F388410

General Info

Members Datasets Scaffolds Average Seq Length
288 192 278 240

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100083174|Ga0068869_1000831743
Length 255
Sequence MTPSPSRAAPGCAPGLSVRGFTPPLRLADFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEIADYKESLRQRVALLKGVPETALHGVYNERLKLNPGADDLVRACQAAGLKTLLVSGGFTFFTDRIRERLCLDFTRSNVLEIVDGALTGRLVDQPWGDICDGAEKRKMLLETCAQLGIEPAQAIAVGDGANDLPMMGEAGLSVAYHAKPAVRDQAMVSITSGGLDRVLEVLEFPPTGAAAQLRSG

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221660 Methylibium sp. Root1272 Isolate Unclassified
3 2721755523 Delftia sp. HK171 Isolate Unclassified
4 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
5 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
6 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
7 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
8 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
9 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
10 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
108 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
175 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 1.04
Rhizoplane 3.12
Rhizosphere 63.54
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000025 3300002705 Bacteria 136287
2 JGI25154J39366_1000045 3300002738 Bacteria 136302
3 JGI25157J39369_1000034 3300002741 Bacteria 136301
4 JGI25152J39213_1002545 3300002773 Bacteria 6867
5 JGI25150J39212_1012067 3300002774 Bacteria 1544
6 JGI25153J46596_10006072 3300003215 Bacteria 6204
7 Ga0055526_1001166 3300003771 Bacteria 19062
8 Ga0055540_1005721 3300003792 Bacteria 5133
9 Ga0055531_10000584 3300003794 Bacteria 31840
10 Ga0065704_10104615 3300005289 Bacteria 2135
11 Ga0065704_10117649 3300005289 Bacteria 1830
12 Ga0065707_10265848 3300005295 Bacteria 1085
13 Ga0070658_10240920 3300005327 Bacteria 1533
14 Ga0070658_10404580 3300005327 Bacteria 1173
15 Ga0070676_10051058 3300005328 Bacteria 2427
16 Ga0070676_10066063 3300005328 Bacteria 2160
17 Ga0070670_100025635 3300005331 Bacteria 5072
18 Ga0070670_100064014 3300005331 Bacteria 3155
19 Ga0070670_100146556 3300005331 Bacteria 2042
20 Ga0068869_100083174 3300005334 Bacteria 2393
21 Ga0068868_100315078 3300005338 Bacteria 1332
22 Ga0070675_100086887 3300005354 Bacteria 2614
23 Ga0070675_100339158 3300005354 Bacteria 1331
24 Ga0070671_100002733 3300005355 Bacteria 13699
25 Ga0070671_100219902 3300005355 Bacteria 1611
26 Ga0070673_100191785 3300005364 Bacteria 1755
27 Ga0070673_100193843 3300005364 Bacteria 1747
28 Ga0070659_100099184 3300005366 Bacteria 2343
29 Ga0070663_100121720 3300005455 Bacteria 1972
30 Ga0070678_100064228 3300005456 Bacteria 2719
31 Ga0070662_100106068 3300005457 Bacteria 2134
32 Ga0068867_100404928 3300005459 Bacteria 1152
33 Ga0070706_100002204 3300005467 Bacteria 19824
34 Ga0070707_100117889 3300005468 Bacteria 2577
35 Ga0068853_100322631 3300005539 Bacteria 1432
36 Ga0070665_100038047 3300005548 Bacteria 4836
37 Ga0070664_100052913 3300005564 Bacteria 3440
38 Ga0068857_100191356 3300005577 Bacteria 1863
39 Ga0068864_100128160 3300005618 Bacteria 2276
40 Ga0068863_100024012 3300005841 Bacteria 5819
41 Ga0068863_100024097 3300005841 Bacteria 5806
42 Ga0068860_100049961 3300005843 Bacteria 3983
43 Ga0068862_100021694 3300005844 Bacteria 5371
44 Ga0068862_100369640 3300005844 Bacteria 1334
45 Ga0081455_10197079 3300005937 Bacteria 1511
46 Ga0075368_10011181 3300006042 Bacteria 3261
47 Ga0075368_10105051 3300006042 Bacteria 1162
48 Ga0075368_10181726 3300006042 Bacteria 887
49 Ga0075363_100012826 3300006048 Bacteria 4046
50 Ga0075364_10021530 3300006051 Bacteria 4065
51 Ga0075432_10002628 3300006058 Bacteria 6004
52 Ga0075362_10110867 3300006177 Bacteria 1291
53 Ga0075362_10115018 3300006177 Bacteria 1269
54 Ga0075367_10067923 3300006178 Bacteria 2137
55 Ga0075366_10001616 3300006195 Bacteria 11290
56 Ga0075366_10001785 3300006195 Bacteria 10865
57 Ga0075366_10012195 3300006195 Bacteria 4871
58 Ga0075366_10136281 3300006195 Bacteria 1482
59 Ga0097621_100055093 3300006237 Bacteria 3246
60 Ga0075370_10000324 3300006353 Bacteria 17247
61 Ga0075370_10004923 3300006353 Bacteria 6560
62 Ga0075370_10006283 3300006353 Bacteria 5964
63 Ga0068871_100413971 3300006358 Bacteria 1202
64 Ga0075430_100162185 3300006846 Bacteria 1861
65 Ga0075429_100209533 3300006880 Bacteria 1708
66 Ga0079104_1000004 3300006946 Bacteria 444549
67 Ga0105244_10138317 3300009036 Bacteria 1173
68 Ga0105250_10007024 3300009092 Bacteria 4862
69 Ga0105240_10229433 3300009093 Bacteria 2159
70 Ga0105245_10066000 3300009098 Bacteria 3274
71 Ga0105243_10169141 3300009148 Bacteria 1891
72 Ga0105242_10001169 3300009176 Bacteria 20656
73 Ga0105248_10053028 3300009177 Bacteria 4550
74 Ga0105248_10632841 3300009177 Bacteria 1207
75 Ga0105248_11116613 3300009177 Bacteria 891
76 Ga0105237_10001237 3300009545 Bacteria 34072
