F387308

General Info

Members Datasets Scaffolds Average Seq Length
286 208 572 296

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100055666|Ga0070672_1000556663
Length 340
Sequence MNRRPDVYGAEEDRLLYVVTVEQGTAPGAPDAGYHAPTASAEPPPALYAIEHDTRYVYDSPVSTSQHMACLRPRPLPRQQVQSFDLRIVPEPSQVAERHDYFGNVVHQFQLLRPHIELRVVSRSLVQVSARGQVAPDSSPPWEEVRTALSQQGGAVAQDVAPFAYASPHVIRAPELARFARPSFPARRPLLLAALDLMHRIHAEFVFDSSATNVATPVTRVLVDRRGVCQDFAHFQIACLRSLGLAARYVSGYLLTDPPSGQPRLIGADASHAWLSVYCPQHGWVDLDPTNDVIVDQRHVTIGWGRDYGDVSPLRGVLLGGAGHRLFVGVSVVPQEASLP

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
205 2506520008 Serratia plymuthica AS12 Isolate Unclassified
206 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
207 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
208 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 2.8
Rhizosphere 83.22
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100055666 3300005543 Bacteria 3099
2 JGI24735J21928_10044725 3300002067 Bacteria 1286
3 rootH2_10005398 3300003320 Bacteria 97640
4 rootL2_10183489 3300003322 Bacteria 4844
5 rootL2_10203815 3300003322 Bacteria 2632
6 rootL2_10336388 3300003322 Bacteria 1417
7 rootH1_10107356 3300003323 Bacteria 3198
8 rootH1_10221088 3300003323 Bacteria 1720
9 Ga0065707_10155917 3300005295 Bacteria 1607
10 Ga0070670_100101787 3300005331 Bacteria 2473
11 Ga0068869_100205259 3300005334 Bacteria 1556
12 Ga0070689_100001948 3300005340 Bacteria 13378
13 Ga0070689_100300242 3300005340 Bacteria 1336
14 Ga0070687_100135218 3300005343 Unclassified 1428
15 Ga0070688_100096784 3300005365 Bacteria 1939
16 Ga0070667_100060054 3300005367 Bacteria 3217
17 Ga0070667_100396332 3300005367 Bacteria 1256
18 Ga0070694_100055708 3300005444 Bacteria 2682
19 Ga0070708_100050039 3300005445 Bacteria 3699
20 Ga0070662_100122859 3300005457 Bacteria 1992
21 Ga0068867_100150532 3300005459 Bacteria 1827
22 Ga0068867_100250912 3300005459 Bacteria 1439
23 Ga0068867_100539257 3300005459 Bacteria 1009
24 Ga0070685_10002795 3300005466 Bacteria 8917
25 Ga0070707_100170205 3300005468 Bacteria 2123
26 Ga0070698_100055848 3300005471 Bacteria 4002
27 Ga0068853_100000017 3300005539 Bacteria 170544
28 Ga0070686_100036242 3300005544 Unclassified 3053
29 Ga0070665_100003210 3300005548 Bacteria 17587
30 Ga0070665_100097300 3300005548 Bacteria 2948
31 Ga0070665_100410183 3300005548 Bacteria 1363
32 Ga0068855_100000076 3300005563 Bacteria 118910
33 Ga0068855_100089815 3300005563 Bacteria 3546
34 Ga0068857_100178730 3300005577 Bacteria 1931
35 Ga0068854_100013425 3300005578 Bacteria 5377
36 Ga0068856_100000649 3300005614 Bacteria 37712
37 Ga0068852_100130679 3300005616 Bacteria 2312
38 Ga0068859_100018117 3300005617 Bacteria 7078
39 Ga0068859_100040448 3300005617 Bacteria 4680
40 Ga0068859_100257821 3300005617 Bacteria 1835
41 Ga0068864_100411555 3300005618 Bacteria 1287
42 Ga0068858_100009016 3300005842 Bacteria 9541
43 Ga0081538_10019490 3300005981 Bacteria 5038
44 Ga0070717_10216749 3300006028 Bacteria 1681
45 Ga0075365_10047661 3300006038 Bacteria 2817
