F385635

General Info

Members Datasets Scaffolds Average Seq Length
283 220 566 78

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10302364|Ga0207683_103023644
Length 94
Sequence MPMAAEEIETMIVAAIPDAMVEIRDLAGDGDHYAARVVSASFAGMSRVRQHQLVYKALQGVWGANFTHCSLRPQCHRETICERHQGAHRRAGAE

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
156 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 5.65
Rhizosphere 81.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10302364 3300026121 Bacteria 1464
2 JGI24746J21847_1004158 3300001977 Bacteria 2286
3 JGI24750J21931_1013997 3300002070 Bacteria 1076
4 JGI24748J21848_1015090 3300002074 Bacteria 917
5 JGI24738J21930_10056529 3300002075 Bacteria 803
6 JGI24749J21850_1002031 3300002076 Bacteria 2861
7 JGI24033J26618_1009631 3300002155 Bacteria 1127
8 JGI24034J26672_10011186 3300002239 Bacteria 1342
9 JGI24751J29686_10015578 3300002459 Bacteria 1568
10 Ga0065715_10001026 3300005293 Bacteria 7608
11 Ga0065707_10704901 3300005295 Bacteria 637
12 Ga0070658_10174659 3300005327 Bacteria 1806
13 Ga0070658_10254395 3300005327 Bacteria 1490
14 Ga0070676_10003962 3300005328 Bacteria 7769
15 Ga0070670_100005879 3300005331 Bacteria 10368
16 Ga0070677_10001836 3300005333 Bacteria 6711
17 Ga0070680_101518797 3300005336 Bacteria 580
18 Ga0070682_100623291 3300005337 Bacteria 855
19 Ga0070682_102081379 3300005337 Bacteria 500
20 Ga0068868_102236698 3300005338 Bacteria 521
21 Ga0070660_100078162 3300005339 Bacteria 2594
22 Ga0070660_100359155 3300005339 Bacteria 1200
23 Ga0070660_101455878 3300005339 Bacteria 582
24 Ga0070661_100649098 3300005344 Bacteria 857
25 Ga0070668_100009886 3300005347 Bacteria 7065
26 Ga0070669_100004305 3300005353 Bacteria 10290
27 Ga0070675_100002640 3300005354 Bacteria 13473
28 Ga0070671_100025136 3300005355 Bacteria 4883
29 Ga0070674_100020117 3300005356 Bacteria 4256
30 Ga0070673_100075192 3300005364 Bacteria 2724
31 Ga0070659_101148597 3300005366 Bacteria 686
32 Ga0070667_100104594 3300005367 Bacteria 2449
33 Ga0070713_101004447 3300005436 Bacteria 805
34 Ga0070701_10046513 3300005438 Bacteria 2231
35 Ga0070705_100056470 3300005440 Bacteria 2312
36 Ga0070705_100182993 3300005440 Bacteria 1421
37 Ga0070705_100249194 3300005440 Bacteria 1246
38 Ga0070700_100060494 3300005441 Bacteria 2388
39 Ga0070663_100032827 3300005455 Bacteria 3582
40 Ga0070678_100108372 3300005456 Bacteria 2168
41 Ga0070678_100509385 3300005456 Bacteria 1063
42 Ga0070662_100011994 3300005457 Bacteria 5734
43 Ga0070662_100017771 3300005457 Bacteria 4798
44 Ga0070681_10656639 3300005458 Bacteria 964
45 Ga0068867_100054309 3300005459 Bacteria 2960
46 Ga0070698_100871143 3300005471 Bacteria 846
47 Ga0070679_100165965 3300005530 Bacteria 2181
48 Ga0070679_100568176 3300005530 Bacteria 1078
49 Ga0070684_101418190 3300005535 Bacteria 654
50 Ga0070697_100009731 3300005536 Bacteria 7501
51 Ga0070672_100003751 3300005543 Bacteria 9892
52 Ga0070695_100002357 3300005545 Bacteria 10839
53 Ga0070695_100814898 3300005545 Bacteria 749
54 Ga0070695_101641599 3300005545 Bacteria 537
55 Ga0070665_101512913 3300005548 Bacteria 680
