F387557

General Info

Members Datasets Scaffolds Average Seq Length
286 181 572 169

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0036044|Ga0451577_0036044_3536_4078
Length 180
Sequence MSYPYQSPTAGRKDVPAGPGKLWKRIPPGRRQTAVEAFWQDDEAIEQQAEALLAIASHLRFRPKTVTALPLEKRVRYLATLPTVSDSVAGRVLISYHLAHQRPMLSAFLDGLGIAHDNGVLAAEEVTAPAPEQLQEAAAKLQTQFPKEDVELYFLTLLAQDPETWGGLADILESMSPQGE

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0
Rhizoplane 1.75
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 11.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0036044 3300042876 Bacteria 4455
2 JGI24749J21850_1035465 3300002076 Unclassified 723
3 Ga0065712_10071733 3300005290 Bacteria 5091
4 Ga0065712_10262576 3300005290 Bacteria 930
5 Ga0065712_10444879 3300005290 Unclassified 691
6 Ga0065715_10185031 3300005293 Unclassified 1451
7 Ga0065707_10217303 3300005295 Bacteria 1239
8 Ga0065707_10769533 3300005295 Unclassified 611
9 Ga0070676_10642755 3300005328 Unclassified 769
10 Ga0070683_100057237 3300005329 Bacteria 3621
11 Ga0070683_100744095 3300005329 Bacteria 939
12 Ga0070690_100192347 3300005330 Bacteria 1415
13 Ga0070670_100023935 3300005331 Bacteria 5253
14 Ga0070670_100780795 3300005331 Bacteria 862
15 Ga0070670_101006509 3300005331 Bacteria 758
16 Ga0068869_100440318 3300005334 Bacteria 1079
17 Ga0070680_100473065 3300005336 Bacteria 1071
18 Ga0070660_100395456 3300005339 Bacteria 1142
19 Ga0070689_100011669 3300005340 Bacteria 6302
20 Ga0070689_100037612 3300005340 Bacteria 3701
21 Ga0070689_100293521 3300005340 Bacteria 1352
22 Ga0070691_10079487 3300005341 Bacteria 1603
23 Ga0070661_100353005 3300005344 Bacteria 1154
24 Ga0070661_100489626 3300005344 Bacteria 983
25 Ga0070668_100732777 3300005347 Bacteria 874
26 Ga0070669_100168778 3300005353 Bacteria 1705
27 Ga0070669_100181480 3300005353 Bacteria 1647
28 Ga0070669_100217984 3300005353 Bacteria 1508
29 Ga0070669_100748653 3300005353 Bacteria 828
30 Ga0070675_100016847 3300005354 Bacteria 5803
31 Ga0070675_100017305 3300005354 Bacteria 5727
32 Ga0070675_100056707 3300005354 Bacteria 3229
33 Ga0070671_101341978 3300005355 Bacteria 631
34 Ga0070674_100892230 3300005356 Bacteria 774
35 Ga0070673_100153115 3300005364 Bacteria 1954
36 Ga0070673_100201055 3300005364 Bacteria 1716
37 Ga0070673_101449757 3300005364 Bacteria 647
38 Ga0070688_100026515 3300005365 Bacteria 3443
39 Ga0070688_100599492 3300005365 Bacteria 843
40 Ga0070659_100962712 3300005366 Unclassified 748
41 Ga0070667_101069001 3300005367 Bacteria 754
42 Ga0070714_100013292 3300005435 Bacteria 6594
43 Ga0070701_10054831 3300005438 Bacteria 2080
44 Ga0070701_10143531 3300005438 Bacteria 1368
45 Ga0070701_10289871 3300005438 Bacteria 1002
46 Ga0070705_100001998 3300005440 Bacteria 10423
47 Ga0070705_100091945 3300005440 Bacteria 1893
48 Ga0070705_101067121 3300005440 Bacteria 659