46 Ga0075364_10009423 3300006051 Bacteria 5858
47 Ga0075364_10028935 3300006051 Bacteria 3549
48 Ga0075367_10230065 3300006178 Bacteria 1161
49 Ga0097621_100190961 3300006237 Bacteria 1774
50 Ga0097621_100245585 3300006237 Bacteria 1566
51 Ga0097621_100353183 3300006237 Bacteria 1308
52 Ga0068871_100012219 3300006358 Bacteria 6321
53 Ga0075434_100025080 3300006871 Bacteria 5832
54 Ga0068865_100072341 3300006881 Bacteria 2449
55 Ga0097620_100018117 3300006931 Bacteria 7078
56 Ga0097620_100040448 3300006931 Bacteria 4680
57 Ga0097620_100257802 3300006931 Bacteria 1835
58 Ga0075435_100003126 3300007076 Bacteria 11185
59 Ga0099794_10103404 3300007265 Bacteria 1423
60 Ga0105251_10002081 3300009011 Bacteria 16156
61 Ga0105250_10001542 3300009092 Bacteria 12374
62 Ga0105240_10001953 3300009093 Bacteria 34136
63 Ga0105240_10003255 3300009093 Bacteria 25406
64 Ga0105240_10049793 3300009093 Bacteria 5285
65 Ga0111539_10014474 3300009094 Bacteria 9846
66 Ga0111539_10068544 3300009094 Bacteria 4188
67 Ga0111539_10109015 3300009094 Unclassified 3249
68 Ga0111539_10459824 3300009094 Bacteria 1482
69 Ga0105245_10030543 3300009098 Bacteria 4765
70 Ga0105247_10000935 3300009101 Bacteria 21999
71 Ga0105247_10163257 3300009101 Bacteria 1476
72 Ga0114129_10131296 3300009147 Bacteria 3440
73 Ga0105243_10227788 3300009148 Bacteria 1651
74 Ga0105248_10040385 3300009177 Bacteria 5229
75 Ga0105248_10051101 3300009177 Bacteria 4639
76 Ga0105248_10301669 3300009177 Bacteria 1804
77 Ga0105237_10028631 3300009545 Bacteria 5672
78 Ga0105238_10013951 3300009551 Bacteria 8125
79 Ga0105249_10030947 3300009553 Bacteria 4838
80 Ga0105249_10236477 3300009553 Bacteria 1804
81 Ga0105239_10221888 3300010375 Bacteria 2120
82 Ga0157371_10024203 3300013102 Bacteria 4436
83 Ga0157369_10017817 3300013105 Bacteria 7971
84 Ga0157369_10226414 3300013105 Bacteria 1956
85 Ga0157374_10000023 3300013296 Bacteria 265247
86 Ga0182008_10021463 3300014497 Bacteria 3315
87 Ga0157379_10001150 3300014968 Bacteria 21579
88 Ga0157376_10001153 3300014969 Bacteria 17368
89 Ga0157376_10251386 3300014969 Bacteria 1651
90 Ga0163161_10000005 3300017792 Bacteria 327860
91 Ga0213871_10002379 3300021441 Bacteria 3454
92 Ga0209672_100205 3300025228 Bacteria 46968
93 Ga0209233_1011031 3300025261 Bacteria 2677
94 Ga0207656_10041860 3300025321 Bacteria 1947
95 Ga0207696_1000039 3300025711 Bacteria 324954
96 Ga0207713_1000095 3300025735 Bacteria 145778
97 Ga0207710_10000026 3300025900 Bacteria 307644
98 Ga0207647_10000199 3300025904 Bacteria 49178
99 Ga0207695_10000007 3300025913 Bacteria 1092551
100 Ga0207695_10006176 3300025913 Bacteria 15613
101 Ga0207695_10065322 3300025913 Bacteria 3741
102 Ga0207671_10005168 3300025914 Bacteria 12137
103 Ga0207671_10077026 3300025914 Bacteria 2496
104 Ga0207694_10000425 3300025924 Bacteria 39177
105 Ga0207694_10002359 3300025924 Bacteria 15444
106 Ga0207650_10015823 3300025925 Bacteria 5260
107 Ga0207687_10075580 3300025927 Unclassified 2418
108 Ga0207644_10187022 3300025931 Bacteria 1627
