044712 | Ga0453684_0006580 | Ga0453684_0006580_2541_3254 | 236 |
| 234 | 3300044712 | Ga0453684_0050817 | Ga0453684_0050817_227_937 | 236 |
| 235 | 3300044712 | Ga0453684_0396747 | Ga0453684_0396747_487_1203 | 236 |
| 236 | 3300044765 | Ga0466970_0123615 | Ga0466970_0123615_52_765 | 236 |
| 237 | 3300045051 | Ga0451576_0000798 | Ga0451576_0000798_56913_57653 | 236 |
| 238 | 3300045051 | Ga0451576_0008491 | Ga0451576_0008491_1015_1725 | 236 |
| 239 | 3300045051 | Ga0451576_0032924 | Ga0451576_0032924_801_1523 | 236 |
| 240 | 3300045976 | Ga0466967_0283155 | Ga0466967_0283155_520_1242 | 236 |
| 241 | 3300046515 | Ga0495620_0050764 | Ga0495620_0050764_244_990 | 236 |
| 242 | 3300046519 | Ga0495632_0032105 | Ga0495632_0032105_646_1392 | 236 |
| 243 | 3300046542 | Ga0495597_0028401 | Ga0495597_0028401_33_776 | 236 |
| 244 | 3300046558 | Ga0495633_0000678 | Ga0495633_0000678_29895_30608 | 236 |
| 245 | 3300046660 | Ga0495625_0076105 | Ga0495625_0076105_155_901 | 236 |
| 246 | 3300046694 | Ga0495649_0006247 | Ga0495649_0006247_5502_6248 | 236 |
| 247 | 3300047443 | Ga0495687_000232 | Ga0495687_000232_39626_40369 | 236 |
| 248 | 3300047443 | Ga0495687_042654 | Ga0495687_042654_983_1729 | 236 |
| 249 | 3300048090 | Ga0495615_0041873 | Ga0495615_0041873_66_791 | 236 |
| 250 | 3300048091 | Ga0495626_0014255 | Ga0495626_0014255_2975_3721 | 236 |
| 251 | 3300048091 | Ga0495626_0103475 | Ga0495626_0103475_261_1004 | 236 |
| 252 | 3300048907 | Ga0496104_0763675 | Ga0496104_0763675_117_851 | 236 |
| 253 | 3300048908 | Ga0496105_0503017 | Ga0496105_0503017_136_870 | 236 |
| 254 | 3300048912 | Ga0496109_0608150 | Ga0496109_0608150_263_985 | 236 |
| 255 | 3300048912 | Ga0496109_0972780 | Ga0496109_0972780_28_762 | 236 |
| 256 | 3300048915 | Ga0496112_0193398 | Ga0496112_0193398_1040_1774 | 236 |
| 257 | 3300048925 | Ga0496122_0111524 | Ga0496122_0111524_539_1252 | 236 |
| 258 | 3300048928 | Ga0496125_0115339 | Ga0496125_0115339_43_756 | 236 |
| 259 | 3300048928 | Ga0496125_0154947 | Ga0496125_0154947_178_897 | 236 |
| 260 | 3300049573 | Ga0501037_0119995 | Ga0501037_0119995_267_983 | 236 |
| 261 | 3300049575 | Ga0501039_0696141 | Ga0501039_0696141_54_776 | 236 |
| 262 | 3300049583 | Ga0501067_0137863 | Ga0501067_0137863_345_1064 | 236 |
| 263 | 3300049649 | Ga0501198_000004 | Ga0501198_000004_130250_130963 | 236 |
| 264 | 3300049662 | Ga0501222_000011 | Ga0501222_000011_55475_56188 | 236 |
| 265 | 3300050489 | nmdc:mga03683_186021_c1 | nmdc:mga03683_186021_c1_87_815 | 236 |
| 266 | 3300050489 | nmdc:mga03683_86845_c1 | nmdc:mga03683_86845_c1_309_1076 | 236 |
| 267 | 3300050489 | nmdc:mga03683_95087_c1 | nmdc:mga03683_95087_c1_236_976 | 236 |
| 268 | 3300050491 | nmdc:mga00v17_244335_c1 | nmdc:mga00v17_244335_c1_254_1021 | 236 |
| 269 | 3300050492 | nmdc:mga0yw44_125770_c1 | nmdc:mga0yw44_125770_c1_808_1548 | 236 |
| 270 | 3300050493 | nmdc:mga0k408_223995_c1 | nmdc:mga0k408_223995_c1_322_1053 | 236 |
| 271 | 3300050493 | nmdc:mga0k408_23204_c1 | nmdc:mga0k408_23204_c1_701_1432 | 236 |
| 272 | 3300050493 | nmdc:mga0k408_241053_c1 | nmdc:mga0k408_241053_c1_132_899 | 236 |
| 273 | 3300050493 | nmdc:mga0k408_26635_c1 | nmdc:mga0k408_26635_c1_2075_2815 | 236 |