56 Ga0070665_101523361 3300005548 Bacteria 677
57 Ga0070665_101606903 3300005548 Bacteria 658
58 Ga0070704_100558762 3300005549 Bacteria 1001
59 Ga0068855_100058989 3300005563 Bacteria 4492
60 Ga0068855_101078155 3300005563 Bacteria 841
61 Ga0070664_100031825 3300005564 Bacteria 4411
62 Ga0068854_100119314 3300005578 Bacteria 2000
63 Ga0068856_101076132 3300005614 Bacteria 822
64 Ga0070702_101893439 3300005615 Bacteria 500
65 Ga0068859_100082130 3300005617 Bacteria 3265
66 Ga0068864_100132926 3300005618 Bacteria 2237
67 Ga0068861_100015122 3300005719 Bacteria 5431
68 Ga0068870_10163847 3300005840 Bacteria 1321
69 Ga0068862_100058156 3300005844 Bacteria 3316
70 Ga0075365_10584771 3300006038 Bacteria 790
71 Ga0075363_100496118 3300006048 Bacteria 725
72 Ga0075363_100733134 3300006048 Bacteria 598
73 Ga0075364_10729059 3300006051 Bacteria 676
74 Ga0070715_10327577 3300006163 Bacteria 829
75 Ga0070716_101525932 3300006173 Bacteria 547
76 Ga0075367_10488449 3300006178 Bacteria 781
77 Ga0075369_10083397 3300006186 Bacteria 1419
78 Ga0075369_10135058 3300006186 Bacteria 1123
79 Ga0075366_10214573 3300006195 Bacteria 1172
80 Ga0068871_100901274 3300006358 Bacteria 820
81 Ga0068871_102333789 3300006358 Bacteria 510
82 Ga0075434_101663875 3300006871 Bacteria 646
83 Ga0068865_100148772 3300006881 Bacteria 1774
84 Ga0068865_101152035 3300006881 Bacteria 685
85 Ga0075436_100000200 3300006914 Bacteria 37220
86 Ga0097620_100082133 3300006931 Bacteria 3265
87 Ga0075435_100037170 3300007076 Bacteria 3876
88 Ga0075435_100567610 3300007076 Bacteria 983
89 Ga0105240_10545122 3300009093 Bacteria 1284
90 Ga0111539_10222060 3300009094 Bacteria 2200
91 Ga0111539_11065843 3300009094 Bacteria 939
92 Ga0105245_10864992 3300009098 Bacteria 945
93 Ga0105243_10012535 3300009148 Bacteria 6412
94 Ga0105243_10587595 3300009148 Bacteria 1070
95 Ga0105243_12453557 3300009148 Bacteria 560
96 Ga0105248_10139591 3300009177 Bacteria 2734
97 Ga0105249_10109155 3300009553 Bacteria 2613
98 Ga0105239_13191624 3300010375 Bacteria 534
99 Ga0105246_10000657 3300011119 Bacteria 19352
100 Ga0105246_10673871 3300011119 Bacteria 903
101 Ga0157327_1039896 3300012512 Bacteria 626
102 Ga0157373_10032124 3300013100 Bacteria 3779
103 Ga0157373_10032383 3300013100 Bacteria 3763
104 Ga0157374_12455983 3300013296 Bacteria 549
105 Ga0157378_10071999 3300013297 Bacteria 3105
106 Ga0163162_10323716 3300013306 Bacteria 1674
107 Ga0157372_11109533 3300013307 Bacteria 915
108 Ga0157375_12261702 3300013308 Bacteria 648
109 Ga0157375_13020767 3300013308 Bacteria 562
110 Ga0157375_13650217 3300013308 Bacteria 512
111 Ga0157375_13746050 3300013308 Bacteria 505
112 Ga0163163_10058607 3300014325 Bacteria 3808
113 Ga0157380_10008488 3300014326 Bacteria 7338
114 Ga0157380_10020592 3300014326 Bacteria 4933
115 Ga0157377_11602077 3300014745 Bacteria 521
116 Ga0163161_10273356 3300017792 Bacteria 1323
117 Ga0163161_11397598 3300017792 Bacteria 611
118 Ga0213876_10176276 3300021384 Bacteria 1137
119 Ga0213875_10265315 3300021388 Bacteria 810
120 Ga0207666_1005766 3300025271 Bacteria 1589
121 Ga0207697_10001685 3300025315 Bacteria 11911