109 Ga0207670_10050015 3300025936 Bacteria 2799
110 Ga0207704_10041085 3300025938 Bacteria 2708
111 Ga0207691_10053523 3300025940 Bacteria 3685
112 Ga0207691_10224599 3300025940 Bacteria 1627
113 Ga0207689_10008493 3300025942 Bacteria 8950
114 Ga0207689_10166236 3300025942 Bacteria 1818
115 Ga0207667_10050601 3300025949 Bacteria 4383
116 Ga0207667_10079396 3300025949 Bacteria 3401
117 Ga0207712_10000204 3300025961 Bacteria 59857
118 Ga0207712_10141872 3300025961 Bacteria 1845
119 Ga0207640_10022405 3300025981 Bacteria 3780
120 Ga0207658_10119102 3300025986 Bacteria 2101
121 Ga0207703_10001254 3300026035 Bacteria 23768
122 Ga0207639_10000031 3300026041 Bacteria 170640
123 Ga0207639_10001552 3300026041 Bacteria 15409
124 Ga0207702_10000965 3300026078 Bacteria 29560
125 Ga0207676_10141517 3300026095 Bacteria 2060
126 Ga0207674_10162153 3300026116 Bacteria 2190
127 Ga0207683_10278839 3300026121 Bacteria 1527
128 Ga0207698_10130048 3300026142 Bacteria 2150
129 Ga0209813_10018169 3300027866 Bacteria 1939
130 Ga0268266_10000006 3300028379 Bacteria 1410021
131 Ga0268264_10088147 3300028381 Bacteria 2670
132 Ga0265337_1060755 3300028556 Bacteria 1048
133 Ga0265326_10001301 3300028558 Bacteria 8859
134 Ga0265318_10024034 3300028577 Bacteria 2423
135 Ga0265323_10058657 3300028653 Bacteria 1343
136 Ga0265322_10006846 3300028654 Bacteria 3343
137 Ga0265336_10008127 3300028666 Unclassified 3696
138 Ga0265324_10004248 3300029957 Bacteria 6549
139 Ga0265330_10004500 3300031235 Bacteria 7068
140 Ga0265332_10027435 3300031238 Unclassified 2495
141 Ga0265332_10028456 3300031238 Bacteria 2446
142 Ga0265320_10007758 3300031240 Bacteria 6631
143 Ga0265325_10011545 3300031241 Bacteria 5073
144 Ga0265325_10063862 3300031241 Bacteria 1862
145 Ga0265325_10093630 3300031241 Unclassified 1478
146 Ga0265329_10000062 3300031242 Bacteria 47661
147 Ga0265339_10035389 3300031249 Unclassified 2802
148 Ga0265331_10033830 3300031250 Bacteria 2525
149 Ga0265316_10000235 3300031344 Bacteria 63962
150 Ga0265316_10000703 3300031344 Bacteria 37060
151 Ga0265316_10014054 3300031344 Bacteria 7069
152 Ga0265316_10119486 3300031344 Bacteria 1991
153 Ga0265316_10224679 3300031344 Bacteria 1384
154 Ga0307509_10000088 3300031507 Bacteria 126453
155 Ga0265313_10062062 3300031595 Bacteria 1747
156 Ga0307508_10002165 3300031616 Bacteria 21043
157 Ga0316579_10094867 3300031691 Bacteria 1426
158 Ga0265314_10077450 3300031711 Unclassified 2205
159 Ga0265342_10000486 3300031712 Bacteria 43046
160 Ga0316576_10002755 3300031727 Bacteria 10081
161 Ga0316576_10009356 3300031727 Bacteria 6315
162 Ga0316576_10024604 3300031727 Bacteria 4205
163 Ga0316578_10007958 3300031728 Bacteria 5356
164 Ga0316578_10091760 3300031728 Unclassified 1814
165 Ga0307516_10007627 3300031730 Bacteria 12394
166 Ga0373934_0025895 3300035086 Bacteria 2274
167 Ga0373954_0008899 3300035118 Bacteria 4417
168 Ga0373956_0013534 3300035119 Bacteria 3394
169 Ga0373956_0074037 3300035119 Bacteria 1557
170 Ga0373943_0080003 3300035170 Bacteria 1674