49 Ga0070694_100041774 3300005444 Bacteria 3061
50 Ga0070708_100837730 3300005445 Bacteria 864
51 Ga0070663_100815402 3300005455 Bacteria 801
52 Ga0070678_100897731 3300005456 Bacteria 810
53 Ga0070681_10078779 3300005458 Bacteria 3252
54 Ga0070707_100400162 3300005468 Bacteria 1333
55 Ga0070698_100233030 3300005471 Bacteria 1774
56 Ga0070684_100013870 3300005535 Bacteria 6510
57 Ga0070684_100659670 3300005535 Bacteria 974
58 Ga0070672_100393566 3300005543 Bacteria 1187
59 Ga0070672_100416694 3300005543 Bacteria 1153
60 Ga0070686_100087778 3300005544 Bacteria 2074
61 Ga0070686_100185373 3300005544 Bacteria 1481
62 Ga0070686_100715204 3300005544 Bacteria 800
63 Ga0070695_100000104 3300005545 Bacteria 37120
64 Ga0070695_100023314 3300005545 Bacteria 3801
65 Ga0070695_100789700 3300005545 Bacteria 760
66 Ga0070696_100001760 3300005546 Bacteria 14207
67 Ga0070704_100074782 3300005549 Bacteria 2472
68 Ga0070704_101091475 3300005549 Bacteria 725
69 Ga0070664_100028284 3300005564 Bacteria 4662
70 Ga0070664_100158550 3300005564 Bacteria 2001
71 Ga0070664_100527717 3300005564 Bacteria 1090
72 Ga0070664_101289950 3300005564 Bacteria 690
73 Ga0068857_100785276 3300005577 Bacteria 909
74 Ga0068856_100918500 3300005614 Bacteria 894
75 Ga0070702_100034627 3300005615 Bacteria 2784
76 Ga0068859_100047674 3300005617 Bacteria 4305
77 Ga0068859_100282644 3300005617 Bacteria 1752
78 Ga0068859_100458470 3300005617 Bacteria 1371
79 Ga0068859_100728905 3300005617 Bacteria 1081
80 Ga0068864_100012810 3300005618 Bacteria 6933
81 Ga0068864_100278432 3300005618 Bacteria 1561
82 Ga0068864_100347441 3300005618 Unclassified 1399
83 Ga0068861_100289515 3300005719 Bacteria 1414
84 Ga0068861_100725782 3300005719 Bacteria 926
85 Ga0068870_10078895 3300005840 Bacteria 1815
86 Ga0068870_10187533 3300005840 Unclassified 1246
87 Ga0068870_10397320 3300005840 Unclassified 896
88 Ga0068863_100999663 3300005841 Bacteria 839
89 Ga0068863_101399289 3300005841 Unclassified 707
90 Ga0068860_100184536 3300005843 Bacteria 2017
91 Ga0068862_100341546 3300005844 Bacteria 1387
92 Ga0068862_100528993 3300005844 Bacteria 1123
93 Ga0081539_10000013 3300005985 Bacteria 432395
94 Ga0070717_10053994 3300006028 Unclassified 3313
95 Ga0075365_10351731 3300006038 Bacteria 1039
96 Ga0075368_10017111 3300006042 Bacteria 2710
97 Ga0075363_100050993 3300006048 Bacteria 2206
98 Ga0075364_10042210 3300006051 Bacteria 2963
99 Ga0097621_100455501 3300006237 Bacteria 1153
100 Ga0075370_10003157 3300006353 Bacteria 7787
101 Ga0075428_100021549 3300006844 Bacteria 7134
102 Ga0075428_100388124 3300006844 Bacteria 1497
103 Ga0075428_101135074 3300006844 Bacteria 825
104 Ga0075430_100007165 3300006846 Bacteria 9409
105 Ga0075430_100088654 3300006846 Bacteria 2589
106 Ga0075430_100440307 3300006846 Bacteria 1076