77 Ga0105237_10027029 3300009545 Bacteria 5860
78 Ga0105249_10346979 3300009553 Bacteria 1503
79 Ga0105249_10456293 3300009553 Bacteria 1317
80 Ga0157374_10206193 3300013296 Bacteria 1926
81 Ga0157375_10069159 3300013308 Bacteria 3536
82 Ga0157376_10215660 3300014969 Bacteria 1774
83 Ga0163161_10044033 3300017792 Bacteria 3214
84 Ga0163161_10186512 3300017792 Bacteria 1592
85 Ga0213872_10022420 3300021361 Bacteria 2908
86 Ga0213872_10043879 3300021361 Bacteria 2036
87 Ga0209435_100001 3300025206 Bacteria 1424171
88 Ga0207425_1000204 3300025245 Bacteria 47226
89 Ga0209646_1000001 3300025246 Bacteria 3092932
90 Ga0209026_1000003 3300025250 Bacteria 1060571
91 Ga0209759_1000001 3300025256 Bacteria 2799452
92 Ga0209129_1000025 3300025258 Bacteria 413639
93 Ga0209564_1000039 3300025295 Bacteria 413604
94 Ga0209758_1000163 3300025297 Bacteria 151988
95 Ga0209051_1000110 3300025303 Bacteria 153230
96 Ga0209051_1041592 3300025303 Bacteria 1633
97 Ga0209257_1000012 3300025304 Bacteria 1111138
98 Ga0209257_1000045 3300025304 Bacteria 484429
99 Ga0207682_10012282 3300025893 Bacteria 3344
100 Ga0207688_10003462 3300025901 Bacteria 8613
101 Ga0207688_10054564 3300025901 Bacteria 2242
102 Ga0207645_10072239 3300025907 Bacteria 2208
103 Ga0207645_10127803 3300025907 Bacteria 1653
104 Ga0207645_10131283 3300025907 Bacteria 1630
105 Ga0207684_10011063 3300025910 Bacteria 7902
106 Ga0207671_10002731 3300025914 Bacteria 18453
107 Ga0207646_10108096 3300025922 Bacteria 2495
108 Ga0207650_10012971 3300025925 Bacteria 5762
109 Ga0207650_10130043 3300025925 Bacteria 1969
110 Ga0207650_10213986 3300025925 Bacteria 1549
111 Ga0207659_10013212 3300025926 Bacteria 5283
112 Ga0207659_10099658 3300025926 Bacteria 2188
113 Ga0207659_10156860 3300025926 Bacteria 1783
114 Ga0207644_10030860 3300025931 Bacteria 3730
115 Ga0207644_10542219 3300025931 Bacteria 962
116 Ga0207690_10116659 3300025932 Bacteria 1931
117 Ga0207706_10088619 3300025933 Bacteria 2720
118 Ga0207706_10237494 3300025933 Bacteria 1594
119 Ga0207686_10004358 3300025934 Bacteria 7587
120 Ga0207709_10000019 3300025935 Bacteria 402225
121 Ga0207709_10024197 3300025935 Bacteria 3465
122 Ga0207709_10222506 3300025935 Bacteria 1362
123 Ga0207704_10297464 3300025938 Bacteria 1235
124 Ga0207691_10172117 3300025940 Bacteria 1896
125 Ga0207711_10003157 3300025941 Bacteria 14362
126 Ga0207711_10056660 3300025941 Bacteria 3368
127 Ga0207711_10682579 3300025941 Bacteria 958
128 Ga0207651_10128065 3300025960 Bacteria 1938
129 Ga0207651_10164593 3300025960 Bacteria 1742
130 Ga0207651_10497317 3300025960 Bacteria 1053
131 Ga0207712_10259660 3300025961 Bacteria 1408
132 Ga0207677_10303555 3300026023 Bacteria 1320
133 Ga0207641_10201460 3300026088 Bacteria 1835
134 Ga0207648_10326677 3300026089 Bacteria 1379
135 Ga0207674_10186364 3300026116 Bacteria 2025
136 Ga0207683_10080608 3300026121 Bacteria 2888
137 Ga0207683_10087200 3300026121 Bacteria 2775
138 Ga0207683_10770329 3300026121 Bacteria 893
139 Ga0207698_10998972 3300026142 Bacteria 847
140 Ga0209281_1000005 3300027111 Bacteria 1242284
141 Ga0209996_1014330 3300027395 Bacteria 1076
142 Ga0209968_1000656 3300027526 Bacteria 5336
143 Ga0209971_1004459 3300027682 Bacteria 3323
144 Ga0209966_1000027 3300027695 Bacteria 65242
145 Ga0268264_10058477 3300028381 Bacteria 3229
146 Ga0307517_10137665 3300028786 Bacteria 1729
147 Ga0307517_10244883 3300028786 Bacteria 1059
148 Ga0307515_10000022 3300028794 Bacteria 404064
149 Ga0307515_10015986 3300028794 Bacteria 13777
150 Ga0307515_10169972 3300028794 Bacteria 2178
151 Ga0307512_10176299 3300030522 Bacteria 1212
152 Ga0265332_10000003 3300031238 Bacteria 482849
153 Ga0307513_10000272 3300031456 Bacteria 75284
154 Ga0307513_10000610 3300031456 Bacteria 51110
155 Ga0307513_10025203 3300031456 Bacteria 6898
156 Ga0307513_10077346 3300031456 Bacteria 3446
157 Ga0307513_10178547 3300031456 Bacteria 1990
158 Ga0307509_10207043 3300031507 Bacteria 1791
159 Ga0307509_10268582 3300031507 Bacteria 1475
160 Ga0307408_100072390 3300031548 Bacteria 2551
161 Ga0307514_10000780 3300031649 Bacteria 52828
162 Ga0307516_10001377 3300031730 Bacteria 33649
163 Ga0307516_10003661 3300031730 Bacteria 19536
164 Ga0307516_10010534 3300031730 Bacteria 10154
165 Ga0307516_10269585 3300031730 Bacteria 1389
166 Ga0307416_100344617 3300032002 Bacteria 1505
167 Ga0307416_100567622 3300032002 Bacteria 1210
168 Ga0307416_100920761 3300032002 Bacteria 975
169 Ga0307510_10004655 3300033180 Bacteria 16184
170 Ga0307510_10226179 3300033180 Bacteria 1378
171 Ga0395899_0094628 3300037312 Bacteria 2161
172 Ga0395900_0027847 3300037418 Bacteria 5789
173 Ga0395900_0977296 3300037418 Bacteria 767
174 Ga0395898_0017491 3300037466 Bacteria 7319
175 Ga0395905_0005478 3300037471 Bacteria 12947
176 Ga0395905_0228151 3300037471 Bacteria 1742
177 Ga0395905_0421793 3300037471 Bacteria 1230