171 Ga0373955_0011205 3300035172 Bacteria 4263
172 Ga0373955_0030846 3300035172 Bacteria 2803
173 Ga0316574_0011751 3300035398 Unclassified 4986
174 Ga0316574_0046045 3300035398 Unclassified 2703
175 Ga0373935_0106187 3300035692 Bacteria 1858
176 Ga0373935_0373915 3300035692 Bacteria 1019
177 Ga0373927_0060826 3300035695 Bacteria 2444
178 Ga0373947_0043159 3300035725 Bacteria 2693
179 Ga0373937_0014123 3300036401 Bacteria 7043
180 Ga0316582_0112416 3300036647 Bacteria 1814
181 Ga0316582_0182146 3300036647 Bacteria 1429
182 Ga0316584_0006440 3300036712 Bacteria 7946
183 Ga0316584_0264762 3300036712 Unclassified 1253
184 Ga0373925_0010359 3300037068 Bacteria 6764
185 Ga0373925_0036488 3300037068 Bacteria 3628
186 Ga0395899_0135457 3300037312 Bacteria 1756
187 Ga0395900_0009865 3300037418 Bacteria 9781
188 Ga0395900_0034384 3300037418 Bacteria 5219
189 Ga0395898_0132349 3300037466 Bacteria 2388
190 Ga0395905_0000653 3300037471 Bacteria 46132
191 Ga0395905_0100269 3300037471 Bacteria 2719
192 Ga0395905_0204804 3300037471 Bacteria 1849
193 Ga0436364_0390292 3300037853 Bacteria 6240
194 Ga0436364_0845226 3300037853 Unclassified 1414
195 Ga0395901_0021859 3300038443 Bacteria 6556
196 Ga0436365_0109023 3300039437 Bacteria 4449
197 Ga0436365_0160439 3300039437 Bacteria 1493
198 Ga0436360_1017961 3300039438 Bacteria 4183
199 Ga0436361_0093144 3300039447 Bacteria 7370
200 Ga0436362_0044358 3300039453 Bacteria 9252
201 Ga0451797_0506398 3300041453 Bacteria 2750
202 Ga0451807_0768403 3300041486 Bacteria 5036
203 Ga0451855_0812145 3300041511 Unclassified 1423
204 Ga0466969_0027336 3300044656 Bacteria 2921
205 Ga0466966_0087732 3300044684 Bacteria 1933
206 Ga0466961_0049575 3300044693 Bacteria 2683
207 Ga0466970_0080442 3300044765 Bacteria 1761
208 Ga0466960_0063326 3300044901 Bacteria 1820
209 Ga0466959_0086128 3300045049 Bacteria 2260
210 Ga0451576_0083872 3300045051 Bacteria 3315
211 Ga0451576_0363138 3300045051 Unclassified 1517
212 Ga0495627_000086 3300046453 Bacteria 111555
213 Ga0495618_0005803 3300046514 Bacteria 7505
214 Ga0495628_0011548 3300046516 Bacteria 7467
215 Ga0495630_0004611 3300046517 Bacteria 9663
216 Ga0495630_0039158 3300046517 Bacteria 3545
217 Ga0495666_0074002 3300046526 Bacteria 1616
218 Ga0495634_0082170 3300046642 Bacteria 2106
219 Ga0495624_0076344 3300046690 Bacteria 2079
220 Ga0495680_0041349 3300047322 Bacteria 3667
221 Ga0496107_0342745 3300048910 Bacteria 1112
222 Ga0496110_0420206 3300048913 Bacteria 1219
223 Ga0496114_0027307 3300048917 Bacteria 4674
224 Ga0496114_0309469 3300048917 Bacteria 1395
225 Ga0496114_0515937 3300048917 Bacteria 1057
226 Ga0496115_0511032 3300048918 Bacteria 964
227 Ga0496116_0000007 3300048919 Bacteria 795464
228 Ga0496117_0000569 3300048920 Bacteria 60550
229 Ga0496119_0050873 3300048922 Bacteria 2550
230 Ga0496119_0124005 3300048922 Bacteria 1416
231 Ga0496120_0038367 3300048923 Bacteria 2834
232 Ga0496121_0075771 3300048924 Bacteria 2686
233 Ga0501032_0120127 3300049569 Bacteria 1737
234 Ga0501033_0030760 3300049570 Bacteria 4034