122 Ga0207682_10019737 3300025893 Bacteria 2641
123 Ga0207647_10394184 3300025904 Bacteria 781
124 Ga0207685_10228964 3300025905 Bacteria 888
125 Ga0207645_10007017 3300025907 Bacteria 8021
126 Ga0207645_10124735 3300025907 Bacteria 1673
127 Ga0207643_10543528 3300025908 Bacteria 745
128 Ga0207705_10005310 3300025909 Bacteria 9638
129 Ga0207705_10032428 3300025909 Bacteria 3733
130 Ga0207695_11433084 3300025913 Bacteria 571
131 Ga0207660_11652545 3300025917 Bacteria 516
132 Ga0207657_10054446 3300025919 Bacteria 3460
133 Ga0207649_10300940 3300025920 Bacteria 1173
134 Ga0207652_10253453 3300025921 Bacteria 1587
135 Ga0207652_11221855 3300025921 Bacteria 653
136 Ga0207681_10007984 3300025923 Bacteria 6471
137 Ga0207681_11507240 3300025923 Bacteria 564
138 Ga0207650_10009192 3300025925 Bacteria 6754
139 Ga0207650_11823982 3300025925 Bacteria 514
140 Ga0207644_10017289 3300025931 Bacteria 4868
141 Ga0207690_10247129 3300025932 Bacteria 1376
142 Ga0207706_10001044 3300025933 Bacteria 28100
143 Ga0207706_10002316 3300025933 Bacteria 18583
144 Ga0207709_10927880 3300025935 Bacteria 709
145 Ga0207704_10092941 3300025938 Bacteria 1987
146 Ga0207665_10128432 3300025939 Bacteria 1797
147 Ga0207691_10037002 3300025940 Bacteria 4521
148 Ga0207667_10023043 3300025949 Bacteria 6862
149 Ga0207651_10038469 3300025960 Bacteria 3145
150 Ga0207712_10015251 3300025961 Bacteria 4953
151 Ga0207668_10004416 3300025972 Bacteria 8256
152 Ga0207668_10683684 3300025972 Bacteria 901
153 Ga0207668_11795898 3300025972 Bacteria 553
154 Ga0207640_11823367 3300025981 Bacteria 550
155 Ga0207658_10104647 3300025986 Bacteria 2224
156 Ga0207677_10825443 3300026023 Bacteria 831
157 Ga0207678_10029324 3300026067 Bacteria 4802
158 Ga0207678_10129338 3300026067 Bacteria 2153
159 Ga0207678_10780140 3300026067 Bacteria 843
160 Ga0207708_10060013 3300026075 Bacteria 2904
161 Ga0207702_11578668 3300026078 Bacteria 649
162 Ga0207648_10011947 3300026089 Bacteria 8152
163 Ga0207676_10272485 3300026095 Bacteria 1533
164 Ga0207674_10218728 3300026116 Bacteria 1853
165 Ga0207675_100044862 3300026118 Bacteria 4131
166 Ga0207683_10031549 3300026121 Bacteria 4598
167 Ga0207683_10499561 3300026121 Bacteria 1123
168 Ga0207428_10146625 3300027907 Bacteria 1798
169 Ga0268266_10164386 3300028379 Bacteria 2010
170 Ga0268266_11070721 3300028379 Bacteria 780
171 Ga0268265_10038008 3300028380 Bacteria 3537
172 Ga0307517_10024293 3300028786 Bacteria 7480
173 Ga0307515_10852171 3300028794 Bacteria 538
174 Ga0307513_10973765 3300031456 Bacteria 557
175 Ga0307408_101009140 3300031548 Bacteria 767
176 Ga0307408_101939001 3300031548 Bacteria 565
177 Ga0316576_10150215 3300031727 Bacteria 1755
178 Ga0316578_10414921 3300031728 Bacteria 797
179 Ga0307405_11602638 3300031731 Bacteria 574
180 Ga0316577_10862623 3300031733 Bacteria 513
181 Ga0307410_10584196 3300031852 Bacteria 930
182 Ga0307406_11325882 3300031901 Bacteria 629
183 Ga0307412_10723688 3300031911 Bacteria 856
184 Ga0307409_101261346 3300031995 Bacteria 763
185 Ga0307416_102303648 3300032002 Bacteria 639