178 Ga0395905_0682276 3300037471 Bacteria 929
179 Ga0395901_0044161 3300038443 Bacteria 4622
180 Ga0395901_0658745 3300038443 Bacteria 1049
181 Ga0436361_0415932 3300039447 Bacteria 6019
182 Ga0436361_0438505 3300039447 Bacteria 3917
183 Ga0439436_0025568 3300041404 Bacteria 1734
184 Ga0439461_0027238 3300041410 Bacteria 1171
185 Ga0451791_0565996 3300041451 Bacteria 1585
186 Ga0451791_1144200 3300041451 Bacteria 921
187 Ga0451851_0133743 3300041507 Bacteria 1878
188 Ga0439449_0001718 3300042007 Bacteria 8601
189 Ga0439457_015124 3300042014 Bacteria 1724
190 Ga0439462_0006909 3300042015 Bacteria 2832
191 Ga0450890_010358 3300042127 Bacteria 1199
192 Ga0450898_047390 3300042134 Bacteria 824
193 Ga0451577_0000257 3300042876 Bacteria 104746
194 Ga0451577_0384965 3300042876 Bacteria 1273
195 Ga0451577_0401360 3300042876 Bacteria 1244
196 Ga0451577_0746242 3300042876 Bacteria 886
197 Ga0466969_0060823 3300044656 Bacteria 1835
198 Ga0453683_0004158 3300044673 Bacteria 10362
199 Ga0453683_0052865 3300044673 Bacteria 2542
200 Ga0466966_0018890 3300044684 Bacteria 4541
201 Ga0466961_0009834 3300044693 Bacteria 6089
202 Ga0466963_0068632 3300044694 Bacteria 2381
203 Ga0466964_0021411 3300044706 Bacteria 2500
204 Ga0453684_0001024 3300044712 Bacteria 89721
205 Ga0453684_0006580 3300044712 Bacteria 21987
206 Ga0453684_0050817 3300044712 Bacteria 5446
207 Ga0453684_0396747 3300044712 Bacteria 1546
208 Ga0466971_0058325 3300044719 Bacteria 1742
209 Ga0466970_0094987 3300044765 Bacteria 1620
210 Ga0466970_0123615 3300044765 Bacteria 1418
211 Ga0466960_0030576 3300044901 Bacteria 2479
212 Ga0466959_0000159 3300045049 Bacteria 44154
213 Ga0451576_0000798 3300045051 Bacteria 61660
214 Ga0451576_0008491 3300045051 Bacteria 12052
215 Ga0451576_0032924 3300045051 Bacteria 5512
216 Ga0466967_0283155 3300045976 Bacteria 1591
217 Ga0466967_0495353 3300045976 Bacteria 1198
218 Ga0495650_0003635 3300046471 Bacteria 11087
219 Ga0495610_0028781 3300046512 Bacteria 2934
220 Ga0495620_0050764 3300046515 Bacteria 1768
221 Ga0495632_0008036 3300046519 Bacteria 6546
222 Ga0495632_0032105 3300046519 Bacteria 2708
223 Ga0495597_0028401 3300046542 Bacteria 2560
224 Ga0495633_0000678 3300046558 Bacteria 31374
225 Ga0495625_0002261 3300046660 Bacteria 21166
226 Ga0495625_0076105 3300046660 Bacteria 2347
227 Ga0495649_0006247 3300046694 Bacteria 7426
228 Ga0495687_000232 3300047443 Bacteria 77572
229 Ga0495687_042654 3300047443 Bacteria 1980
230 Ga0495615_0041873 3300048090 Bacteria 1146
231 Ga0495626_0014255 3300048091 Bacteria 4105
232 Ga0495626_0103475 3300048091 Bacteria 1239
233 Ga0496104_0763675 3300048907 Bacteria 873
234 Ga0496105_0503017 3300048908 Bacteria 951
235 Ga0496109_0123902 3300048912 Bacteria 2409
236 Ga0496109_0608150 3300048912 Bacteria 1029
237 Ga0496109_0972780 3300048912 Bacteria 786
238 Ga0496112_0193398 3300048915 Bacteria 1995
239 Ga0496113_0042744 3300048916 Bacteria 3350
240 Ga0496122_0111524 3300048925 Bacteria 1794
241 Ga0496125_0115339 3300048928 Bacteria 1932
242 Ga0496125_0154947 3300048928 Bacteria 1567
243 Ga0501037_0119995 3300049573 Bacteria 1891
244 Ga0501039_0696141 3300049575 Bacteria 795
245 Ga0501067_0137863 3300049583 Bacteria 1358
246 Ga0501198_000004 3300049649 Bacteria 175146
247 Ga0501222_000011 3300049662 Bacteria 100553
248 nmdc:mga03683_186021_c1 3300050489 Bacteria 949
249 nmdc:mga03683_86845_c1 3300050489 Bacteria 1359
250 nmdc:mga03683_95087_c1 3300050489 Bacteria 1304
251 nmdc:mga00v17_244335_c1 3300050491 Bacteria 1164
252 nmdc:mga0yw44_125770_c1 3300050492 Bacteria 1655
253 nmdc:mga0k408_223995_c1 3300050493 Bacteria 1123
254 nmdc:mga0k408_23204_c1 3300050493 Bacteria 3498
255 nmdc:mga0k408_241053_c1 3300050493 Bacteria 1080
256 nmdc:mga0k408_26635_c1 3300050493 Bacteria 3280
257 nmdc:mga0k408_34931_c1 3300050493 Bacteria 2881
258 nmdc:mga0k408_4164_c1 3300050493 Bacteria 7677
259 nmdc:mga0k408_63931_c1 3300050493 Bacteria 2141
260 nmdc:mga0k408_80553_c1 3300050493 Bacteria 1906
261 nmdc:mga06z11_102049_c1 3300050494 Bacteria 1575
262 nmdc:mga06z11_304885_c1 3300050494 Bacteria 947
263 nmdc:mga04h51_55272_c1 3300050495 Bacteria 1344
264 nmdc:mga07m45_131_c1 3300050496 Bacteria 29571
265 nmdc:mga07m45_13263_c1 3300050496 Bacteria 4369
266 nmdc:mga07m45_202882_c1 3300050496 Bacteria 1154
267 nmdc:mga07m45_29300_c1 3300050496 Bacteria 3043
268 nmdc:mga09592_150247_c1 3300050508 Bacteria 2009
269 nmdc:mga0sz30_18098_c1 3300050516 Bacteria 2816
270 Ga0500578_0000871 3300053086 Bacteria 34797
271 Ga0500651_0032327 3300053093 Bacteria 3297
272 Ga0500652_091523 3300053131 Bacteria 1270
273 Ga0500568_0005479 3300053139 Bacteria 6550
274 Ga0500637_0229203 3300053178 Bacteria 1047
275 Ga0500645_001464 3300053730 Bacteria 11877
276 Ga0500645_006041 3300053730 Bacteria 4369
277 Ga0590075_007209 3300059424 Bacteria 2640
278 Ga0466962_0056708 3300061719 Bacteria 1870