235 Ga0501034_0143096 3300049571 Bacteria 2370
236 Ga0501036_0138300 3300049572 Bacteria 2055
237 Ga0501037_0007819 3300049573 Bacteria 7829
238 Ga0501038_0002893 3300049574 Bacteria 16010
239 Ga0501043_0137964 3300049579 Bacteria 1910
240 Ga0501046_0007704 3300049580 Bacteria 9441
241 Ga0501048_0005788 3300049582 Bacteria 9398
242 Ga0501067_0016784 3300049583 Bacteria 4046
243 Ga0501067_0095835 3300049583 Bacteria 1648
244 Ga0501068_0024179 3300049584 Bacteria 3566
245 Ga0501069_0158355 3300049585 Bacteria 1303
246 Ga0501070_0000027 3300049586 Bacteria 141004
247 Ga0501070_0080322 3300049586 Bacteria 2698
248 Ga0501073_0000339 3300049589 Bacteria 31473
249 Ga0501073_0040452 3300049589 Bacteria 3299
250 Ga0501073_0066201 3300049589 Bacteria 2519
251 Ga0501073_0088711 3300049589 Bacteria 2150
252 Ga0501073_0099291 3300049589 Bacteria 2021
253 Ga0501073_0108427 3300049589 Bacteria 1927
254 Ga0501074_0014800 3300049590 Bacteria 5675
255 Ga0501074_0059681 3300049590 Bacteria 2748
256 Ga0501074_0200845 3300049590 Bacteria 1421
257 Ga0501080_0019864 3300049742 Bacteria 6221
258 Ga0501080_0189721 3300049742 Bacteria 1889
259 Ga0501083_0007889 3300049744 Bacteria 7539
260 Ga0501083_0098160 3300049744 Bacteria 1932
261 nmdc:mga00v17_2147_c1 3300050491 Bacteria 10134
262 nmdc:mga00v17_42520_c1 3300050491 Bacteria 2734
263 nmdc:mga06z11_199922_c1 3300050494 Bacteria 1160
264 nmdc:mga06z11_29840_c1 3300050494 Bacteria 2632
265 nmdc:mga04h51_26002_c1 3300050495 Bacteria 1806
266 nmdc:mga07m45_107643_c1 3300050496 Bacteria 1604
267 nmdc:mga08y16_58863_c1 3300050511 Bacteria 4014
268 nmdc:mga0n895_14770_c1 3300050512 Bacteria 7104
269 nmdc:mga0rr50_9488_c1 3300050513 Bacteria 6121
270 nmdc:mga08x19_205074_c1 3300050514 Bacteria 1352
271 Ga0495595_0008021 3300053084 Bacteria 4326
272 Ga0500651_0125789 3300053093 Bacteria 1553
273 Ga0500555_003427 3300053103 Bacteria 4520
274 Ga0500616_0000449 3300053153 Bacteria 53975
275 Ga0500611_035458 3300053727 Bacteria 1063
276 Ga0500645_000248 3300053730 Bacteria 40377
277 Ga0501084_0060944 3300054114 Bacteria 3159
278 Ga0501082_0007281 3300060353 Bacteria 9545
279 Ga0501082_0090672 3300060353 Bacteria 2639
280 Ga0466962_0211959 3300061719 Bacteria 948
281 Ga0530510_0209797 3300061734 Bacteria 1447
282 2506579783 2506520007 Bacteria 5442880
283 2506584922 2506520008 Bacteria 5443009
284 2656278231 2654587920 Bacteria 5475511
285 2689446312 2687453601 Bacteria 5546041
286 2869555680 2869551831 Bacteria 5474685
287 Ga0070672_100055666
288 JGI24735J21928_10044725
289 rootH2_10005398
290 rootL2_10183489
291 rootL2_10203815
292 rootL2_10336388
293 rootH1_10107356
294 rootH1_10221088
295 Ga0065707_10155917
296 Ga0070670_100101787
297 Ga0068869_100205259
298 Ga0070689_100001948
299 Ga0070689_100300242
300 Ga0070687_100135218
301 Ga0070688_100096784
302 Ga0070667_100060054
303 Ga0070667_100396332
304 Ga0070694_100055708
305 Ga0070708_100050039
306 Ga0070662_100122859
307 Ga0068867_100150532
308 Ga0068867_100250912
309 Ga0068867_100539257