107 Ga0075431_100334436 3300006847 Bacteria 1525
108 Ga0075431_100510273 3300006847 Bacteria 1192
109 Ga0075431_101268544 3300006847 Unclassified 698
110 Ga0075433_10060192 3300006852 Bacteria 3325
111 Ga0075434_100007917 3300006871 Bacteria 9850
112 Ga0075434_100127096 3300006871 Bacteria 2566
113 Ga0075434_100979109 3300006871 Unclassified 860
114 Ga0075429_100111583 3300006880 Bacteria 2390
115 Ga0097620_100047674 3300006931 Bacteria 4305
116 Ga0097620_100282657 3300006931 Bacteria 1752
117 Ga0097620_100458532 3300006931 Bacteria 1371
118 Ga0097620_100718311 3300006931 Bacteria 1089
119 Ga0097620_100728963 3300006931 Bacteria 1081
120 Ga0075435_100096700 3300007076 Bacteria 2443
121 Ga0105240_10038745 3300009093 Bacteria 6111
122 Ga0105240_10094332 3300009093 Bacteria 3650
123 Ga0111539_10000921 3300009094 Bacteria 38446
124 Ga0111539_10001210 3300009094 Bacteria 34346
125 Ga0111539_10004658 3300009094 Bacteria 17924
126 Ga0111539_10336300 3300009094 Bacteria 1757
127 Ga0111539_12430736 3300009094 Bacteria 608
128 Ga0114129_10277195 3300009147 Bacteria 2241
129 Ga0114129_10409041 3300009147 Bacteria 1787
130 Ga0105243_10615365 3300009148 Bacteria 1048
131 Ga0105248_10418298 3300009177 Bacteria 1509
132 Ga0105248_10740860 3300009177 Bacteria 1109
133 Ga0105238_10568179 3300009551 Bacteria 1139
134 Ga0105249_10203793 3300009553 Bacteria 1937
135 Ga0105249_10474837 3300009553 Bacteria 1292
136 Ga0163163_10039558 3300014325 Bacteria 4602
137 Ga0163163_10091562 3300014325 Bacteria 3055
138 Ga0157380_10233668 3300014326 Bacteria 1653
139 Ga0157380_10286606 3300014326 Bacteria 1510
140 Ga0157377_10037375 3300014745 Bacteria 2675
141 Ga0157377_10039725 3300014745 Bacteria 2604
142 Ga0206356_10017952 3300020070 Bacteria 887
143 Ga0207645_10175879 3300025907 Bacteria 1404
144 Ga0207643_10110214 3300025908 Bacteria 1621
145 Ga0207707_10118569 3300025912 Bacteria 2313
146 Ga0207695_10460863 3300025913 Bacteria 1154
147 Ga0207660_10098498 3300025917 Bacteria 2181
148 Ga0207660_10795653 3300025917 Bacteria 772
149 Ga0207662_10103218 3300025918 Bacteria 1769
150 Ga0207649_10146929 3300025920 Bacteria 1619
151 Ga0207646_10617309 3300025922 Bacteria 973
152 Ga0207681_10060014 3300025923 Bacteria 2609
153 Ga0207681_10216636 3300025923 Bacteria 1479
154 Ga0207681_10715657 3300025923 Bacteria 833
155 Ga0207681_10792323 3300025923 Bacteria 791
156 Ga0207650_10004887 3300025925 Bacteria 9155
157 Ga0207650_10050398 3300025925 Bacteria 3078
158 Ga0207650_10712409 3300025925 Bacteria 848
159 Ga0207659_10010654 3300025926 Bacteria 5781
160 Ga0207659_10042760 3300025926 Bacteria 3178
161 Ga0207659_10112728 3300025926 Bacteria 2070
162 Ga0207706_10259344 3300025933 Bacteria 1518
163 Ga0207709_10213011 3300025935 Bacteria 1388
164 Ga0207670_10113702 3300025936 Bacteria 1955