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0094628 Ga0395899_0094628_1505_2137 206
2 3300037418 Ga0395900_0977296 Ga0395900_0977296_70_750 222
3 3300006195 Ga0075366_10012195 Ga0075366_100121955 227
4 3300006353 Ga0075370_10000324 Ga0075370_100003246 227
5 3300050493 nmdc:mga0k408_63931_c1 nmdc:mga0k408_63931_c1_757_1503 227
6 3300050496 nmdc:mga07m45_131_c1 nmdc:mga07m45_131_c1_4002_4748 227
7 3300032002 Ga0307416_100344617 Ga0307416_1003446172 230
8 3300006178 Ga0075367_10067923 Ga0075367_100679232 231
9 3300025935 Ga0207709_10024197 Ga0207709_100241972 231
10 3300031507 Ga0307509_10207043 Ga0307509_102070432 231
11 iso_pu_bacteria 2585428062 2587757365 231
12 iso_pu_bacteria 2932422444 2932423570 231
13 3300005844 Ga0068862_100369640 Ga0068862_1003696402 232
14 3300046471 Ga0495650_0003635 Ga0495650_0003635_2414_3112 232
15 iso_pu_bacteria 2721755523 2722884517 232
16 iso_pu_bacteria 2839138175 2839143113 232
17 3300025907 Ga0207645_10127803 Ga0207645_101278032 233
18 iso_pu_bacteria 2842718218 2842721083 233
19 iso_pu_bacteria 2894023352 2894026594 233
20 iso_pu_bacteria 2919704043 2919704697 233
21 iso_pu_bacteria 2974320154 2974323993 233
22 3300005338 Ga0068868_100315078 Ga0068868_1003150782 234
23 3300005459 Ga0068867_100404928 Ga0068867_1004049282 234
24 3300025940 Ga0207691_10172117 Ga0207691_101721172 234
25 3300026023 Ga0207677_10303555 Ga0207677_103035552 234
26 3300031456 Ga0307513_10178547 Ga0307513_101785472 234
27 3300053086 Ga0500578_0000871 Ga0500578_0000871_23666_24370 234
28 3300002773 JGI25152J39213_1002545 JGI25152J39213_10025453 235
29 3300003215 JGI25153J46596_10006072 JGI25153J46596_100060727 235
30 3300003771 Ga0055526_1001166 Ga0055526_100116611 235
31 3300005548 Ga0070665_100038047 Ga0070665_1000380477 235
32 3300005841 Ga0068863_100024097 Ga0068863_1000240976 235
33 3300005843 Ga0068860_100049961 Ga0068860_1000499612 235
34 3300006177 Ga0075362_10110867 Ga0075362_101108672 235
35 3300009098 Ga0105245_10066000 Ga0105245_100660002 235
36 3300014969 Ga0157376_10215660 Ga0157376_102156602 235
37 3300021361 Ga0213872_10022420 Ga0213872_100224202 235
38 3300025245 Ga0207425_1000204 Ga0207425_100020442 235
39 3300025258 Ga0209129_1000025 Ga0209129_1000025279 235
40 3300025295 Ga0209564_1000039 Ga0209564_1000039279 235
41 3300025297 Ga0209758_1000163 Ga0209758_100016339 235
42 3300025303 Ga0209051_1041592 Ga0209051_10415921 235
43 3300026121 Ga0207683_10770329 Ga0207683_107703291 235
44 3300027395 Ga0209996_1014330 Ga0209996_10143302 235
45 3300027526 Ga0209968_1000656 Ga0209968_10006563 235
46 3300027695 Ga0209966_1000027 Ga0209966_100002768 235
47 3300028381 Ga0268264_10058477 Ga0268264_100584772 235
48 3300028786 Ga0307517_10137665 Ga0307517_101376652 235
49 3300028794 Ga0307515_10015986 Ga0307515_100159863 235
50 3300031507 Ga0307509_10268582 Ga0307509_102685822 235
51 3300031730 Ga0307516_10001377 Ga0307516_1000137722 235
52 3300031730 Ga0307516_10010534 Ga0307516_1001053410 235
53 3300033180 Ga0307510_10004655 Ga0307510_100046558 235
54 3300039447 Ga0436361_0438505 Ga0436361_0438505_997_1704 235
55 3300041451 Ga0451791_1144200 Ga0451791_1144200_16_726 235
56 3300041507 Ga0451851_0133743 Ga0451851_0133743_167_877 235
57 3300042134 Ga0450898_047390 Ga0450898_047390_97_807 235
58 3300044656 Ga0466969_0060823 Ga0466969_0060823_389_1099 235
59 3300044684 Ga0466966_0018890 Ga0466966_0018890_3430_4140 235
60 3300044693 Ga0466961_0009834 Ga0466961_0009834_4598_5308 235
61 3300044694 Ga0466963_0068632 Ga0466963_0068632_1063_1773 235
62 3300044706 Ga0466964_0021411 Ga0466964_0021411_1154_1864 235
63 3300044719 Ga0466971_0058325 Ga0466971_0058325_55_765 235
64 3300044765 Ga0466970_0094987 Ga0466970_0094987_741_1451 235
65 3300044901 Ga0466960_0030576 Ga0466960_0030576_545_1252 235
66 3300045049 Ga0466959_0000159 Ga0466959_0000159_22217_22927 235
67 3300045976 Ga0466967_0495353 Ga0466967_0495353_183_893 235
68 3300046512 Ga0495610_0028781 Ga0495610_0028781_853_1563 235
69 3300046519 Ga0495632_0008036 Ga0495632_0008036_2328_3038 235
70 3300046660 Ga0495625_0002261 Ga0495625_0002261_7708_8418 235
71 3300048912 Ga0496109_0123902 Ga0496109_0123902_1292_1999 235
72 3300048916 Ga0496113_0042744 Ga0496113_0042744_2626_3336 235
73 3300050493 nmdc:mga0k408_34931_c1 nmdc:mga0k408_34931_c1_937_1647 235
74 3300050496 nmdc:mga07m45_202882_c1 nmdc:mga07m45_202882_c1_49_759 235