186 Ga0307416_103177286 3300032002 Bacteria 550
187 Ga0307414_11358921 3300032004 Bacteria 660
188 Ga0307411_11944233 3300032005 Bacteria 548
189 Ga0307510_10261165 3300033180 Bacteria 1213
190 Ga0316588_1071244 3300033528 Bacteria 854
191 Ga0316596_1039700 3300033541 Bacteria 1235
192 Ga0373944_0453521 3300035089 Bacteria 500
193 Ga0373953_0201843 3300035117 Bacteria 860
194 Ga0373943_0407581 3300035170 Bacteria 785
195 Ga0316584_0030697 3300036712 Bacteria 3970
196 Ga0395900_0632661 3300037418 Bacteria 1008
197 Ga0395900_1417478 3300037418 Bacteria 607
198 Ga0436364_0209674 3300037853 Bacteria 652
199 Ga0436364_1126480 3300037853 Bacteria 810
200 Ga0436364_1281026 3300037853 Bacteria 863
201 Ga0395901_0424010 3300038443 Bacteria 1364
202 Ga0395901_0433105 3300038443 Bacteria 1347
203 Ga0237819_00646 3300038705 Bacteria 11334
204 Ga0237816_01651 3300039145 Bacteria 1796
205 Ga0436365_0321020 3300039437 Bacteria 2362
206 Ga0436365_0738461 3300039437 Bacteria 770
207 Ga0436360_0343536 3300039438 Bacteria 913
208 Ga0436360_0364608 3300039438 Bacteria 523
209 Ga0436360_0720813 3300039438 Bacteria 798
210 Ga0436361_0480920 3300039447 Bacteria 1898
211 Ga0436363_0375615 3300039450 Bacteria 1147
212 Ga0436363_0660680 3300039450 Bacteria 529
213 Ga0436363_0888389 3300039450 Bacteria 538
214 Ga0436363_1048783 3300039450 Bacteria 1002
215 Ga0436362_0831318 3300039453 Bacteria 610
216 Ga0439465_0372270 3300041413 Bacteria 541
217 Ga0451833_1301806 3300041491 Bacteria 717
218 Ga0439458_0241088 3300042157 Bacteria 501
219 Ga0466969_0057629 3300044656 Bacteria 1893
220 Ga0466972_0181535 3300044658 Bacteria 987
221 Ga0466965_0604951 3300044683 Bacteria 623
222 Ga0466966_0002854 3300044684 Bacteria 11375
223 Ga0466966_0547022 3300044684 Bacteria 697
224 Ga0466961_0008230 3300044693 Bacteria 6641
225 Ga0466963_0020310 3300044694 Bacteria 4176
226 Ga0466971_0005161 3300044719 Bacteria 5653
227 Ga0466968_0018073 3300044735 Bacteria 2825
228 Ga0466970_0001595 3300044765 Bacteria 10930
229 Ga0466970_0061874 3300044765 Bacteria 2006
230 Ga0466957_0000272 3300044842 Bacteria 25068
231 Ga0466957_0992271 3300044842 Bacteria 603
232 Ga0466960_0116316 3300044901 Bacteria 1395
233 Ga0466959_0125671 3300045049 Bacteria 1820
234 Ga0466958_0000445 3300045836 Bacteria 17129
235 Ga0466958_0590674 3300045836 Bacteria 722
236 Ga0495590_0121260 3300046457 Bacteria 937
237 Ga0495629_0876627 3300046459 Bacteria 589
238 Ga0495641_0461677 3300046461 Bacteria 578
239 Ga0495639_0174596 3300046475 Bacteria 1044
240 Ga0495633_0018454 3300046558 Bacteria 3543
241 Ga0495588_0439835 3300046674 Bacteria 684
242 Ga0495581_0149017 3300047315 Bacteria 1366
243 Ga0495686_0356930 3300047472 Bacteria 793
244 Ga0495686_0359304 3300047472 Bacteria 790
245 Ga0496100_0105222 3300048903 Bacteria 1951
246 Ga0496101_0265658 3300048904 Bacteria 1339
247 Ga0496102_0071050 3300048905 Bacteria 3196
248 Ga0496103_0233437 3300048906 Bacteria 1183
249 Ga0496103_0999609 3300048906 Bacteria 521
250 Ga0496104_0002786 3300048907 Bacteria 15067
251 Ga0496104_0434343 3300048907 Bacteria 1225
252 Ga0496105_0001775 3300048908 Bacteria 15414