165 Ga0207669_10622656 3300025937 Bacteria 880
166 Ga0207691_10227024 3300025940 Bacteria 1618
167 Ga0207691_10629641 3300025940 Bacteria 907
168 Ga0207711_10401222 3300025941 Bacteria 1274
169 Ga0207711_11172030 3300025941 Unclassified 710
170 Ga0207689_10164935 3300025942 Bacteria 1826
171 Ga0207661_10289513 3300025944 Bacteria 1466
172 Ga0207679_10014536 3300025945 Bacteria 5179
173 Ga0207679_10047465 3300025945 Bacteria 3120
174 Ga0207679_10057535 3300025945 Bacteria 2876
175 Ga0207679_10083459 3300025945 Bacteria 2449
176 Ga0207651_10025798 3300025960 Bacteria 3659
177 Ga0207651_10443959 3300025960 Bacteria 1112
178 Ga0207708_10199623 3300026075 Bacteria 1595
179 Ga0207708_10303801 3300026075 Bacteria 1298
180 Ga0207702_10826208 3300026078 Bacteria 917
181 Ga0207641_10858205 3300026088 Unclassified 900
182 Ga0207648_10396695 3300026089 Bacteria 1249
183 Ga0207676_10438041 3300026095 Bacteria 1229
184 Ga0207674_10961184 3300026116 Bacteria 823
185 Ga0207675_100136028 3300026118 Bacteria 2332
186 Ga0207675_100251992 3300026118 Bacteria 1709
187 Ga0209813_10025027 3300027866 Bacteria 1713
188 Ga0209974_10021330 3300027876 Bacteria 2145
189 Ga0207428_10003244 3300027907 Bacteria 15855
190 Ga0207428_10014348 3300027907 Bacteria 6890
191 Ga0207428_10042402 3300027907 Bacteria 3680
192 Ga0207428_10302805 3300027907 Bacteria 1183
193 Ga0207428_10472094 3300027907 Bacteria 913
194 Ga0268265_10142891 3300028380 Bacteria 2006
195 Ga0268265_11026247 3300028380 Unclassified 816
196 Ga0307513_10242702 3300031456 Bacteria 1605
197 Ga0307408_101984181 3300031548 Unclassified 559
198 Ga0307410_10889208 3300031852 Bacteria 762
199 Ga0307412_10329330 3300031911 Bacteria 1218
200 Ga0307416_100099077 3300032002 Bacteria 2530
201 Ga0307416_101886924 3300032002 Unclassified 701
202 Ga0307411_10028247 3300032005 Bacteria 3408
203 Ga0373923_0263753 3300035111 Bacteria 809
204 Ga0373955_0150476 3300035172 Bacteria 1370
205 Ga0373924_0031085 3300035410 Unclassified 2145
206 Ga0373937_0263713 3300036401 Bacteria 1625
207 Ga0373925_1166310 3300037068 Bacteria 633
208 Ga0450908_078843 3300042184 Bacteria 590
209 Ga0439435_0057417 3300042436 Unclassified 1127
210 Ga0450916_024528 3300042530 Unclassified 847
211 Ga0453684_0234944 3300044712 Bacteria 2114
212 Ga0451576_0020565 3300045051 Bacteria 7183
213 Ga0451576_1688933 3300045051 Bacteria 656
214 Ga0495629_0053954 3300046459 Bacteria 2811
215 Ga0495639_0223164 3300046475 Bacteria 927
216 Ga0495662_0149329 3300046476 Unclassified 1151
217 Ga0495664_0476544 3300046477 Unclassified 746
218 Ga0495596_0165713 3300046500 Bacteria 859
219 Ga0495643_0003172 3300046522 Bacteria 12222
220 Ga0495663_0123159 3300046525 Bacteria 870
221 Ga0495598_0015350 3300046537 Bacteria 1933
222 Ga0495621_0054972 3300046539 Bacteria 1432
223 Ga0495634_0367442 3300046642 Unclassified 859