75 3300053131 Ga0500652_091523 Ga0500652_091523_390_1097 235
76 3300053178 Ga0500637_0229203 Ga0500637_0229203_141_848 235
77 3300061719 Ga0466962_0056708 Ga0466962_0056708_978_1688 235
78 iso_pu_bacteria 2643221660 2644339962 235
79 3300002705 JGI25156J39149_1000025 JGI25156J39149_100002528 236
80 3300002738 JGI25154J39366_1000045 JGI25154J39366_100004528 236
81 3300002741 JGI25157J39369_1000034 JGI25157J39369_100003428 236
82 3300002774 JGI25150J39212_1012067 JGI25150J39212_10120672 236
83 3300003792 Ga0055540_1005721 Ga0055540_10057214 236
84 3300003794 Ga0055531_10000584 Ga0055531_1000058425 236
85 3300005289 Ga0065704_10104615 Ga0065704_101046151 236
86 3300005289 Ga0065704_10117649 Ga0065704_101176491 236
87 3300005295 Ga0065707_10265848 Ga0065707_102658482 236
88 3300005327 Ga0070658_10240920 Ga0070658_102409202 236
89 3300005327 Ga0070658_10404580 Ga0070658_104045802 236
90 3300005328 Ga0070676_10051058 Ga0070676_100510582 236
91 3300005328 Ga0070676_10066063 Ga0070676_100660632 236
92 3300005331 Ga0070670_100025635 Ga0070670_1000256353 236
93 3300005331 Ga0070670_100064014 Ga0070670_1000640142 236
94 3300005331 Ga0070670_100146556 Ga0070670_1001465562 236
95 3300005334 Ga0068869_100083174 Ga0068869_1000831743 236
96 3300005354 Ga0070675_100086887 Ga0070675_1000868872 236
97 3300005354 Ga0070675_100339158 Ga0070675_1003391582 236
98 3300005355 Ga0070671_100002733 Ga0070671_1000027332 236
99 3300005355 Ga0070671_100219902 Ga0070671_1002199022 236
100 3300005364 Ga0070673_100191785 Ga0070673_1001917852 236
101 3300005364 Ga0070673_100193843 Ga0070673_1001938432 236
102 3300005366 Ga0070659_100099184 Ga0070659_1000991842 236
103 3300005455 Ga0070663_100121720 Ga0070663_1001217202 236
104 3300005456 Ga0070678_100064228 Ga0070678_1000642283 236
105 3300005457 Ga0070662_100106068 Ga0070662_1001060682 236
106 3300005467 Ga0070706_100002204 Ga0070706_1000022045 236
107 3300005468 Ga0070707_100117889 Ga0070707_1001178892 236
108 3300005539 Ga0068853_100322631 Ga0068853_1003226312 236
109 3300005564 Ga0070664_100052913 Ga0070664_1000529132 236
110 3300005577 Ga0068857_100191356 Ga0068857_1001913562 236
111 3300005618 Ga0068864_100128160 Ga0068864_1001281602 236
112 3300005841 Ga0068863_100024012 Ga0068863_1000240122 236
113 3300005844 Ga0068862_100021694 Ga0068862_1000216943 236
114 3300005937 Ga0081455_10197079 Ga0081455_101970792 236
115 3300006042 Ga0075368_10011181 Ga0075368_100111812 236
116 3300006042 Ga0075368_10105051 Ga0075368_101050512 236
117 3300006042 Ga0075368_10181726 Ga0075368_101817262 236
118 3300006048 Ga0075363_100012826 Ga0075363_1000128262 236
119 3300006051 Ga0075364_10021530 Ga0075364_100215301 236
120 3300006058 Ga0075432_10002628 Ga0075432_100026282 236
121 3300006177 Ga0075362_10115018 Ga0075362_101150182 236
122 3300006195 Ga0075366_10001616 Ga0075366_100016167 236
123 3300006195 Ga0075366_10001785 Ga0075366_100017853 236
124 3300006195 Ga0075366_10136281 Ga0075366_101362812 236
125 3300006237 Ga0097621_100055093 Ga0097621_1000550933 236
126 3300006353 Ga0075370_10004923 Ga0075370_100049234 236
127 3300006353 Ga0075370_10006283 Ga0075370_100062837 236
128 3300006358 Ga0068871_100413971 Ga0068871_1004139712 236
129 3300006846 Ga0075430_100162185 Ga0075430_1001621852 236
130 3300006880 Ga0075429_100209533 Ga0075429_1002095332 236
131 3300006946 Ga0079104_1000004 Ga0079104_100000442 236
132 3300009036 Ga0105244_10138317 Ga0105244_101383172 236
133 3300009092 Ga0105250_10007024 Ga0105250_100070242 236
134 3300009093 Ga0105240_10229433 Ga0105240_102294332 236
135 3300009148 Ga0105243_10169141 Ga0105243_101691413 236
136 3300009176 Ga0105242_10001169 Ga0105242_100011694 236
137 3300009177 Ga0105248_10053028 Ga0105248_100530284 236
138 3300009177 Ga0105248_10632841 Ga0105248_106328412 236
139 3300009177 Ga0105248_11116613 Ga0105248_111166131 236
140 3300009545 Ga0105237_10001237 Ga0105237_1000123719 236
141 3300009545 Ga0105237_10027029 Ga0105237_100270297 236
142 3300009553 Ga0105249_10346979 Ga0105249_103469792 236
143 3300009553 Ga0105249_10456293 Ga0105249_104562931 236
144 3300013296 Ga0157374_10206193 Ga0157374_102061932 236
145 3300013308 Ga0157375_10069159 Ga0157375_100691594 236
146 3300017792 Ga0163161_10044033 Ga0163161_100440333 236
147 3300017792 Ga0163161_10186512 Ga0163161_101865122 236
148 3300021361 Ga0213872_10043879 Ga0213872_100438793 236
149 3300025206 Ga0209435_100001 Ga0209435_100001953 236