310 Ga0070685_10002795
311 Ga0070707_100170205
312 Ga0070698_100055848
313 Ga0068853_100000017
314 Ga0070686_100036242
315 Ga0070665_100003210
316 Ga0070665_100097300
317 Ga0070665_100410183
318 Ga0068855_100000076
319 Ga0068855_100089815
320 Ga0068857_100178730
321 Ga0068854_100013425
322 Ga0068856_100000649
323 Ga0068852_100130679
324 Ga0068859_100018117
325 Ga0068859_100040448
326 Ga0068859_100257821
327 Ga0068864_100411555
328 Ga0068858_100009016
329 Ga0081538_10019490
330 Ga0070717_10216749
331 Ga0075365_10047661
332 Ga0075364_10009423
333 Ga0075364_10028935
334 Ga0075367_10230065
335 Ga0097621_100190961
336 Ga0097621_100245585
337 Ga0097621_100353183
338 Ga0068871_100012219
339 Ga0075434_100025080
340 Ga0068865_100072341
341 Ga0097620_100018117
342 Ga0097620_100040448
343 Ga0097620_100257802
344 Ga0075435_100003126
345 Ga0099794_10103404
346 Ga0105251_10002081
347 Ga0105250_10001542
348 Ga0105240_10001953
349 Ga0105240_10003255
350 Ga0105240_10049793
351 Ga0111539_10014474
352 Ga0111539_10068544
353 Ga0111539_10109015
354 Ga0111539_10459824
355 Ga0105245_10030543
356 Ga0105247_10000935
357 Ga0105247_10163257
358 Ga0114129_10131296
359 Ga0105243_10227788
360 Ga0105248_10040385
361 Ga0105248_10051101
362 Ga0105248_10301669
363 Ga0105237_10028631
364 Ga0105238_10013951
365 Ga0105249_10030947
366 Ga0105249_10236477
367 Ga0105239_10221888
368 Ga0157371_10024203
369 Ga0157369_10017817
370 Ga0157369_10226414
371 Ga0157374_10000023
372 Ga0182008_10021463
373 Ga0157379_10001150
374 Ga0157376_10001153
375 Ga0157376_10251386
376 Ga0163161_10000005
377 Ga0213871_10002379
378 Ga0209672_100205
379 Ga0209233_1011031
380 Ga0207656_10041860
381 Ga0207696_1000039
382 Ga0207713_1000095
383 Ga0207710_10000026
384 Ga0207647_10000199
385 Ga0207695_10000007
386 Ga0207695_10006176
387 Ga0207695_10065322
388 Ga0207671_10005168
389 Ga0207671_10077026
390 Ga0207694_10000425
391 Ga0207694_10002359
392 Ga0207650_10015823
393 Ga0207687_10075580
394 Ga0207644_10187022
395 Ga0207670_10050015
396 Ga0207704_10041085
397 Ga0207691_10053523
398 Ga0207691_10224599
399 Ga0207689_10008493
400 Ga0207689_10166236
401 Ga0207667_10050601
402 Ga0207667_10079396
403 Ga0207712_10000204
404 Ga0207712_10141872
405 Ga0207640_10022405
406 Ga0207658_10119102
407 Ga0207703_10001254
408 Ga0207639_10000031
409 Ga0207639_10001552
410 Ga0207702_10000965
411 Ga0207676_10141517
412 Ga0207674_10162153
413 Ga0207683_10278839
414 Ga0207698_10130048
415 Ga0209813_10018169
416 Ga0268266_10000006
417 Ga0268264_10088147
418 Ga0265337_1060755
419 Ga0265326_10001301
420 Ga0265318_10024034
421 Ga0265323_10058657
422 Ga0265322_10006846
423 Ga0265336_10008127
424 Ga0265324_10004248
425 Ga0265330_10004500
426 Ga0265332_10027435
427 Ga0265332_10028456
428 Ga0265320_10007758
429 Ga0265325_10011545
430 Ga0265325_10063862
431 Ga0265325_10093630
432 Ga0265329_10000062
433 Ga0265339_10035389
434 Ga0265331_10033830
435 Ga0265316_10000235
436 Ga0265316_10000703
437 Ga0265316_10014054
438 Ga0265316_10119486
439 Ga0265316_10224679