224 Ga0495635_0150363 3300046663 Unclassified 1585
225 Ga0495659_0331252 3300046664 Unclassified 648
226 Ga0495658_0039133 3300046683 Bacteria 2630
227 Ga0495604_1015916 3300047317 Bacteria 513
228 Ga0495636_0113147 3300047318 Bacteria 1196
229 Ga0495674_0568723 3300047319 Bacteria 901
230 Ga0495676_0104553 3300047321 Bacteria 2089
231 Ga0496105_0491614 3300048908 Bacteria 964
232 Ga0496109_0447050 3300048912 Bacteria 1221
233 Ga0496109_1050541 3300048912 Unclassified 752
234 Ga0496112_0085631 3300048915 Bacteria 3118
235 Ga0496113_0595238 3300048916 Bacteria 886
236 Ga0501037_0341469 3300049573 Bacteria 1034
237 Ga0501041_0341660 3300049577 Bacteria 945
238 Ga0501046_0066510 3300049580 Bacteria 2809
239 Ga0501067_0045588 3300049583 Unclassified 2434
240 Ga0501069_0457218 3300049585 Unclassified 759
241 Ga0501071_0066610 3300049587 Bacteria 2618
242 Ga0501072_0192981 3300049588 Bacteria 1624
243 Ga0501073_0170823 3300049589 Bacteria 1505
244 Ga0501075_0071381 3300049591 Bacteria 2625
245 Ga0501076_0068977 3300049592 Bacteria 2825
246 Ga0501077_0064589 3300049593 Bacteria 2322
247 Ga0501080_0035192 3300049742 Bacteria 4675
248 Ga0501081_0049882 3300049743 Bacteria 2883
249 Ga0501045_0038989 3300049824 Bacteria 3457
250 nmdc:mga00v17_18557_c1 3300050491 Bacteria 3954
251 nmdc:mga0yw44_100065_c1 3300050492 Bacteria 1845
252 nmdc:mga0yw44_630726_c1 3300050492 Unclassified 728
253 nmdc:mga06z11_262374_c1 3300050494 Bacteria 1020
254 nmdc:mga04h51_91691_c1 3300050495 Bacteria 1094
255 nmdc:mga05p37_21994_c1 3300050507 Bacteria 7726
256 nmdc:mga05p37_99296_c1 3300050507 Bacteria 3585
257 nmdc:mga09592_25203_c1 3300050508 Bacteria 4920
258 nmdc:mga09592_346962_c1 3300050508 Bacteria 1285
259 nmdc:mga09592_50050_c1 3300050508 Bacteria 2008
260 nmdc:mga0qj67_1000943_c1 3300050509 Bacteria 656
261 nmdc:mga0qj67_15853_c1 3300050509 Bacteria 5707
262 nmdc:mga0qj67_20685_c1 3300050509 Bacteria 5040
263 nmdc:mga0qj67_362161_c1 3300050509 Bacteria 1172
264 nmdc:mga06r32_645396_c1 3300050510 Bacteria 1027
265 nmdc:mga06r32_74470_c1 3300050510 Bacteria 3292
266 nmdc:mga08y16_1385_c1 3300050511 Bacteria 24245
267 nmdc:mga08y16_167037_c1 3300050511 Bacteria 2286
268 nmdc:mga08y16_171667_c1 3300050511 Bacteria 2252
269 nmdc:mga08y16_28802_c1 3300050511 Bacteria 5854
270 nmdc:mga08y16_440241_c1 3300050511 Bacteria 1330
271 nmdc:mga08y16_5699_c1 3300050511 Bacteria 13049
272 nmdc:mga0n895_169946_c1 3300050512 Bacteria 2212
273 nmdc:mga0n895_18885_c1 3300050512 Bacteria 6393
274 nmdc:mga0n895_838576_c1 3300050512 Unclassified 908
275 nmdc:mga0rr50_85624_c1 3300050513 Bacteria 2443
276 nmdc:mga0a205_192458_c1 3300050515 Bacteria 1931
277 nmdc:mga0a205_197997_c1 3300050515 Bacteria 1900
278 nmdc:mga0sz30_196718_c1 3300050516 Bacteria 895
279 Ga0495595_0471690 3300053084 Bacteria 639