253 Ga0496108_0000585 3300048911 Bacteria 28495
254 Ga0496109_0000377 3300048912 Bacteria 40679
255 Ga0496110_0009784 3300048913 Bacteria 7765
256 Ga0496111_0013254 3300048914 Bacteria 5604
257 Ga0496112_0014496 3300048915 Bacteria 7318
258 Ga0496113_0000368 3300048916 Bacteria 21718
259 Ga0496114_0291707 3300048917 Bacteria 1439
260 Ga0496115_0631497 3300048918 Bacteria 848
261 Ga0496118_0253631 3300048921 Bacteria 998
262 Ga0496121_0338220 3300048924 Bacteria 1007
263 Ga0496123_0511475 3300048926 Bacteria 523
264 Ga0496126_0218936 3300048929 Bacteria 1600
265 Ga0501033_0266147 3300049570 Bacteria 1212
266 Ga0501070_1270648 3300049586 Bacteria 563
267 Ga0501076_0309130 3300049592 Bacteria 1296
268 Ga0501273_014320 3300049770 Bacteria 1020
269 nmdc:mga03683_362833_c1 3300050489 Bacteria 687
270 nmdc:mga03n38_464116_c1 3300050490 Bacteria 706
271 nmdc:mga0yw44_684627_c1 3300050492 Bacteria 697
272 nmdc:mga0k408_498631_c1 3300050493 Bacteria 721
273 nmdc:mga07m45_556085_c1 3300050496 Bacteria 663
274 nmdc:mga08y16_204676_c1 3300050511 Bacteria 2045
275 nmdc:mga08y16_610624_c1 3300050511 Bacteria 1098
276 nmdc:mga0n895_1477755_c1 3300050512 Bacteria 646
277 nmdc:mga0rr50_16151_c1 3300050513 Bacteria 4948
278 nmdc:mga0rr50_504474_c1 3300050513 Bacteria 1029
279 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
280 nmdc:mga0sz30_57478_c1 3300050516 Bacteria 1658
281 Ga0500645_083220 3300053730 Bacteria 912
282 Ga0587128_093739 3300059630 Bacteria 620
283 Ga0466962_0002892 3300061719 Bacteria 8187
284 Ga0207683_10302364
285 JGI24746J21847_1004158
286 JGI24750J21931_1013997
287 JGI24748J21848_1015090
288 JGI24738J21930_10056529
289 JGI24749J21850_1002031
290 JGI24033J26618_1009631
291 JGI24034J26672_10011186
292 JGI24751J29686_10015578
293 Ga0065715_10001026
294 Ga0065707_10704901
295 Ga0070658_10174659
296 Ga0070658_10254395
297 Ga0070676_10003962
298 Ga0070670_100005879
299 Ga0070677_10001836
300 Ga0070680_101518797
301 Ga0070682_100623291
302 Ga0070682_102081379
303 Ga0068868_102236698
304 Ga0070660_100078162
305 Ga0070660_100359155
306 Ga0070660_101455878
307 Ga0070661_100649098
308 Ga0070668_100009886
309 Ga0070669_100004305
310 Ga0070675_100002640
311 Ga0070671_100025136
312 Ga0070674_100020117
313 Ga0070673_100075192
314 Ga0070659_101148597
315 Ga0070667_100104594
316 Ga0070713_101004447
317 Ga0070701_10046513
318 Ga0070705_100056470
319 Ga0070705_100182993
320 Ga0070705_100249194
321 Ga0070700_100060494
322 Ga0070663_100032827
323 Ga0070678_100108372
324 Ga0070678_100509385
325 Ga0070662_100011994
326 Ga0070662_100017771
327 Ga0070681_10656639
328 Ga0068867_100054309
329 Ga0070698_100871143
330 Ga0070679_100165965
331 Ga0070679_100568176
332 Ga0070684_101418190
333 Ga0070697_100009731
334 Ga0070672_100003751
335 Ga0070695_100002357
336 Ga0070695_100814898
337 Ga0070695_101641599
338 Ga0070665_101512913
339 Ga0070665_101523361
340 Ga0070665_101606903
341 Ga0070704_100558762
342 Ga0068855_100058989
343 Ga0068855_101078155
344 Ga0070664_100031825
345 Ga0068854_100119314
346 Ga0068856_101076132
347 Ga0070702_101893439