150 3300025246 Ga0209646_1000001 Ga0209646_10000011322 236
151 3300025250 Ga0209026_1000003 Ga0209026_1000003953 236
152 3300025256 Ga0209759_1000001 Ga0209759_1000001953 236
153 3300025303 Ga0209051_1000110 Ga0209051_100011096 236
154 3300025304 Ga0209257_1000012 Ga0209257_1000012905 236
155 3300025304 Ga0209257_1000045 Ga0209257_1000045311 236
156 3300025893 Ga0207682_10012282 Ga0207682_100122822 236
157 3300025901 Ga0207688_10003462 Ga0207688_100034622 236
158 3300025901 Ga0207688_10054564 Ga0207688_100545642 236
159 3300025907 Ga0207645_10072239 Ga0207645_100722392 236
160 3300025907 Ga0207645_10131283 Ga0207645_101312832 236
161 3300025910 Ga0207684_10011063 Ga0207684_100110634 236
162 3300025914 Ga0207671_10002731 Ga0207671_100027313 236
163 3300025922 Ga0207646_10108096 Ga0207646_101080963 236
164 3300025925 Ga0207650_10012971 Ga0207650_100129713 236
165 3300025925 Ga0207650_10130043 Ga0207650_101300432 236
166 3300025925 Ga0207650_10213986 Ga0207650_102139862 236
167 3300025926 Ga0207659_10013212 Ga0207659_100132122 236
168 3300025926 Ga0207659_10099658 Ga0207659_100996582 236
169 3300025926 Ga0207659_10156860 Ga0207659_101568602 236
170 3300025931 Ga0207644_10030860 Ga0207644_100308602 236
171 3300025931 Ga0207644_10542219 Ga0207644_105422192 236
172 3300025932 Ga0207690_10116659 Ga0207690_101166592 236
173 3300025933 Ga0207706_10088619 Ga0207706_100886193 236
174 3300025933 Ga0207706_10237494 Ga0207706_102374942 236
175 3300025934 Ga0207686_10004358 Ga0207686_100043583 236
176 3300025935 Ga0207709_10000019 Ga0207709_10000019106 236
177 3300025935 Ga0207709_10222506 Ga0207709_102225062 236
178 3300025938 Ga0207704_10297464 Ga0207704_102974642 236
179 3300025941 Ga0207711_10003157 Ga0207711_100031572 236
180 3300025941 Ga0207711_10056660 Ga0207711_100566601 236
181 3300025941 Ga0207711_10682579 Ga0207711_106825791 236
182 3300025960 Ga0207651_10128065 Ga0207651_101280652 236
183 3300025960 Ga0207651_10164593 Ga0207651_101645932 236
184 3300025960 Ga0207651_10497317 Ga0207651_104973171 236
185 3300025961 Ga0207712_10259660 Ga0207712_102596602 236
186 3300026088 Ga0207641_10201460 Ga0207641_102014602 236
187 3300026089 Ga0207648_10326677 Ga0207648_103266772 236
188 3300026116 Ga0207674_10186364 Ga0207674_101863642 236
189 3300026121 Ga0207683_10080608 Ga0207683_100806081 236
190 3300026121 Ga0207683_10087200 Ga0207683_100872003 236
191 3300026142 Ga0207698_10998972 Ga0207698_109989722 236
192 3300027111 Ga0209281_1000005 Ga0209281_1000005243 236
193 3300027682 Ga0209971_1004459 Ga0209971_10044594 236
194 3300028786 Ga0307517_10244883 Ga0307517_102448832 236
195 3300028794 Ga0307515_10000022 Ga0307515_10000022307 236
196 3300028794 Ga0307515_10169972 Ga0307515_101699722 236
197 3300030522 Ga0307512_10176299 Ga0307512_101762992 236
198 3300031238 Ga0265332_10000003 Ga0265332_10000003384 236
199 3300031456 Ga0307513_10000272 Ga0307513_1000027219 236
200 3300031456 Ga0307513_10000610 Ga0307513_1000061039 236
201 3300031456 Ga0307513_10025203 Ga0307513_100252033 236
202 3300031456 Ga0307513_10077346 Ga0307513_100773465 236
203 3300031548 Ga0307408_100072390 Ga0307408_1000723902 236
204 3300031649 Ga0307514_10000780 Ga0307514_1000078024 236
205 3300031730 Ga0307516_10003661 Ga0307516_1000366117 236
206 3300031730 Ga0307516_10269585 Ga0307516_102695851 236
207 3300032002 Ga0307416_100567622 Ga0307416_1005676222 236
208 3300032002 Ga0307416_100920761 Ga0307416_1009207612 236
209 3300033180 Ga0307510_10226179 Ga0307510_102261792 236
210 3300037418 Ga0395900_0027847 Ga0395900_0027847_646_1371 236
211 3300037466 Ga0395898_0017491 Ga0395898_0017491_3942_4664 236
212 3300037471 Ga0395905_0005478 Ga0395905_0005478_3262_3981 236
213 3300037471 Ga0395905_0228151 Ga0395905_0228151_761_1483 236
214 3300037471 Ga0395905_0421793 Ga0395905_0421793_41_766 236
215 3300037471 Ga0395905_0682276 Ga0395905_0682276_55_777 236
216 3300038443 Ga0395901_0044161 Ga0395901_0044161_3565_4287 236
217 3300038443 Ga0395901_0658745 Ga0395901_0658745_211_936 236
218 3300039447 Ga0436361_0415932 Ga0436361_0415932_280_990 236
219 3300041404 Ga0439436_0025568 Ga0439436_0025568_289_1056 236
220 3300041410 Ga0439461_0027238 Ga0439461_0027238_174_896 236
221 3300041451 Ga0451791_0565996 Ga0451791_0565996_427_1137 236
222 3300042007 Ga0439449_0001718 Ga0439449_0001718_3693_4460 236
223 3300042014 Ga0439457_015124 Ga0439457_015124_436_1161 236