280 Ga0495619_0253309 3300053085 Unclassified 1220
281 Ga0590071_000038 3300059421 Bacteria 34004
282 Ga0590071_014489 3300059421 Bacteria 1851
283 Ga0590074_000532 3300059423 Bacteria 5710
284 Ga0590075_006669 3300059424 Bacteria 2734
285 Ga0590077_000404 3300059426 Bacteria 12123
286 Ga0501082_0340896 3300060353 Bacteria 1306
287 Ga0451577_0036044
288 JGI24749J21850_1035465
289 Ga0065712_10071733
290 Ga0065712_10262576
291 Ga0065712_10444879
292 Ga0065715_10185031
293 Ga0065707_10217303
294 Ga0065707_10769533
295 Ga0070676_10642755
296 Ga0070683_100057237
297 Ga0070683_100744095
298 Ga0070690_100192347
299 Ga0070670_100023935
300 Ga0070670_100780795
301 Ga0070670_101006509
302 Ga0068869_100440318
303 Ga0070680_100473065
304 Ga0070660_100395456
305 Ga0070689_100011669
306 Ga0070689_100037612
307 Ga0070689_100293521
308 Ga0070691_10079487
309 Ga0070661_100353005
310 Ga0070661_100489626
311 Ga0070668_100732777
312 Ga0070669_100168778
313 Ga0070669_100181480
314 Ga0070669_100217984
315 Ga0070669_100748653
316 Ga0070675_100016847
317 Ga0070675_100017305
318 Ga0070675_100056707
319 Ga0070671_101341978
320 Ga0070674_100892230
321 Ga0070673_100153115
322 Ga0070673_100201055
323 Ga0070673_101449757
324 Ga0070688_100026515
325 Ga0070688_100599492
326 Ga0070659_100962712
327 Ga0070667_101069001
328 Ga0070714_100013292
329 Ga0070701_10054831
330 Ga0070701_10143531
331 Ga0070701_10289871
332 Ga0070705_100001998
333 Ga0070705_100091945
334 Ga0070705_101067121
335 Ga0070694_100041774
336 Ga0070708_100837730
337 Ga0070663_100815402
338 Ga0070678_100897731
339 Ga0070681_10078779
340 Ga0070707_100400162
341 Ga0070698_100233030
342 Ga0070684_100013870
343 Ga0070684_100659670
344 Ga0070672_100393566
345 Ga0070672_100416694
346 Ga0070686_100087778
347 Ga0070686_100185373
348 Ga0070686_100715204
349 Ga0070695_100000104
350 Ga0070695_100023314
351 Ga0070695_100789700
352 Ga0070696_100001760
353 Ga0070704_100074782
354 Ga0070704_101091475
355 Ga0070664_100028284
356 Ga0070664_100158550
357 Ga0070664_100527717
358 Ga0070664_101289950
359 Ga0068857_100785276
360 Ga0068856_100918500
361 Ga0070702_100034627
362 Ga0068859_100047674
363 Ga0068859_100282644
364 Ga0068859_100458470
365 Ga0068859_100728905
366 Ga0068864_100012810
367 Ga0068864_100278432
368 Ga0068864_100347441
369 Ga0068861_100289515
370 Ga0068861_100725782
371 Ga0068870_10078895
372 Ga0068870_10187533
373 Ga0068870_10397320
374 Ga0068863_100999663
375 Ga0068863_101399289
376 Ga0068860_100184536
377 Ga0068862_100341546
378 Ga0068862_100528993
379 Ga0081539_10000013
380 Ga0070717_10053994
381 Ga0075365_10351731
382 Ga0075368_10017111
383 Ga0075363_100050993
384 Ga0075364_10042210
385 Ga0097621_100455501
386 Ga0075370_10003157
387 Ga0075428_100021549
388 Ga0075428_100388124
389 Ga0075428_101135074
390 Ga0075430_100007165