348 Ga0068859_100082130
349 Ga0068864_100132926
350 Ga0068861_100015122
351 Ga0068870_10163847
352 Ga0068862_100058156
353 Ga0075365_10584771
354 Ga0075363_100496118
355 Ga0075363_100733134
356 Ga0075364_10729059
357 Ga0070715_10327577
358 Ga0070716_101525932
359 Ga0075367_10488449
360 Ga0075369_10083397
361 Ga0075369_10135058
362 Ga0075366_10214573
363 Ga0068871_100901274
364 Ga0068871_102333789
365 Ga0075434_101663875
366 Ga0068865_100148772
367 Ga0068865_101152035
368 Ga0075436_100000200
369 Ga0097620_100082133
370 Ga0075435_100037170
371 Ga0075435_100567610
372 Ga0105240_10545122
373 Ga0111539_10222060
374 Ga0111539_11065843
375 Ga0105245_10864992
376 Ga0105243_10012535
377 Ga0105243_10587595
378 Ga0105243_12453557
379 Ga0105248_10139591
380 Ga0105249_10109155
381 Ga0105239_13191624
382 Ga0105246_10000657
383 Ga0105246_10673871
384 Ga0157327_1039896
385 Ga0157373_10032124
386 Ga0157373_10032383
387 Ga0157374_12455983
388 Ga0157378_10071999
389 Ga0163162_10323716
390 Ga0157372_11109533
391 Ga0157375_12261702
392 Ga0157375_13020767
393 Ga0157375_13650217
394 Ga0157375_13746050
395 Ga0163163_10058607
396 Ga0157380_10008488
397 Ga0157380_10020592
398 Ga0157377_11602077
399 Ga0163161_10273356
400 Ga0163161_11397598
401 Ga0213876_10176276
402 Ga0213875_10265315
403 Ga0207666_1005766
404 Ga0207697_10001685
405 Ga0207682_10019737
406 Ga0207647_10394184
407 Ga0207685_10228964
408 Ga0207645_10007017
409 Ga0207645_10124735
410 Ga0207643_10543528
411 Ga0207705_10005310
412 Ga0207705_10032428
413 Ga0207695_11433084
414 Ga0207660_11652545
415 Ga0207657_10054446
416 Ga0207649_10300940
417 Ga0207652_10253453
418 Ga0207652_11221855
419 Ga0207681_10007984
420 Ga0207681_11507240
421 Ga0207650_10009192
422 Ga0207650_11823982
423 Ga0207644_10017289
424 Ga0207690_10247129
425 Ga0207706_10001044
426 Ga0207706_10002316
427 Ga0207709_10927880
428 Ga0207704_10092941
429 Ga0207665_10128432
430 Ga0207691_10037002
431 Ga0207667_10023043
432 Ga0207651_10038469
433 Ga0207712_10015251
434 Ga0207668_10004416
435 Ga0207668_10683684
436 Ga0207668_11795898
437 Ga0207640_11823367
438 Ga0207658_10104647
439 Ga0207677_10825443
440 Ga0207678_10029324
441 Ga0207678_10129338
442 Ga0207678_10780140
443 Ga0207708_10060013
444 Ga0207702_11578668
445 Ga0207648_10011947
446 Ga0207676_10272485
447 Ga0207674_10218728
448 Ga0207675_100044862
449 Ga0207683_10031549
450 Ga0207683_10499561
451 Ga0207428_10146625
452 Ga0268266_10164386
453 Ga0268266_11070721
454 Ga0268265_10038008
455 Ga0307517_10024293
456 Ga0307515_10852171
457 Ga0307513_10973765
458 Ga0307408_101009140
459 Ga0307408_101939001
460 Ga0316576_10150215
461 Ga0316578_10414921
462 Ga0307405_11602638
463 Ga0316577_10862623
464 Ga0307410_10584196
465 Ga0307406_11325882
466 Ga0307412_10723688
467 Ga0307409_101261346
468 Ga0307416_102303648
469 Ga0307416_103177286
470 Ga0307414_11358921
471 Ga0307411_11944233
472 Ga0307510_10261165
473 Ga0316588_1071244
474 Ga0316596_1039700
475 Ga0373944_0453521
476 Ga0373953_0201843
477 Ga0373943_0407581
478 Ga0316584_0030697
479 Ga0395900_0632661
480 Ga0395900_1417478
481 Ga0436364_0209674