440 Ga0307509_10000088
441 Ga0265313_10062062
442 Ga0307508_10002165
443 Ga0316579_10094867
444 Ga0265314_10077450
445 Ga0265342_10000486
446 Ga0316576_10002755
447 Ga0316576_10009356
448 Ga0316576_10024604
449 Ga0316578_10007958
450 Ga0316578_10091760
451 Ga0307516_10007627
452 Ga0373934_0025895
453 Ga0373954_0008899
454 Ga0373956_0013534
455 Ga0373956_0074037
456 Ga0373943_0080003
457 Ga0373955_0011205
458 Ga0373955_0030846
459 Ga0316574_0011751
460 Ga0316574_0046045
461 Ga0373935_0106187
462 Ga0373935_0373915
463 Ga0373927_0060826
464 Ga0373947_0043159
465 Ga0373937_0014123
466 Ga0316582_0112416
467 Ga0316582_0182146
468 Ga0316584_0006440
469 Ga0316584_0264762
470 Ga0373925_0010359
471 Ga0373925_0036488
472 Ga0395899_0135457
473 Ga0395900_0009865
474 Ga0395900_0034384
475 Ga0395898_0132349
476 Ga0395905_0000653
477 Ga0395905_0100269
478 Ga0395905_0204804
479 Ga0436364_0390292
480 Ga0436364_0845226
481 Ga0395901_0021859
482 Ga0436365_0109023
483 Ga0436365_0160439
484 Ga0436360_1017961
485 Ga0436361_0093144
486 Ga0436362_0044358
487 Ga0451797_0506398
488 Ga0451807_0768403
489 Ga0451855_0812145
490 Ga0466969_0027336
491 Ga0466966_0087732
492 Ga0466961_0049575
493 Ga0466970_0080442
494 Ga0466960_0063326
495 Ga0466959_0086128
496 Ga0451576_0083872
497 Ga0451576_0363138
498 Ga0495627_000086
499 Ga0495618_0005803
500 Ga0495628_0011548
501 Ga0495630_0004611
502 Ga0495630_0039158
503 Ga0495666_0074002
504 Ga0495634_0082170
505 Ga0495624_0076344
506 Ga0495680_0041349
507 Ga0496107_0342745
508 Ga0496110_0420206
509 Ga0496114_0027307
510 Ga0496114_0309469
511 Ga0496114_0515937
512 Ga0496115_0511032
513 Ga0496116_0000007
514 Ga0496117_0000569
515 Ga0496119_0050873
516 Ga0496119_0124005
517 Ga0496120_0038367
518 Ga0496121_0075771
519 Ga0501032_0120127
520 Ga0501033_0030760
521 Ga0501034_0143096
522 Ga0501036_0138300
523 Ga0501037_0007819
524 Ga0501038_0002893
525 Ga0501043_0137964
526 Ga0501046_0007704
527 Ga0501048_0005788
528 Ga0501067_0016784
529 Ga0501067_0095835
530 Ga0501068_0024179
531 Ga0501069_0158355
532 Ga0501070_0000027
533 Ga0501070_0080322
534 Ga0501073_0000339
535 Ga0501073_0040452
536 Ga0501073_0066201
537 Ga0501073_0088711
538 Ga0501073_0099291
539 Ga0501073_0108427
540 Ga0501074_0014800
541 Ga0501074_0059681
542 Ga0501074_0200845
543 Ga0501080_0019864
544 Ga0501080_0189721
545 Ga0501083_0007889
546 Ga0501083_0098160
547 nmdc:mga00v17_2147_c1
548 nmdc:mga00v17_42520_c1
549 nmdc:mga06z11_199922_c1
550 nmdc:mga06z11_29840_c1
551 nmdc:mga04h51_26002_c1
552 nmdc:mga07m45_107643_c1
553 nmdc:mga08y16_58863_c1
554 nmdc:mga0n895_14770_c1
555 nmdc:mga0rr50_9488_c1
556 nmdc:mga08x19_205074_c1
557 Ga0495595_0008021
558 Ga0500651_0125789
559 Ga0500555_003427
560 Ga0500616_0000449
561 Ga0500611_035458
562 Ga0500645_000248
563 Ga0501084_0060944
564 Ga0501082_0007281
565 Ga0501082_0090672
566 Ga0466962_0211959
567 Ga0530510_0209797
568 2506579783
569 2506584922
570 2656278231
571 2689446312
572 2869555680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08379