391 Ga0075430_100088654
392 Ga0075430_100440307
393 Ga0075431_100334436
394 Ga0075431_100510273
395 Ga0075431_101268544
396 Ga0075433_10060192
397 Ga0075434_100007917
398 Ga0075434_100127096
399 Ga0075434_100979109
400 Ga0075429_100111583
401 Ga0097620_100047674
402 Ga0097620_100282657
403 Ga0097620_100458532
404 Ga0097620_100718311
405 Ga0097620_100728963
406 Ga0075435_100096700
407 Ga0105240_10038745
408 Ga0105240_10094332
409 Ga0111539_10000921
410 Ga0111539_10001210
411 Ga0111539_10004658
412 Ga0111539_10336300
413 Ga0111539_12430736
414 Ga0114129_10277195
415 Ga0114129_10409041
416 Ga0105243_10615365
417 Ga0105248_10418298
418 Ga0105248_10740860
419 Ga0105238_10568179
420 Ga0105249_10203793
421 Ga0105249_10474837
422 Ga0163163_10039558
423 Ga0163163_10091562
424 Ga0157380_10233668
425 Ga0157380_10286606
426 Ga0157377_10037375
427 Ga0157377_10039725
428 Ga0206356_10017952
429 Ga0207645_10175879
430 Ga0207643_10110214
431 Ga0207707_10118569
432 Ga0207695_10460863
433 Ga0207660_10098498
434 Ga0207660_10795653
435 Ga0207662_10103218
436 Ga0207649_10146929
437 Ga0207646_10617309
438 Ga0207681_10060014
439 Ga0207681_10216636
440 Ga0207681_10715657
441 Ga0207681_10792323
442 Ga0207650_10004887
443 Ga0207650_10050398
444 Ga0207650_10712409
445 Ga0207659_10010654
446 Ga0207659_10042760
447 Ga0207659_10112728
448 Ga0207706_10259344
449 Ga0207709_10213011
450 Ga0207670_10113702
451 Ga0207669_10622656
452 Ga0207691_10227024
453 Ga0207691_10629641
454 Ga0207711_10401222
455 Ga0207711_11172030
456 Ga0207689_10164935
457 Ga0207661_10289513
458 Ga0207679_10014536
459 Ga0207679_10047465
460 Ga0207679_10057535
461 Ga0207679_10083459
462 Ga0207651_10025798
463 Ga0207651_10443959
464 Ga0207708_10199623
465 Ga0207708_10303801
466 Ga0207702_10826208
467 Ga0207641_10858205
468 Ga0207648_10396695
469 Ga0207676_10438041
470 Ga0207674_10961184
471 Ga0207675_100136028
472 Ga0207675_100251992
473 Ga0209813_10025027
474 Ga0209974_10021330
475 Ga0207428_10003244
476 Ga0207428_10014348
477 Ga0207428_10042402
478 Ga0207428_10302805
479 Ga0207428_10472094
480 Ga0268265_10142891
481 Ga0268265_11026247
482 Ga0307513_10242702
483 Ga0307408_101984181
484 Ga0307410_10889208
485 Ga0307412_10329330
486 Ga0307416_100099077
487 Ga0307416_101886924
488 Ga0307411_10028247
489 Ga0373923_0263753
490 Ga0373955_0150476
491 Ga0373924_0031085
492 Ga0373937_0263713
493 Ga0373925_1166310
494 Ga0450908_078843
495 Ga0439435_0057417
496 Ga0450916_024528
497 Ga0453684_0234944
498 Ga0451576_0020565
499 Ga0451576_1688933
500 Ga0495629_0053954
501 Ga0495639_0223164
502 Ga0495662_0149329
503 Ga0495664_0476544
504 Ga0495596_0165713
505 Ga0495643_0003172
506 Ga0495663_0123159
507 Ga0495598_0015350
508 Ga0495621_0054972
509 Ga0495634_0367442
510 Ga0495635_0150363
511 Ga0495659_0331252
512 Ga0495658_0039133
513 Ga0495604_1015916
514 Ga0495636_0113147
515 Ga0495674_0568723
516 Ga0495676_0104553
517 Ga0496105_0491614
518 Ga0496109_0447050
519 Ga0496109_1050541
520 Ga0496112_0085631
521 Ga0496113_0595238
522 Ga0501037_0341469
523 Ga0501041_0341660
524 Ga0501046_0066510
525 Ga0501067_0045588
526 Ga0501069_0457218
527 Ga0501071_0066610
528 Ga0501072_0192981
529 Ga0501073_0170823
530 Ga0501075_0071381
531 Ga0501076_0068977
532 Ga0501077_0064589
533 Ga0501080_0035192
534 Ga0501081_0049882
535 Ga0501045_0038989
536 nmdc:mga00v17_18557_c1
537 nmdc:mga0yw44_100065_c1
538 nmdc:mga0yw44_630726_c1
539 nmdc:mga06z11_262374_c1
540 nmdc:mga04h51_91691_c1
541 nmdc:mga05p37_21994_c1
542 nmdc:mga05p37_99296_c1
543 nmdc:mga09592_25203_c1
544 nmdc:mga09592_346962_c1
545 nmdc:mga09592_50050_c1
546 nmdc:mga0qj67_1000943_c1
547 nmdc:mga0qj67_15853_c1
548 nmdc:mga0qj67_20685_c1
549 nmdc:mga0qj67_362161_c1
550 nmdc:mga06r32_645396_c1
551 nmdc:mga06r32_74470_c1
552 nmdc:mga08y16_1385_c1
553 nmdc:mga08y16_167037_c1
554 nmdc:mga08y16_171667_c1
555 nmdc:mga08y16_28802_c1
556 nmdc:mga08y16_440241_c1
557 nmdc:mga08y16_5699_c1
558 nmdc:mga0n895_169946_c1
559 nmdc:mga0n895_18885_c1
560 nmdc:mga0n895_838576_c1
561 nmdc:mga0rr50_85624_c1
562 nmdc:mga0a205_192458_c1
563 nmdc:mga0a205_197997_c1
564 nmdc:mga0sz30_196718_c1
565 Ga0495595_0471690
566 Ga0495619_0253309
567 Ga0590071_000038
568 Ga0590071_014489
569 Ga0590074_000532
570 Ga0590075_006669
571 Ga0590077_000404
572 Ga0501082_0340896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iih-assembly1.cif.gz_A crystal structure of mouse bcl-xl (wt) at ph 6.0 0.3344 20 161
1r2h-assembly1.cif.gz_A human bcl-xl containing an ala to leu mutation at position 142 0.3268 18 170
2jcn-assembly1.cif.gz_A the crystal structure of bak1 - a mitochondrial apoptosis regulator 0.3255 22 170
5b26-assembly1.cif.gz_B crystal structure of mouse sel1l 0.3162 74 169
8f5h-assembly1.cif.gz_A sars-cov-2 s2 helix epitope scaffold 0.3009 83 161
ID Description Score Start End Superfamily
af_Q8INF0_1_188_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.4356 83 153 3.90.1520.10
4dalH01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.4298 3 64 3.40.605.10
af_Q9W0T9_3_258_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4211 17 133 3.10.450.50
af_O02298_1_195_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.3798 82 159 3.90.1520.10
af_Q54SL6_2_265_1.10.555.10 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.3514 6 155 1.10.555.10
ID Description Score Start End GO Terms
AF-A0A3N5YFP4-F1-model_v4 Uncharacterized protein 0.9554 9 161
AF-A0A521TC89-F1-model_v4 Uncharacterized protein 0.9448 7 165
AF-A0A1F2U2G6-F1-model_v4 Uncharacterized protein 0.9361 17 167
AF-A0A2V8EE98-F1-model_v4 Uncharacterized protein 0.9311 88 164
AF-A0A1F2U2G6-F1-model_v4 Uncharacterized protein 0.9302 17 167

Map