482 Ga0436364_1126480
483 Ga0436364_1281026
484 Ga0395901_0424010
485 Ga0395901_0433105
486 Ga0237819_00646
487 Ga0237816_01651
488 Ga0436365_0321020
489 Ga0436365_0738461
490 Ga0436360_0343536
491 Ga0436360_0364608
492 Ga0436360_0720813
493 Ga0436361_0480920
494 Ga0436363_0375615
495 Ga0436363_0660680
496 Ga0436363_0888389
497 Ga0436363_1048783
498 Ga0436362_0831318
499 Ga0439465_0372270
500 Ga0451833_1301806
501 Ga0439458_0241088
502 Ga0466969_0057629
503 Ga0466972_0181535
504 Ga0466965_0604951
505 Ga0466966_0002854
506 Ga0466966_0547022
507 Ga0466961_0008230
508 Ga0466963_0020310
509 Ga0466971_0005161
510 Ga0466968_0018073
511 Ga0466970_0001595
512 Ga0466970_0061874
513 Ga0466957_0000272
514 Ga0466957_0992271
515 Ga0466960_0116316
516 Ga0466959_0125671
517 Ga0466958_0000445
518 Ga0466958_0590674
519 Ga0495590_0121260
520 Ga0495629_0876627
521 Ga0495641_0461677
522 Ga0495639_0174596
523 Ga0495633_0018454
524 Ga0495588_0439835
525 Ga0495581_0149017
526 Ga0495686_0356930
527 Ga0495686_0359304
528 Ga0496100_0105222
529 Ga0496101_0265658
530 Ga0496102_0071050
531 Ga0496103_0233437
532 Ga0496103_0999609
533 Ga0496104_0002786
534 Ga0496104_0434343
535 Ga0496105_0001775
536 Ga0496108_0000585
537 Ga0496109_0000377
538 Ga0496110_0009784
539 Ga0496111_0013254
540 Ga0496112_0014496
541 Ga0496113_0000368
542 Ga0496114_0291707
543 Ga0496115_0631497
544 Ga0496118_0253631
545 Ga0496121_0338220
546 Ga0496123_0511475
547 Ga0496126_0218936
548 Ga0501033_0266147
549 Ga0501070_1270648
550 Ga0501076_0309130
551 Ga0501273_014320
552 nmdc:mga03683_362833_c1
553 nmdc:mga03n38_464116_c1
554 nmdc:mga0yw44_684627_c1
555 nmdc:mga0k408_498631_c1
556 nmdc:mga07m45_556085_c1
557 nmdc:mga08y16_204676_c1
558 nmdc:mga08y16_610624_c1
559 nmdc:mga0n895_1477755_c1
560 nmdc:mga0rr50_16151_c1
561 nmdc:mga0rr50_504474_c1
562 nmdc:mga08x19_23_c1
563 nmdc:mga0sz30_57478_c1
564 Ga0500645_083220
565 Ga0587128_093739
566 Ga0466962_0002892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

14

70

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.9015 4 77
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8903 4 77
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8506 3 76
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8324 3 77
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.832 3 76
ID Description Score Start End Superfamily
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9015 4 77 3.30.300.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8917 6 78 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8903 4 77 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8846 1 77 3.10.20.90
af_Q54GP0_1_85_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8731 3 75 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A258E1I0-F1-model_v4 BolA family transcriptional regulator 0.9897 1 77
AF-A0A5C8PQA4-F1-model_v4 BolA family transcriptional regulator 0.9843 1 78
AF-A0A357LA00-F1-model_v4 BolA family transcriptional regulator 0.9799 1 77
AF-J1JRA7-F1-model_v4 BolA protein 0.9797 1 77
AF-A0A258E1I0-F1-model_v4 BolA family transcriptional regulator 0.9771 1 77

Map