224 3300042015 Ga0439462_0006909 Ga0439462_0006909_1117_1884 236
225 3300042127 Ga0450890_010358 Ga0450890_010358_366_1097 236
226 3300042876 Ga0451577_0000257 Ga0451577_0000257_73496_74248 236
227 3300042876 Ga0451577_0384965 Ga0451577_0384965_154_867 236
228 3300042876 Ga0451577_0401360 Ga0451577_0401360_491_1219 236
229 3300042876 Ga0451577_0746242 Ga0451577_0746242_24_740 236
230 3300044673 Ga0453683_0004158 Ga0453683_0004158_202_924 236
231 3300044673 Ga0453683_0052865 Ga0453683_0052865_55_765 236
232 3300044712 Ga0453684_0001024 Ga0453684_0001024_30479_31231 236
233 3300044712 Ga0453684_0006580 Ga0453684_0006580_2541_3254 236
234 3300044712 Ga0453684_0050817 Ga0453684_0050817_227_937 236
235 3300044712 Ga0453684_0396747 Ga0453684_0396747_487_1203 236
236 3300044765 Ga0466970_0123615 Ga0466970_0123615_52_765 236
237 3300045051 Ga0451576_0000798 Ga0451576_0000798_56913_57653 236
238 3300045051 Ga0451576_0008491 Ga0451576_0008491_1015_1725 236
239 3300045051 Ga0451576_0032924 Ga0451576_0032924_801_1523 236
240 3300045976 Ga0466967_0283155 Ga0466967_0283155_520_1242 236
241 3300046515 Ga0495620_0050764 Ga0495620_0050764_244_990 236
242 3300046519 Ga0495632_0032105 Ga0495632_0032105_646_1392 236
243 3300046542 Ga0495597_0028401 Ga0495597_0028401_33_776 236
244 3300046558 Ga0495633_0000678 Ga0495633_0000678_29895_30608 236
245 3300046660 Ga0495625_0076105 Ga0495625_0076105_155_901 236
246 3300046694 Ga0495649_0006247 Ga0495649_0006247_5502_6248 236
247 3300047443 Ga0495687_000232 Ga0495687_000232_39626_40369 236
248 3300047443 Ga0495687_042654 Ga0495687_042654_983_1729 236
249 3300048090 Ga0495615_0041873 Ga0495615_0041873_66_791 236
250 3300048091 Ga0495626_0014255 Ga0495626_0014255_2975_3721 236
251 3300048091 Ga0495626_0103475 Ga0495626_0103475_261_1004 236
252 3300048907 Ga0496104_0763675 Ga0496104_0763675_117_851 236
253 3300048908 Ga0496105_0503017 Ga0496105_0503017_136_870 236
254 3300048912 Ga0496109_0608150 Ga0496109_0608150_263_985 236
255 3300048912 Ga0496109_0972780 Ga0496109_0972780_28_762 236
256 3300048915 Ga0496112_0193398 Ga0496112_0193398_1040_1774 236
257 3300048925 Ga0496122_0111524 Ga0496122_0111524_539_1252 236
258 3300048928 Ga0496125_0115339 Ga0496125_0115339_43_756 236
259 3300048928 Ga0496125_0154947 Ga0496125_0154947_178_897 236
260 3300049573 Ga0501037_0119995 Ga0501037_0119995_267_983 236
261 3300049575 Ga0501039_0696141 Ga0501039_0696141_54_776 236
262 3300049583 Ga0501067_0137863 Ga0501067_0137863_345_1064 236
263 3300049649 Ga0501198_000004 Ga0501198_000004_130250_130963 236
264 3300049662 Ga0501222_000011 Ga0501222_000011_55475_56188 236
265 3300050489 nmdc:mga03683_186021_c1 nmdc:mga03683_186021_c1_87_815 236
266 3300050489 nmdc:mga03683_86845_c1 nmdc:mga03683_86845_c1_309_1076 236
267 3300050489 nmdc:mga03683_95087_c1 nmdc:mga03683_95087_c1_236_976 236
268 3300050491 nmdc:mga00v17_244335_c1 nmdc:mga00v17_244335_c1_254_1021 236
269 3300050492 nmdc:mga0yw44_125770_c1 nmdc:mga0yw44_125770_c1_808_1548 236
270 3300050493 nmdc:mga0k408_223995_c1 nmdc:mga0k408_223995_c1_322_1053 236
271 3300050493 nmdc:mga0k408_23204_c1 nmdc:mga0k408_23204_c1_701_1432 236
272 3300050493 nmdc:mga0k408_241053_c1 nmdc:mga0k408_241053_c1_132_899 236
273 3300050493 nmdc:mga0k408_26635_c1 nmdc:mga0k408_26635_c1_2075_2815 236
274 3300050493 nmdc:mga0k408_4164_c1 nmdc:mga0k408_4164_c1_1127_1840 236
275 3300050493 nmdc:mga0k408_80553_c1 nmdc:mga0k408_80553_c1_984_1730 236
276 3300050494 nmdc:mga06z11_102049_c1 nmdc:mga06z11_102049_c1_689_1420 236
277 3300050494 nmdc:mga06z11_304885_c1 nmdc:mga06z11_304885_c1_87_815 236
278 3300050495 nmdc:mga04h51_55272_c1 nmdc:mga04h51_55272_c1_458_1189 236
279 3300050496 nmdc:mga07m45_13263_c1 nmdc:mga07m45_13263_c1_994_1725 236
280 3300050496 nmdc:mga07m45_29300_c1 nmdc:mga07m45_29300_c1_185_928 236
281 3300050508 nmdc:mga09592_150247_c1 nmdc:mga09592_150247_c1_589_1311 236
282 3300050516 nmdc:mga0sz30_18098_c1 nmdc:mga0sz30_18098_c1_878_1618 236
283 3300053093 Ga0500651_0032327 Ga0500651_0032327_1406_2116 236
284 3300053139 Ga0500568_0005479 Ga0500568_0005479_876_1622 236
285 3300053730 Ga0500645_001464 Ga0500645_001464_1629_2339 236
286 3300053730 Ga0500645_006041 Ga0500645_006041_1863_2573 236
287 3300059424 Ga0590075_007209 Ga0590075_007209_1520_2245 236
288 iso_pu_bacteria 2939631187 2939634840 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

169

241

0.85

PF12710

HAD

haloacid dehalogenase-like hydrolase

33

207

0.82

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

30

210

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1y-assembly2.cif.gz_C crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.9581 25 236
3m1y-assembly1.cif.gz_B crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.9559 25 235
1l7o-assembly3.cif.gz_A crystal structure of phosphoserine phosphatase in apo form 0.9554 24 236
3m1y-assembly2.cif.gz_D crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.9516 24 231
4eze-assembly2.cif.gz_B crystal structure of had family hydrolase t0658 from salmonella enterica subsp. enterica serovar typhi (target efi-501419) 0.947 17 236
ID Description Score Start End Superfamily
af_P0AGB0_183_315_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9648 100 235 3.40.50.1000
af_O74382_8_284_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9536 17 236 3.40.50.1000
af_P0AGB0_183_315_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9508 100 235 3.40.50.1000
4ezeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.947 17 236 3.40.50.1000
3m1yC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9429 99 236 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A353Y946-F1-model_v4 Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) 0.9959 76 236 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A4V1U426-F1-model_v4 deleted 0.9939 27 234
AF-B7WXM4-F1-model_v4 Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) 0.9929 2 236 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A2M8X4U6-F1-model_v4 Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) 0.9926 3 236 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A315EFR7-F1-model_v4 Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) 0.9925 2 236 GO:0000287
GO:0005737
GO:0006564
GO:0036424

Feature Viewer

pLDDT pTM Quality
94.45 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map