Bact_transglu_N

Bacterial transglutaminase-like N-terminal region

48

127

0.99

PF01841

Transglut_core

Transglutaminase-like superfamily

179

289

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.8354 2 294
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.7658 2 294
4ktr-assembly4.cif.gz_H crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with isofagomine and glycerol 0.7117 42 85
4ktp-assembly1.cif.gz_B crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose 0.6979 43 85
7pjo-assembly1.cif.gz_AAA crystal form 3 of cpr-c4: a cysteine protease from the candidate phyla radiation 0.6959 133 246
ID Description Score Start End Superfamily
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.9383 120 283 3.10.620.30
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8534 120 283 3.10.620.30
af_P71734_77_269_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8295 89 283 3.10.620.30
3isrD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7887 7 88 2.60.40.2250
af_P71734_77_269_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7856 89 283 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A192A4U8-F1-model_v4 Transglutaminase 0.9967 1 295
AF-F6GAP9-F1-model_v4 Transglutaminase-like enzyme protein 0.9943 2 295
AF-A0A192A4U8-F1-model_v4 Transglutaminase 0.9934 1 295
AF-A0A5C8AED6-F1-model_v4 deleted 0.9928 1 293
AF-F6GAP9-F1-model_v4 Transglutaminase-like enzyme protein 0.9876 2 295

Map