| 274 | 3300050493 | nmdc:mga0k408_4164_c1 | nmdc:mga0k408_4164_c1_1127_1840 | 236 |
| 275 | 3300050493 | nmdc:mga0k408_80553_c1 | nmdc:mga0k408_80553_c1_984_1730 | 236 |
| 276 | 3300050494 | nmdc:mga06z11_102049_c1 | nmdc:mga06z11_102049_c1_689_1420 | 236 |
| 277 | 3300050494 | nmdc:mga06z11_304885_c1 | nmdc:mga06z11_304885_c1_87_815 | 236 |
| 278 | 3300050495 | nmdc:mga04h51_55272_c1 | nmdc:mga04h51_55272_c1_458_1189 | 236 |
| 279 | 3300050496 | nmdc:mga07m45_13263_c1 | nmdc:mga07m45_13263_c1_994_1725 | 236 |
| 280 | 3300050496 | nmdc:mga07m45_29300_c1 | nmdc:mga07m45_29300_c1_185_928 | 236 |
| 281 | 3300050508 | nmdc:mga09592_150247_c1 | nmdc:mga09592_150247_c1_589_1311 | 236 |
| 282 | 3300050516 | nmdc:mga0sz30_18098_c1 | nmdc:mga0sz30_18098_c1_878_1618 | 236 |
| 283 | 3300053093 | Ga0500651_0032327 | Ga0500651_0032327_1406_2116 | 236 |
| 284 | 3300053139 | Ga0500568_0005479 | Ga0500568_0005479_876_1622 | 236 |
| 285 | 3300053730 | Ga0500645_001464 | Ga0500645_001464_1629_2339 | 236 |
| 286 | 3300053730 | Ga0500645_006041 | Ga0500645_006041_1863_2573 | 236 |
| 287 | 3300059424 | Ga0590075_007209 | Ga0590075_007209_1520_2245 | 236 |
| 288 | iso_pu_bacteria | 2939631187 | 2939634840 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m1y-assembly2.cif.gz_C | crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori | 0.9581 | 25 | 236 |
| 3m1y-assembly1.cif.gz_B | crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori | 0.9559 | 25 | 235 |
| 1l7o-assembly3.cif.gz_A | crystal structure of phosphoserine phosphatase in apo form | 0.9554 | 24 | 236 |
| 3m1y-assembly2.cif.gz_D | crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori | 0.9516 | 24 | 231 |
| 4eze-assembly2.cif.gz_B | crystal structure of had family hydrolase t0658 from salmonella enterica subsp. enterica serovar typhi (target efi-501419) | 0.947 | 17 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGB0_183_315_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9648 | 100 | 235 | 3.40.50.1000 |
| af_O74382_8_284_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9536 | 17 | 236 | 3.40.50.1000 |
| af_P0AGB0_183_315_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9508 | 100 | 235 | 3.40.50.1000 |
| 4ezeB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.947 | 17 | 236 | 3.40.50.1000 |
| 3m1yC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9429 | 99 | 236 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353Y946-F1-model_v4 | Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) | 0.9959 | 76 | 236 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
| AF-A0A4V1U426-F1-model_v4 | deleted | 0.9939 | 27 | 234 |
|
| AF-B7WXM4-F1-model_v4 | Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) | 0.9929 | 2 | 236 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
| AF-A0A2M8X4U6-F1-model_v4 | Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) | 0.9926 | 3 | 236 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
| AF-A0A315EFR7-F1-model_v4 | Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) | 0.9925 | 2 | 236 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar