F384888
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 210 | 282 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10255646|Ga0105240_102556463 |
| Length | 78 |
| Sequence | LLPEMGRLAGFRYREIRRKLKACGFEFDRQAAGSHEIWFNPTTKRYTTIPNHPGDMPEGTLRAILKQAGIDVDFFLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 100 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 101 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 102 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 108 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 122 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 123 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 124 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 125 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 126 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 127 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 131 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 132 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 133 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 140 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 141 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 142 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 145 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 146 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 147 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 148 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 149 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 150 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 151 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 152 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 153 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 154 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 155 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 170 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 171 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 202 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 203 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 204 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 205 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 206 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 207 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 2.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.13 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 87.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100000972 | 3300005329 | Bacteria | 21350 |
| 2 | Ga0070670_100546693 | 3300005331 | Bacteria | 1033 |
| 3 | Ga0070670_101153333 | 3300005331 | Unclassified | 707 |
| 4 | Ga0070666_10626913 | 3300005335 | Bacteria | 785 |
| 5 | Ga0070680_100020330 | 3300005336 | Bacteria | 5270 |
| 6 | Ga0070660_100075036 | 3300005339 | Bacteria | 2647 |
| 7 | Ga0070691_10015751 | 3300005341 | Bacteria | 3474 |
| 8 | Ga0070661_100173793 | 3300005344 | Bacteria | 1637 |
| 9 | Ga0070668_100472478 | 3300005347 | Bacteria | 1082 |
| 10 | Ga0070688_100030634 | 3300005365 | Bacteria | 3230 |
| 11 | Ga0070667_100920030 | 3300005367 | Bacteria | 814 |
| 12 | Ga0070667_101024414 | 3300005367 | Bacteria | 770 |
| 13 | Ga0070663_101693057 | 3300005455 | Unclassified | 565 |
| 14 | Ga0070681_10000569 | 3300005458 | Bacteria | 30428 |
| 15 | Ga0070685_10001702 | 3300005466 | Bacteria | 11560 |
| 16 | Ga0070706_100619766 | 3300005467 | Unclassified | 1005 |
| 17 | Ga0070706_101041456 | 3300005467 | Bacteria | 754 |
| 18 | Ga0070698_100000461 | 3300005471 | Bacteria | 43074 |
| 19 | Ga0070679_100000840 | 3300005530 | Bacteria | 26739 |
| 20 | Ga0070684_100002765 | 3300005535 | Bacteria | 12984 |
| 21 | Ga0070697_100082461 | 3300005536 | Bacteria | 2651 |
| 22 | Ga0070697_101833498 | 3300005536 | Bacteria | 543 |
| 23 | Ga0068853_100218935 | 3300005539 | Bacteria | 1738 |
| 24 | Ga0068853_100223282 | 3300005539 | Bacteria | 1721 |
| 25 | Ga0068853_101849148 | 3300005539 | Unclassified | 585 |
| 26 | Ga0070696_100014525 | 3300005546 | Bacteria | 5285 |
| 27 | Ga0070665_100126431 | 3300005548 | Bacteria | 2559 |
| 28 | Ga0068855_101022022 | 3300005563 | Bacteria | 867 |
| 29 | Ga0068855_101410476 | 3300005563 | Unclassified | 718 |
| 30 | Ga0068857_100003533 | 3300005577 | Bacteria | 13064 |
| 31 | Ga0068856_100000415 | 3300005614 | Bacteria | 47035 |
| 32 | Ga0070702_100446668 | 3300005615 | Bacteria | 937 |
| 33 | Ga0070702_101051645 | 3300005615 | Unclassified | 647 |
| 34 | Ga0068852_100126651 | 3300005616 | Bacteria | 2346 |
| 35 | Ga0068852_100142140 | 3300005616 | Bacteria | 2222 |
| 36 | Ga0068859_102552091 | 3300005617 | Unclassified | 562 |
| 37 | Ga0068864_100273458 | 3300005618 | Bacteria | 1575 |
| 38 | Ga0068851_11078636 | 3300005834 | Unclassified | 509 |
| 39 | Ga0068863_101032319 | 3300005841 | Bacteria | 825 |
| 40 | Ga0068863_101833455 | 3300005841 | Unclassified | 616 |
| 41 | Ga0068858_100429858 | 3300005842 | Bacteria | 1270 |
| 42 | Ga0068860_100498597 | 3300005843 | Unclassified | 1215 |
| 43 | Ga0081455_10001165 | 3300005937 | Bacteria | 32867 |
| 44 | Ga0081540_1095186 | 3300005983 | Bacteria | 1299 |
| 45 | Ga0075433_10536602 | 3300006852 | Bacteria | 1029 |
| 46 | Ga0068865_100074371 | 3300006881 | Bacteria | 2419 |
| 47 | Ga0068865_100143183 | 3300006881 | Bacteria | 1805 |
| 48 | Ga0097620_102552690 | 3300006931 | Unclassified | 562 |
| 49 | Ga0099795_10202026 | 3300007788 | Unclassified | 839 |
| 50 | Ga0105240_10003118 | 3300009093 | Bacteria | 26098 |
| 51 | Ga0105240_10250357 | 3300009093 | Bacteria | 2049 |
| 52 | Ga0105240_10255646 | 3300009093 | Bacteria | 2023 |
| 53 | Ga0105245_10463386 | 3300009098 | Bacteria | 1278 |
| 54 | Ga0105245_11494134 | 3300009098 | Bacteria | 726 |
| 55 | Ga0105245_12656197 | 3300009098 | Unclassified | 554 |
| 56 | Ga0105243_11318986 | 3300009148 | Unclassified | 739 |
| 57 | Ga0105241_10039036 | 3300009174 | Bacteria | 3581 |
| 58 | Ga0105241_11648367 | 3300009174 | Unclassified | 622 |
| 59 | Ga0105241_11935381 | 3300009174 | Unclassified | 579 |
| 60 | Ga0105242_10126004 | 3300009176 | Unclassified | 2204 |
| 61 | Ga0105242_10889754 | 3300009176 | Bacteria | 889 |
| 62 | Ga0105242_11184736 | 3300009176 | Bacteria | 782 |
| 63 | Ga0105248_11115583 | 3300009177 | Unclassified | 892 |
| 64 | Ga0105248_11127214 | 3300009177 | Unclassified | 887 |
| 65 | Ga0105237_10001708 | 3300009545 | Bacteria | 28398 |
| 66 | Ga0105237_10823901 | 3300009545 | Bacteria | 935 |
| 67 | Ga0105238_10000748 | 3300009551 | Bacteria | 33846 |
| 68 | Ga0105238_11402758 | 3300009551 | Unclassified | 726 |
| 69 | Ga0105249_10131494 | 3300009553 | Bacteria | 2390 |
| 70 | Ga0105249_11250997 | 3300009553 | Bacteria | 814 |
| 71 | Ga0105239_10004536 | 3300010375 | Bacteria | 16546 |
| 72 | Ga0105239_10203074 | 3300010375 | Bacteria | 2221 |
| 73 | Ga0105239_10742284 | 3300010375 | Unclassified | 1123 |
| 74 | Ga0105239_11512901 | 3300010375 | Bacteria | 776 |
| 75 | Ga0157371_10363592 | 3300013102 | Bacteria | 1055 |
| 76 | Ga0157370_11620059 | 3300013104 | Bacteria | 581 |
| 77 | Ga0157369_10005557 | 3300013105 | Bacteria | 14638 |
| 78 | Ga0157369_10010621 | 3300013105 | Bacteria | 10481 |
| 79 | Ga0157369_10710462 | 3300013105 | Unclassified | 1035 |
| 80 | Ga0157374_10557521 | 3300013296 | Bacteria | 1154 |
| 81 | Ga0157374_10677362 | 3300013296 | Bacteria | 1044 |
| 82 | Ga0157374_11858943 | 3300013296 | Bacteria | 628 |
| 83 | Ga0163162_10743024 | 3300013306 | Bacteria | 1101 |
| 84 | Ga0157372_10002079 | 3300013307 | Bacteria | 21751 |
| 85 | Ga0157372_10870216 | 3300013307 | Bacteria | 1046 |
| 86 | Ga0157372_11244889 | 3300013307 | Unclassified | 859 |
| 87 | Ga0157375_10551512 | 3300013308 | Unclassified | 1314 |
| 88 | Ga0157375_11186202 | 3300013308 | Bacteria | 895 |
| 89 | Ga0157375_11240569 | 3300013308 | Bacteria | 875 |
| 90 | Ga0157375_13111895 | 3300013308 | Bacteria | 554 |
| 91 | Ga0163163_10048163 | 3300014325 | Bacteria | 4190 |
| 92 | Ga0163163_11539743 | 3300014325 | Unclassified | 726 |
| 93 | Ga0157376_12932570 | 3300014969 | Unclassified | 516 |
| 94 | Ga0163161_11434354 | 3300017792 | Unclassified | 604 |
| 95 | Ga0206352_11198737 | 3300020078 | Unclassified | 561 |
| 96 | Ga0154015_1385700 | 3300020610 | Unclassified | 595 |
| 97 | Ga0213872_10011350 | 3300021361 | Bacteria | 4217 |
| 98 | Ga0213872_10125098 | 3300021361 | Bacteria | 1135 |
| 99 | Ga0224712_10309580 | 3300022467 | Unclassified | 740 |
| 100 | Ga0224712_10479728 | 3300022467 | Unclassified | 599 |
| 101 | Ga0207645_10445725 | 3300025907 | Bacteria | 873 |
| 102 | Ga0207705_10702885 | 3300025909 | Bacteria | 786 |
| 103 | Ga0207684_10475023 | 3300025910 | Bacteria | 1073 |
| 104 | Ga0207654_10006041 | 3300025911 | Bacteria | 6089 |
| 105 | Ga0207654_11110460 | 3300025911 | Unclassified | 576 |
| 106 | Ga0207707_10000594 | 3300025912 | Bacteria | 36476 |
| 107 | Ga0207695_10000597 | 3300025913 | Bacteria | 72390 |
| 108 | Ga0207695_10121468 | 3300025913 | Bacteria | 2579 |
| 109 | Ga0207695_10599693 | 3300025913 | Bacteria | 982 |
| 110 | Ga0207671_10007132 | 3300025914 | Bacteria | 9755 |
| 111 | Ga0207671_11454688 | 3300025914 | Unclassified | 530 |
| 112 | Ga0207693_11047702 | 3300025915 | Bacteria | 621 |
| 113 | Ga0207660_10003269 | 3300025917 | Bacteria | 10602 |
| 114 | Ga0207649_10430312 | 3300025920 | Bacteria | 993 |
| 115 | Ga0207652_10000972 | 3300025921 | Bacteria | 26766 |
| 116 | Ga0207652_10797458 | 3300025921 | Bacteria | 839 |
| 117 | Ga0207646_10762522 | 3300025922 | Bacteria | 863 |
| 118 | Ga0207694_10000375 | 3300025924 | Bacteria | 41549 |
| 119 | Ga0207694_10806551 | 3300025924 | Unclassified | 793 |
| 120 | Ga0207650_10061868 | 3300025925 | Bacteria | 2796 |
| 121 | Ga0207687_10269617 | 3300025927 | Bacteria | 1360 |
| 122 | Ga0207704_11113546 | 3300025938 | Bacteria | 671 |
| 123 | Ga0207661_10004738 | 3300025944 | Bacteria | 9527 |
| 124 | Ga0207679_10100265 | 3300025945 | Bacteria | 2263 |
| 125 | Ga0207667_10000779 | 3300025949 | Bacteria | 41333 |
| 126 | Ga0207667_11393769 | 3300025949 | Bacteria | 675 |
| 127 | Ga0207712_10483530 | 3300025961 | Bacteria | 1056 |
| 128 | Ga0207712_10698303 | 3300025961 | Bacteria | 885 |
| 129 | Ga0207658_10281961 | 3300025986 | Bacteria | 1425 |
| 130 | Ga0207658_10494836 | 3300025986 | Bacteria | 1088 |
| 131 | Ga0207703_10069971 | 3300026035 | Unclassified | 2895 |
| 132 | Ga0207639_10067644 | 3300026041 | Bacteria | 2780 |
| 133 | Ga0207639_10486425 | 3300026041 | Bacteria | 1125 |
| 134 | Ga0207639_11895047 | 3300026041 | Unclassified | 557 |
| 135 | Ga0207678_11581821 | 3300026067 | Unclassified | 577 |
| 136 | Ga0207702_10004458 | 3300026078 | Bacteria | 12441 |
| 137 | Ga0207676_10191994 | 3300026095 | Bacteria | 1798 |
| 138 | Ga0207674_10000544 | 3300026116 | Bacteria | 49416 |
| 139 | Ga0207698_10889645 | 3300026142 | Bacteria | 897 |
| 140 | Ga0268266_11248067 | 3300028379 | Unclassified | 718 |
| 141 | Ga0268265_10764616 | 3300028380 | Bacteria | 939 |
| 142 | Ga0268264_10544379 | 3300028381 | Unclassified | 1138 |
| 143 | Ga0268264_11425333 | 3300028381 | Bacteria | 703 |
| 144 | Ga0265338_10649033 | 3300028800 | Unclassified | 732 |
| 145 | Ga0265327_10019453 | 3300031251 | Bacteria | 4173 |
| 146 | Ga0265327_10195273 | 3300031251 | Bacteria | 919 |
| 147 | Ga0265316_10062605 | 3300031344 | Bacteria | 2887 |
| 148 | Ga0265316_10179734 | 3300031344 | Unclassified | 1575 |
| 149 | Ga0307513_10314095 | 3300031456 | Archaea | 1328 |
| 150 | Ga0307408_101006072 | 3300031548 | Unclassified | 768 |
| 151 | Ga0316575_10003689 | 3300031665 | Bacteria | 5313 |
| 152 | Ga0316575_10265698 | 3300031665 | Bacteria | 721 |
| 153 | Ga0316579_10491797 | 3300031691 | Bacteria | 594 |
| 154 | Ga0316576_11083714 | 3300031727 | Bacteria | 569 |
| 155 | Ga0316576_11223176 | 3300031727 | Unclassified | 530 |
| 156 | Ga0316578_10345254 | 3300031728 | Unclassified | 886 |
| 157 | Ga0307405_10068871 | 3300031731 | Bacteria | 2266 |
| 158 | Ga0316577_10220003 | 3300031733 | Bacteria | 1073 |
| 159 | Ga0307407_10879512 | 3300031903 | Bacteria | 686 |
| 160 | Ga0307416_100382377 | 3300032002 | Bacteria | 1438 |
| 161 | Ga0307411_10551189 | 3300032005 | Bacteria | 984 |
| 162 | Ga0307411_11228451 | 3300032005 | Bacteria | 680 |
| 163 | Ga0316593_10112361 | 3300032168 | Unclassified | 973 |
| 164 | Ga0316588_1062368 | 3300033528 | Unclassified | 910 |
| 165 | Ga0316596_1120630 | 3300033541 | Unclassified | 714 |
| 166 | Ga0373955_0322977 | 3300035172 | Unclassified | 933 |
| 167 | Ga0316574_0049172 | 3300035398 | Bacteria | 2621 |
| 168 | Ga0373947_0193895 | 3300035725 | Bacteria | 1327 |
| 169 | Ga0373937_0448077 | 3300036401 | Bacteria | 1226 |
| 170 | Ga0316582_0795990 | 3300036647 | Unclassified | 648 |
| 171 | Ga0395899_0001218 | 3300037312 | Bacteria | 22536 |
| 172 | Ga0395898_0023433 | 3300037466 | Bacteria | 6239 |
| 173 | Ga0395905_0310836 | 3300037471 | Bacteria | 1464 |
| 174 | Ga0436364_1390408 | 3300037853 | Bacteria | 1551 |
| 175 | Ga0395901_0078477 | 3300038443 | Bacteria | 3447 |
| 176 | Ga0400484_05355 | 3300038725 | Bacteria | 1177 |
| 177 | Ga0400484_25124 | 3300038725 | Unclassified | 1329 |
| 178 | Ga0400490_47077 | 3300038726 | Bacteria | 4972 |
| 179 | Ga0400491_28034 | 3300038727 | Bacteria | 1330 |
| 180 | Ga0400488_13305 | 3300038741 | Bacteria | 2579 |
| 181 | Ga0400488_38086 | 3300038741 | Bacteria | 2100 |
| 182 | Ga0400486_08262 | 3300038742 | Bacteria | 1573 |
| 183 | Ga0400483_024816 | 3300039062 | Bacteria | 2081 |
| 184 | Ga0400483_160395 | 3300039062 | Bacteria | 3335 |
| 185 | Ga0400487_35887 | 3300039110 | Bacteria | 2503 |
| 186 | Ga0436360_1069154 | 3300039438 | Bacteria | 1465 |
| 187 | Ga0436361_0240997 | 3300039447 | Bacteria | 1307 |
| 188 | Ga0436361_0334611 | 3300039447 | Bacteria | 1855 |
| 189 | Ga0436361_0489833 | 3300039447 | Bacteria | 1790 |
| 190 | Ga0436361_0743953 | 3300039447 | Unclassified | 637 |
| 191 | Ga0436363_0356776 | 3300039450 | Unclassified | 565 |
| 192 | Ga0439436_0001772 | 3300041404 | Bacteria | 6347 |
| 193 | Ga0439466_0071506 | 3300041411 | Bacteria | 1104 |
| 194 | Ga0451791_0693467 | 3300041451 | Bacteria | 2266 |
| 195 | Ga0451797_1253825 | 3300041453 | Bacteria | 1221 |
| 196 | Ga0451804_0340791 | 3300041463 | Bacteria | 1183 |
| 197 | Ga0451807_0104252 | 3300041486 | Bacteria | 2140 |
| 198 | Ga0451843_0320898 | 3300041509 | Bacteria | 1945 |
| 199 | Ga0451853_2738728 | 3300041512 | Bacteria | 504 |
| 200 | Ga0439431_0015010 | 3300041997 | Bacteria | 1800 |
| 201 | Ga0439433_0022708 | 3300041999 | Bacteria | 1409 |
| 202 | Ga0439442_006496 | 3300042002 | Bacteria | 2348 |
| 203 | Ga0439432_010838 | 3300042006 | Bacteria | 3149 |
| 204 | Ga0439449_0049632 | 3300042007 | Bacteria | 1552 |
| 205 | Ga0439452_011190 | 3300042010 | Bacteria | 2586 |
| 206 | Ga0439457_010648 | 3300042014 | Bacteria | 2109 |
| 207 | Ga0439462_0010820 | 3300042015 | Bacteria | 2315 |
| 208 | Ga0450923_020516 | 3300042125 | Bacteria | 1281 |
| 209 | Ga0450897_000064 | 3300042128 | Bacteria | 4806 |
| 210 | Ga0450894_007190 | 3300042131 | Bacteria | 1436 |
| 211 | Ga0450896_019585 | 3300042133 | Bacteria | 986 |
| 212 | Ga0450906_010043 | 3300042145 | Bacteria | 1795 |
| 213 | Ga0439446_0028184 | 3300042156 | Bacteria | 1616 |
| 214 | Ga0450909_008111 | 3300042185 | Bacteria | 1524 |
| 215 | Ga0439434_0206553 | 3300042435 | Bacteria | 663 |
| 216 | Ga0453683_0006561 | 3300044673 | Bacteria | 7973 |
| 217 | Ga0466961_0118658 | 3300044693 | Bacteria | 1662 |
| 218 | Ga0453684_0197550 | 3300044712 | Bacteria | 2347 |
| 219 | Ga0451576_0243020 | 3300045051 | Bacteria | 1880 |
| 220 | Ga0451576_0350839 | 3300045051 | Bacteria | 1545 |
| 221 | Ga0451576_1780738 | 3300045051 | Unclassified | 637 |
| 222 | Ga0495580_0019784 | 3300046472 | Bacteria | 4996 |
| 223 | Ga0495639_0534182 | 3300046475 | Unclassified | 600 |
| 224 | Ga0495645_0743885 | 3300046543 | Bacteria | 592 |
| 225 | Ga0495635_1007755 | 3300046663 | Unclassified | 530 |
| 226 | Ga0495686_0061032 | 3300047472 | Bacteria | 2343 |
| 227 | Ga0496101_0567872 | 3300048904 | Unclassified | 897 |
| 228 | Ga0496103_0229431 | 3300048906 | Bacteria | 1194 |
| 229 | Ga0496104_1419692 | 3300048907 | Unclassified | 597 |
| 230 | Ga0496114_0210928 | 3300048917 | Bacteria | 1703 |
| 231 | Ga0496117_0093780 | 3300048920 | Bacteria | 1924 |
| 232 | Ga0496117_0570082 | 3300048920 | Bacteria | 535 |
| 233 | Ga0496118_0018575 | 3300048921 | Bacteria | 6263 |
| 234 | Ga0496122_0000178 | 3300048925 | Bacteria | 150162 |
| 235 | Ga0496123_0000559 | 3300048926 | Bacteria | 63800 |
| 236 | Ga0496126_0157351 | 3300048929 | Bacteria | 1944 |
| 237 | Ga0501031_0077434 | 3300049568 | Unclassified | 2166 |
| 238 | Ga0501032_0829270 | 3300049569 | Unclassified | 583 |
| 239 | Ga0501033_0031146 | 3300049570 | Plasmid | 4010 |
| 240 | Ga0501033_0753427 | 3300049570 | Bacteria | 660 |
| 241 | Ga0501036_0014429 | 3300049572 | Bacteria | 6581 |
| 242 | Ga0501037_0176041 | 3300049573 | Unclassified | 1519 |
| 243 | Ga0501038_0060225 | 3300049574 | Bacteria | 3249 |
| 244 | Ga0501038_0358851 | 3300049574 | Bacteria | 1134 |
| 245 | Ga0501039_0062290 | 3300049575 | Unclassified | 2890 |
| 246 | Ga0501040_0005890 | 3300049576 | Bacteria | 7934 |
| 247 | Ga0501041_0010493 | 3300049577 | Bacteria | 5459 |
| 248 | Ga0501043_0232505 | 3300049579 | Bacteria | 1424 |
| 249 | Ga0501043_0432295 | 3300049579 | Unclassified | 991 |
| 250 | Ga0501043_0966775 | 3300049579 | Unclassified | 608 |
| 251 | Ga0501046_0359326 | 3300049580 | Unclassified | 1056 |
| 252 | Ga0501046_0840916 | 3300049580 | Bacteria | 642 |
| 253 | Ga0501047_0173009 | 3300049581 | Bacteria | 2028 |
| 254 | Ga0501047_0409135 | 3300049581 | Bacteria | 1189 |
| 255 | Ga0501048_0000253 | 3300049582 | Bacteria | 35754 |
| 256 | Ga0501068_0729200 | 3300049584 | Unclassified | 648 |
| 257 | Ga0501071_0200997 | 3300049587 | Unclassified | 1497 |
| 258 | Ga0501072_0041638 | 3300049588 | Bacteria | 3609 |
| 259 | Ga0501074_0106588 | 3300049590 | Unclassified | 2006 |
| 260 | Ga0501075_0010119 | 3300049591 | Bacteria | 6617 |
| 261 | Ga0501076_0002739 | 3300049592 | Bacteria | 12201 |
| 262 | Ga0501077_0015580 | 3300049593 | Bacteria | 4786 |
| 263 | Ga0501079_0006658 | 3300049741 | Bacteria | 8690 |
| 264 | Ga0501080_0157621 | 3300049742 | Bacteria | 2097 |
| 265 | Ga0501080_0525628 | 3300049742 | Unclassified | 1055 |
| 266 | Ga0501081_0003769 | 3300049743 | Bacteria | 9709 |
| 267 | Ga0501035_0228265 | 3300049822 | Unclassified | 1587 |
| 268 | Ga0501044_0684341 | 3300049823 | Unclassified | 912 |
| 269 | Ga0501045_0000612 | 3300049824 | Bacteria | 22530 |
| 270 | nmdc:mga05p37_1207692_c1 | 3300050507 | Bacteria | 780 |
| 271 | nmdc:mga0a205_286127_c1 | 3300050515 | Bacteria | 1523 |
| 272 | Ga0500635_0084977 | 3300053080 | Bacteria | 1143 |
| 273 | Ga0500643_008082 | 3300053087 | Bacteria | 4168 |
| 274 | Ga0500556_0053166 | 3300053104 | Bacteria | 1472 |
| 275 | Ga0500638_212202 | 3300053162 | Bacteria | 810 |
| 276 | Ga0500639_056576 | 3300053163 | Bacteria | 2031 |
| 277 | Ga0500637_0044387 | 3300053178 | Bacteria | 2518 |
| 278 | Ga0501084_0018078 | 3300054114 | Bacteria | 5872 |
| 279 | Ga0587128_131312 | 3300059630 | Bacteria | 554 |
| 280 | Ga0501082_0040433 | 3300060353 | Bacteria | 4022 |
| 281 | Ga0501082_1317379 | 3300060353 | Unclassified | 631 |
| 282 | Ga0530510_0000518 | 3300061734 | Bacteria | 24630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_101833498 | Ga0070697_1018334982 | 71 |
| 2 | 3300005546 | Ga0070696_100014525 | Ga0070696_1000145253 | 71 |
| 3 | 3300060353 | Ga0501082_1317379 | Ga0501082_1317379_310_525 | 71 |
| 4 | 3300031728 | Ga0316578_10345254 | Ga0316578_103452541 | 72 |
| 5 | 3300033541 | Ga0316596_1120630 | Ga0316596_11206301 | 72 |
| 6 | 3300005331 | Ga0070670_100546693 | Ga0070670_1005466932 | 74 |
| 7 | 3300005331 | Ga0070670_101153333 | Ga0070670_1011533333 | 74 |
| 8 | 3300005335 | Ga0070666_10626913 | Ga0070666_106269131 | 74 |
| 9 | 3300005347 | Ga0070668_100472478 | Ga0070668_1004724783 | 74 |
| 10 | 3300005365 | Ga0070688_100030634 | Ga0070688_1000306342 | 74 |
| 11 | 3300005367 | Ga0070667_100920030 | Ga0070667_1009200301 | 74 |
| 12 | 3300005367 | Ga0070667_101024414 | Ga0070667_1010244141 | 74 |
| 13 | 3300005455 | Ga0070663_101693057 | Ga0070663_1016930572 | 74 |
| 14 | 3300005466 | Ga0070685_10001702 | Ga0070685_1000170213 | 74 |
| 15 | 3300005467 | Ga0070706_100619766 | Ga0070706_1006197662 | 74 |
| 16 | 3300005467 | Ga0070706_101041456 | Ga0070706_1010414563 | 74 |
| 17 | 3300005471 | Ga0070698_100000461 | Ga0070698_1000004616 | 74 |
| 18 | 3300005536 | Ga0070697_100082461 | Ga0070697_1000824613 | 74 |
| 19 | 3300005539 | Ga0068853_100223282 | Ga0068853_1002232822 | 74 |
| 20 | 3300005539 | Ga0068853_101849148 | Ga0068853_1018491482 | 74 |
| 21 | 3300005548 | Ga0070665_100126431 | Ga0070665_1001264312 | 74 |
| 22 | 3300005563 | Ga0068855_101022022 | Ga0068855_1010220223 | 74 |
| 23 | 3300005563 | Ga0068855_101410476 | Ga0068855_1014104762 | 74 |
| 24 | 3300005615 | Ga0070702_100446668 | Ga0070702_1004466683 | 74 |
| 25 | 3300005616 | Ga0068852_100126651 | Ga0068852_1001266512 | 74 |
| 26 | 3300005618 | Ga0068864_100273458 | Ga0068864_1002734582 | 74 |
| 27 | 3300005834 | Ga0068851_11078636 | Ga0068851_110786362 | 74 |
| 28 | 3300005841 | Ga0068863_101032319 | Ga0068863_1010323193 | 74 |
| 29 | 3300005841 | Ga0068863_101833455 | Ga0068863_1018334552 | 74 |
| 30 | 3300005842 | Ga0068858_100429858 | Ga0068858_1004298583 | 74 |
| 31 | 3300005843 | Ga0068860_100498597 | Ga0068860_1004985972 | 74 |
| 32 | 3300005937 | Ga0081455_10001165 | Ga0081455_1000116513 | 74 |
| 33 | 3300005983 | Ga0081540_1095186 | Ga0081540_10951862 | 74 |
| 34 | 3300006881 | Ga0068865_100074371 | Ga0068865_1000743714 | 74 |
| 35 | 3300006881 | Ga0068865_100143183 | Ga0068865_1001431835 | 74 |
| 36 | 3300009093 | Ga0105240_10250357 | Ga0105240_102503574 | 74 |
| 37 | 3300009093 | Ga0105240_10255646 | Ga0105240_102556463 | 74 |
| 38 | 3300009098 | Ga0105245_10463386 | Ga0105245_104633862 | 74 |
| 39 | 3300009098 | Ga0105245_11494134 | Ga0105245_114941342 | 74 |
| 40 | 3300009098 | Ga0105245_12656197 | Ga0105245_126561971 | 74 |
| 41 | 3300009174 | Ga0105241_11648367 | Ga0105241_116483672 | 74 |
| 42 | 3300009176 | Ga0105242_10126004 | Ga0105242_101260043 | 74 |
| 43 | 3300009176 | Ga0105242_10889754 | Ga0105242_108897542 | 74 |
| 44 | 3300009176 | Ga0105242_11184736 | Ga0105242_111847362 | 74 |
| 45 | 3300009177 | Ga0105248_11115583 | Ga0105248_111155832 | 74 |
| 46 | 3300009177 | Ga0105248_11127214 | Ga0105248_111272142 | 74 |
| 47 | 3300009545 | Ga0105237_10823901 | Ga0105237_108239012 | 74 |
| 48 | 3300009551 | Ga0105238_11402758 | Ga0105238_114027582 | 74 |
| 49 | 3300009553 | Ga0105249_10131494 | Ga0105249_101314943 | 74 |
| 50 | 3300009553 | Ga0105249_11250997 | Ga0105249_112509972 | 74 |
| 51 | 3300010375 | Ga0105239_10203074 | Ga0105239_102030743 | 74 |
| 52 | 3300010375 | Ga0105239_10742284 | Ga0105239_107422843 | 74 |
| 53 | 3300010375 | Ga0105239_11512901 | Ga0105239_115129013 | 74 |
| 54 | 3300013104 | Ga0157370_11620059 | Ga0157370_116200592 | 74 |
| 55 | 3300013105 | Ga0157369_10010621 | Ga0157369_100106219 | 74 |
| 56 | 3300013105 | Ga0157369_10710462 | Ga0157369_107104621 | 74 |
| 57 | 3300013296 | Ga0157374_10557521 | Ga0157374_105575212 | 74 |
| 58 | 3300013296 | Ga0157374_10677362 | Ga0157374_106773621 | 74 |
| 59 | 3300013296 | Ga0157374_11858943 | Ga0157374_118589431 | 74 |
| 60 | 3300013306 | Ga0163162_10743024 | Ga0163162_107430242 | 74 |
| 61 | 3300013307 | Ga0157372_10870216 | Ga0157372_108702161 | 74 |
| 62 | 3300013307 | Ga0157372_11244889 | Ga0157372_112448891 | 74 |
| 63 | 3300013308 | Ga0157375_10551512 | Ga0157375_105515122 | 74 |
| 64 | 3300013308 | Ga0157375_11186202 | Ga0157375_111862022 | 74 |
| 65 | 3300013308 | Ga0157375_11240569 | Ga0157375_112405692 | 74 |
| 66 | 3300013308 | Ga0157375_13111895 | Ga0157375_131118952 | 74 |
| 67 | 3300014325 | Ga0163163_10048163 | Ga0163163_100481634 | 74 |
| 68 | 3300014325 | Ga0163163_11539743 | Ga0163163_115397432 | 74 |
| 69 | 3300014969 | Ga0157376_12932570 | Ga0157376_129325701 | 74 |
| 70 | 3300017792 | Ga0163161_11434354 | Ga0163161_114343541 | 74 |
| 71 | 3300021361 | Ga0213872_10125098 | Ga0213872_101250982 | 74 |
| 72 | 3300022467 | Ga0224712_10309580 | Ga0224712_103095802 | 74 |
| 73 | 3300025907 | Ga0207645_10445725 | Ga0207645_104457251 | 74 |
| 74 | 3300025910 | Ga0207684_10475023 | Ga0207684_104750233 | 74 |
| 75 | 3300025913 | Ga0207695_10121468 | Ga0207695_101214683 | 74 |
| 76 | 3300025913 | Ga0207695_10599693 | Ga0207695_105996934 | 74 |
| 77 | 3300025914 | Ga0207671_11454688 | Ga0207671_114546882 | 74 |
| 78 | 3300025915 | Ga0207693_11047702 | Ga0207693_110477021 | 74 |
| 79 | 3300025921 | Ga0207652_10797458 | Ga0207652_107974582 | 74 |
| 80 | 3300025922 | Ga0207646_10762522 | Ga0207646_107625223 | 74 |
| 81 | 3300025924 | Ga0207694_10806551 | Ga0207694_108065512 | 74 |
| 82 | 3300025925 | Ga0207650_10061868 | Ga0207650_100618682 | 74 |
| 83 | 3300025927 | Ga0207687_10269617 | Ga0207687_102696174 | 74 |
| 84 | 3300025938 | Ga0207704_11113546 | Ga0207704_111135462 | 74 |
| 85 | 3300025949 | Ga0207667_11393769 | Ga0207667_113937692 | 74 |
| 86 | 3300025961 | Ga0207712_10483530 | Ga0207712_104835302 | 74 |
| 87 | 3300025961 | Ga0207712_10698303 | Ga0207712_106983032 | 74 |
| 88 | 3300025986 | Ga0207658_10281961 | Ga0207658_102819612 | 74 |
| 89 | 3300025986 | Ga0207658_10494836 | Ga0207658_104948363 | 74 |
| 90 | 3300026035 | Ga0207703_10069971 | Ga0207703_100699711 | 74 |
| 91 | 3300026041 | Ga0207639_10486425 | Ga0207639_104864253 | 74 |
| 92 | 3300026041 | Ga0207639_11895047 | Ga0207639_118950472 | 74 |
| 93 | 3300026067 | Ga0207678_11581821 | Ga0207678_115818211 | 74 |
| 94 | 3300026095 | Ga0207676_10191994 | Ga0207676_101919942 | 74 |
| 95 | 3300026142 | Ga0207698_10889645 | Ga0207698_108896453 | 74 |
| 96 | 3300028379 | Ga0268266_11248067 | Ga0268266_112480672 | 74 |
| 97 | 3300028380 | Ga0268265_10764616 | Ga0268265_107646161 | 74 |
| 98 | 3300028381 | Ga0268264_10544379 | Ga0268264_105443792 | 74 |
| 99 | 3300028381 | Ga0268264_11425333 | Ga0268264_114253331 | 74 |
| 100 | 3300028800 | Ga0265338_10649033 | Ga0265338_106490332 | 74 |
| 101 | 3300031251 | Ga0265327_10019453 | Ga0265327_100194535 | 74 |
| 102 | 3300031344 | Ga0265316_10062605 | Ga0265316_100626055 | 74 |
| 103 | 3300031344 | Ga0265316_10179734 | Ga0265316_101797344 | 74 |
| 104 | 3300031548 | Ga0307408_101006072 | Ga0307408_1010060722 | 74 |
| 105 | 3300031665 | Ga0316575_10003689 | Ga0316575_100036895 | 74 |
| 106 | 3300031665 | Ga0316575_10265698 | Ga0316575_102656982 | 74 |
| 107 | 3300031691 | Ga0316579_10491797 | Ga0316579_104917972 | 74 |
| 108 | 3300031727 | Ga0316576_11223176 | Ga0316576_112231761 | 74 |
| 109 | 3300031731 | Ga0307405_10068871 | Ga0307405_100688713 | 74 |
| 110 | 3300031903 | Ga0307407_10879512 | Ga0307407_108795122 | 74 |
| 111 | 3300032002 | Ga0307416_100382377 | Ga0307416_1003823773 | 74 |
| 112 | 3300032005 | Ga0307411_10551189 | Ga0307411_105511892 | 74 |
| 113 | 3300032005 | Ga0307411_11228451 | Ga0307411_112284512 | 74 |
| 114 | 3300035172 | Ga0373955_0322977 | Ga0373955_0322977_265_489 | 74 |
| 115 | 3300035398 | Ga0316574_0049172 | Ga0316574_0049172_954_1178 | 74 |
| 116 | 3300035725 | Ga0373947_0193895 | Ga0373947_0193895_42_266 | 74 |
| 117 | 3300036401 | Ga0373937_0448077 | Ga0373937_0448077_650_886 | 74 |
| 118 | 3300036647 | Ga0316582_0795990 | Ga0316582_0795990_11_235 | 74 |
| 119 | 3300037312 | Ga0395899_0001218 | Ga0395899_0001218_2603_2827 | 74 |
| 120 | 3300037466 | Ga0395898_0023433 | Ga0395898_0023433_654_878 | 74 |
| 121 | 3300037471 | Ga0395905_0310836 | Ga0395905_0310836_1135_1359 | 74 |
| 122 | 3300038443 | Ga0395901_0078477 | Ga0395901_0078477_2569_2793 | 74 |
| 123 | 3300038725 | Ga0400484_05355 | Ga0400484_05355_105_329 | 74 |
| 124 | 3300038741 | Ga0400488_13305 | Ga0400488_13305_1292_1516 | 74 |
| 125 | 3300039110 | Ga0400487_35887 | Ga0400487_35887_1293_1517 | 74 |
| 126 | 3300039438 | Ga0436360_1069154 | Ga0436360_1069154_1140_1364 | 74 |
| 127 | 3300039447 | Ga0436361_0240997 | Ga0436361_0240997_389_613 | 74 |
| 128 | 3300039447 | Ga0436361_0489833 | Ga0436361_0489833_208_432 | 74 |
| 129 | 3300039447 | Ga0436361_0743953 | Ga0436361_0743953_78_302 | 74 |
| 130 | 3300041404 | Ga0439436_0001772 | Ga0439436_0001772_4936_5160 | 74 |
| 131 | 3300041411 | Ga0439466_0071506 | Ga0439466_0071506_582_806 | 74 |
| 132 | 3300041451 | Ga0451791_0693467 | Ga0451791_0693467_1235_1459 | 74 |
| 133 | 3300041453 | Ga0451797_1253825 | Ga0451797_1253825_772_996 | 74 |
| 134 | 3300041463 | Ga0451804_0340791 | Ga0451804_0340791_34_258 | 74 |
| 135 | 3300041486 | Ga0451807_0104252 | Ga0451807_0104252_598_822 | 74 |
| 136 | 3300041509 | Ga0451843_0320898 | Ga0451843_0320898_1172_1396 | 74 |
| 137 | 3300041512 | Ga0451853_2738728 | Ga0451853_2738728_183_407 | 74 |
| 138 | 3300041997 | Ga0439431_0015010 | Ga0439431_0015010_660_884 | 74 |
| 139 | 3300041999 | Ga0439433_0022708 | Ga0439433_0022708_782_1006 | 74 |
| 140 | 3300042002 | Ga0439442_006496 | Ga0439442_006496_1733_1957 | 74 |
| 141 | 3300042006 | Ga0439432_010838 | Ga0439432_010838_695_919 | 74 |
| 142 | 3300042007 | Ga0439449_0049632 | Ga0439449_0049632_1225_1449 | 74 |
| 143 | 3300042010 | Ga0439452_011190 | Ga0439452_011190_729_953 | 74 |
| 144 | 3300042014 | Ga0439457_010648 | Ga0439457_010648_172_396 | 74 |
| 145 | 3300042015 | Ga0439462_0010820 | Ga0439462_0010820_844_1068 | 74 |
| 146 | 3300042125 | Ga0450923_020516 | Ga0450923_020516_743_967 | 74 |
| 147 | 3300042128 | Ga0450897_000064 | Ga0450897_000064_725_949 | 74 |
| 148 | 3300042131 | Ga0450894_007190 | Ga0450894_007190_489_713 | 74 |
| 149 | 3300042133 | Ga0450896_019585 | Ga0450896_019585_621_845 | 74 |
| 150 | 3300042145 | Ga0450906_010043 | Ga0450906_010043_432_656 | 74 |
| 151 | 3300042156 | Ga0439446_0028184 | Ga0439446_0028184_437_661 | 74 |
| 152 | 3300042185 | Ga0450909_008111 | Ga0450909_008111_731_955 | 74 |
| 153 | 3300042435 | Ga0439434_0206553 | Ga0439434_0206553_104_328 | 74 |
| 154 | 3300044693 | Ga0466961_0118658 | Ga0466961_0118658_1123_1347 | 74 |
| 155 | 3300044712 | Ga0453684_0197550 | Ga0453684_0197550_1531_1755 | 74 |
| 156 | 3300045051 | Ga0451576_0243020 | Ga0451576_0243020_964_1188 | 74 |
| 157 | 3300045051 | Ga0451576_0350839 | Ga0451576_0350839_446_670 | 74 |
| 158 | 3300046472 | Ga0495580_0019784 | Ga0495580_0019784_1423_1647 | 74 |
| 159 | 3300046475 | Ga0495639_0534182 | Ga0495639_0534182_28_252 | 74 |
| 160 | 3300046543 | Ga0495645_0743885 | Ga0495645_0743885_351_575 | 74 |
| 161 | 3300046663 | Ga0495635_1007755 | Ga0495635_1007755_272_496 | 74 |
| 162 | 3300047472 | Ga0495686_0061032 | Ga0495686_0061032_159_383 | 74 |
| 163 | 3300048904 | Ga0496101_0567872 | Ga0496101_0567872_433_657 | 74 |
| 164 | 3300048906 | Ga0496103_0229431 | Ga0496103_0229431_77_301 | 74 |
| 165 | 3300048907 | Ga0496104_1419692 | Ga0496104_1419692_283_507 | 74 |
| 166 | 3300048917 | Ga0496114_0210928 | Ga0496114_0210928_114_338 | 74 |
| 167 | 3300048920 | Ga0496117_0093780 | Ga0496117_0093780_780_1004 | 74 |
| 168 | 3300048920 | Ga0496117_0570082 | Ga0496117_0570082_249_473 | 74 |
| 169 | 3300048921 | Ga0496118_0018575 | Ga0496118_0018575_5230_5454 | 74 |
| 170 | 3300048925 | Ga0496122_0000178 | Ga0496122_0000178_125063_125287 | 74 |
| 171 | 3300048926 | Ga0496123_0000559 | Ga0496123_0000559_62174_62398 | 74 |
| 172 | 3300048929 | Ga0496126_0157351 | Ga0496126_0157351_1344_1568 | 74 |
| 173 | 3300049570 | Ga0501033_0753427 | Ga0501033_0753427_333_557 | 74 |
| 174 | 3300049574 | Ga0501038_0358851 | Ga0501038_0358851_563_787 | 74 |
| 175 | 3300049579 | Ga0501043_0232505 | Ga0501043_0232505_484_708 | 74 |
| 176 | 3300049579 | Ga0501043_0966775 | Ga0501043_0966775_79_303 | 74 |
| 177 | 3300049580 | Ga0501046_0840916 | Ga0501046_0840916_84_308 | 74 |
| 178 | 3300049581 | Ga0501047_0173009 | Ga0501047_0173009_301_525 | 74 |
| 179 | 3300049581 | Ga0501047_0409135 | Ga0501047_0409135_243_467 | 74 |
| 180 | 3300049742 | Ga0501080_0157621 | Ga0501080_0157621_1816_2040 | 74 |
| 181 | 3300050507 | nmdc:mga05p37_1207692_c1 | nmdc:mga05p37_1207692_c1_208_432 | 74 |
| 182 | 3300053087 | Ga0500643_008082 | Ga0500643_008082_11_235 | 74 |
| 183 | 3300053104 | Ga0500556_0053166 | Ga0500556_0053166_1059_1283 | 74 |
| 184 | 3300005329 | Ga0070683_100000972 | Ga0070683_10000097221 | 75 |
| 185 | 3300005336 | Ga0070680_100020330 | Ga0070680_1000203301 | 75 |
| 186 | 3300005339 | Ga0070660_100075036 | Ga0070660_1000750363 | 75 |
| 187 | 3300005341 | Ga0070691_10015751 | Ga0070691_100157515 | 75 |
| 188 | 3300005344 | Ga0070661_100173793 | Ga0070661_1001737932 | 75 |
| 189 | 3300005458 | Ga0070681_10000569 | Ga0070681_100005699 | 75 |
| 190 | 3300005530 | Ga0070679_100000840 | Ga0070679_10000084022 | 75 |
| 191 | 3300005535 | Ga0070684_100002765 | Ga0070684_10000276514 | 75 |
| 192 | 3300005539 | Ga0068853_100218935 | Ga0068853_1002189353 | 75 |
| 193 | 3300005577 | Ga0068857_100003533 | Ga0068857_1000035339 | 75 |
| 194 | 3300005614 | Ga0068856_100000415 | Ga0068856_10000041519 | 75 |
| 195 | 3300005615 | Ga0070702_101051645 | Ga0070702_1010516451 | 75 |
| 196 | 3300005616 | Ga0068852_100142140 | Ga0068852_1001421402 | 75 |
| 197 | 3300005617 | Ga0068859_102552091 | Ga0068859_1025520912 | 75 |
| 198 | 3300006852 | Ga0075433_10536602 | Ga0075433_105366023 | 75 |
| 199 | 3300006931 | Ga0097620_102552690 | Ga0097620_1025526902 | 75 |
| 200 | 3300007788 | Ga0099795_10202026 | Ga0099795_102020262 | 75 |
| 201 | 3300009093 | Ga0105240_10003118 | Ga0105240_1000311814 | 75 |
| 202 | 3300009148 | Ga0105243_11318986 | Ga0105243_113189862 | 75 |
| 203 | 3300009174 | Ga0105241_10039036 | Ga0105241_100390364 | 75 |
| 204 | 3300009174 | Ga0105241_11935381 | Ga0105241_119353812 | 75 |
| 205 | 3300009545 | Ga0105237_10001708 | Ga0105237_100017087 | 75 |
| 206 | 3300009551 | Ga0105238_10000748 | Ga0105238_1000074813 | 75 |
| 207 | 3300010375 | Ga0105239_10004536 | Ga0105239_1000453616 | 75 |
| 208 | 3300013102 | Ga0157371_10363592 | Ga0157371_103635923 | 75 |
| 209 | 3300013105 | Ga0157369_10005557 | Ga0157369_100055574 | 75 |
| 210 | 3300013307 | Ga0157372_10002079 | Ga0157372_100020794 | 75 |
| 211 | 3300020078 | Ga0206352_11198737 | Ga0206352_111987372 | 75 |
| 212 | 3300020610 | Ga0154015_1385700 | Ga0154015_13857002 | 75 |
| 213 | 3300021361 | Ga0213872_10011350 | Ga0213872_100113504 | 75 |
| 214 | 3300022467 | Ga0224712_10479728 | Ga0224712_104797282 | 75 |
| 215 | 3300025909 | Ga0207705_10702885 | Ga0207705_107028851 | 75 |
| 216 | 3300025911 | Ga0207654_10006041 | Ga0207654_100060416 | 75 |
| 217 | 3300025911 | Ga0207654_11110460 | Ga0207654_111104602 | 75 |
| 218 | 3300025912 | Ga0207707_10000594 | Ga0207707_1000059418 | 75 |
| 219 | 3300025913 | Ga0207695_10000597 | Ga0207695_1000059727 | 75 |
| 220 | 3300025914 | Ga0207671_10007132 | Ga0207671_100071323 | 75 |
| 221 | 3300025917 | Ga0207660_10003269 | Ga0207660_100032698 | 75 |
| 222 | 3300025920 | Ga0207649_10430312 | Ga0207649_104303123 | 75 |
| 223 | 3300025921 | Ga0207652_10000972 | Ga0207652_1000097223 | 75 |
| 224 | 3300025924 | Ga0207694_10000375 | Ga0207694_1000037511 | 75 |
| 225 | 3300025944 | Ga0207661_10004738 | Ga0207661_100047384 | 75 |
| 226 | 3300025945 | Ga0207679_10100265 | Ga0207679_101002654 | 75 |
| 227 | 3300025949 | Ga0207667_10000779 | Ga0207667_1000077918 | 75 |
| 228 | 3300026041 | Ga0207639_10067644 | Ga0207639_100676443 | 75 |
| 229 | 3300026078 | Ga0207702_10004458 | Ga0207702_100044587 | 75 |
| 230 | 3300026116 | Ga0207674_10000544 | Ga0207674_1000054425 | 75 |
| 231 | 3300031251 | Ga0265327_10195273 | Ga0265327_101952732 | 75 |
| 232 | 3300031456 | Ga0307513_10314095 | Ga0307513_103140951 | 75 |
| 233 | 3300031727 | Ga0316576_11083714 | Ga0316576_110837141 | 75 |
| 234 | 3300031733 | Ga0316577_10220003 | Ga0316577_102200033 | 75 |
| 235 | 3300032168 | Ga0316593_10112361 | Ga0316593_101123611 | 75 |
| 236 | 3300033528 | Ga0316588_1062368 | Ga0316588_10623682 | 75 |
| 237 | 3300037853 | Ga0436364_1390408 | Ga0436364_1390408_376_603 | 75 |
| 238 | 3300038725 | Ga0400484_25124 | Ga0400484_25124_336_563 | 75 |
| 239 | 3300038726 | Ga0400490_47077 | Ga0400490_47077_4474_4701 | 75 |
| 240 | 3300038727 | Ga0400491_28034 | Ga0400491_28034_819_1046 | 75 |
| 241 | 3300038741 | Ga0400488_38086 | Ga0400488_38086_1089_1316 | 75 |
| 242 | 3300038742 | Ga0400486_08262 | Ga0400486_08262_422_649 | 75 |
| 243 | 3300039062 | Ga0400483_024816 | Ga0400483_024816_1233_1460 | 75 |
| 244 | 3300039062 | Ga0400483_160395 | Ga0400483_160395_1194_1421 | 75 |
| 245 | 3300039447 | Ga0436361_0334611 | Ga0436361_0334611_968_1195 | 75 |
| 246 | 3300039450 | Ga0436363_0356776 | Ga0436363_0356776_302_529 | 75 |
| 247 | 3300044673 | Ga0453683_0006561 | Ga0453683_0006561_2720_2947 | 75 |
| 248 | 3300045051 | Ga0451576_1780738 | Ga0451576_1780738_19_246 | 75 |
| 249 | 3300049568 | Ga0501031_0077434 | Ga0501031_0077434_882_1109 | 75 |
| 250 | 3300049569 | Ga0501032_0829270 | Ga0501032_0829270_332_559 | 75 |
| 251 | 3300049570 | Ga0501033_0031146 | Ga0501033_0031146_1106_1333 | 75 |
| 252 | 3300049572 | Ga0501036_0014429 | Ga0501036_0014429_4291_4518 | 75 |
| 253 | 3300049573 | Ga0501037_0176041 | Ga0501037_0176041_249_476 | 75 |
| 254 | 3300049574 | Ga0501038_0060225 | Ga0501038_0060225_10_237 | 75 |
| 255 | 3300049575 | Ga0501039_0062290 | Ga0501039_0062290_1142_1369 | 75 |
| 256 | 3300049576 | Ga0501040_0005890 | Ga0501040_0005890_4624_4851 | 75 |
| 257 | 3300049577 | Ga0501041_0010493 | Ga0501041_0010493_4929_5156 | 75 |
| 258 | 3300049579 | Ga0501043_0432295 | Ga0501043_0432295_166_393 | 75 |
| 259 | 3300049580 | Ga0501046_0359326 | Ga0501046_0359326_519_746 | 75 |
| 260 | 3300049582 | Ga0501048_0000253 | Ga0501048_0000253_4690_4917 | 75 |
| 261 | 3300049584 | Ga0501068_0729200 | Ga0501068_0729200_383_610 | 75 |
| 262 | 3300049587 | Ga0501071_0200997 | Ga0501071_0200997_122_349 | 75 |
| 263 | 3300049588 | Ga0501072_0041638 | Ga0501072_0041638_3076_3303 | 75 |
| 264 | 3300049590 | Ga0501074_0106588 | Ga0501074_0106588_1555_1782 | 75 |
| 265 | 3300049591 | Ga0501075_0010119 | Ga0501075_0010119_5462_5689 | 75 |
| 266 | 3300049592 | Ga0501076_0002739 | Ga0501076_0002739_3350_3577 | 75 |
| 267 | 3300049593 | Ga0501077_0015580 | Ga0501077_0015580_4016_4243 | 75 |
| 268 | 3300049741 | Ga0501079_0006658 | Ga0501079_0006658_3643_3870 | 75 |
| 269 | 3300049742 | Ga0501080_0525628 | Ga0501080_0525628_695_922 | 75 |
| 270 | 3300049743 | Ga0501081_0003769 | Ga0501081_0003769_3624_3851 | 75 |
| 271 | 3300049822 | Ga0501035_0228265 | Ga0501035_0228265_362_589 | 75 |
| 272 | 3300049823 | Ga0501044_0684341 | Ga0501044_0684341_316_543 | 75 |
| 273 | 3300049824 | Ga0501045_0000612 | Ga0501045_0000612_4102_4329 | 75 |
| 274 | 3300050515 | nmdc:mga0a205_286127_c1 | nmdc:mga0a205_286127_c1_378_605 | 75 |
| 275 | 3300053080 | Ga0500635_0084977 | Ga0500635_0084977_431_658 | 75 |
| 276 | 3300053162 | Ga0500638_212202 | Ga0500638_212202_93_320 | 75 |
| 277 | 3300053163 | Ga0500639_056576 | Ga0500639_056576_214_441 | 75 |
| 278 | 3300053178 | Ga0500637_0044387 | Ga0500637_0044387_107_334 | 75 |
| 279 | 3300054114 | Ga0501084_0018078 | Ga0501084_0018078_129_356 | 75 |
| 280 | 3300059630 | Ga0587128_131312 | Ga0587128_131312_129_356 | 75 |
| 281 | 3300060353 | Ga0501082_0040433 | Ga0501082_0040433_51_278 | 75 |
| 282 | 3300061734 | Ga0530510_0000518 | Ga0530510_0000518_23162_23389 | 75 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1whz-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.8824 | 6 | 72 |
| 6g26-assembly1.cif.gz_F | the crystal structure of the burkholderia pseudomallei hicab complex | 0.8717 | 10 | 66 |
| 1whz-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.8146 | 6 | 72 |
| 6g26-assembly1.cif.gz_F | the crystal structure of the burkholderia pseudomallei hicab complex | 0.8077 | 10 | 66 |
| 4c26-assembly1.cif.gz_A | solution nmr structure of the hica toxin from burkholderia pseudomallei | 0.7824 | 13 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1whzA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. | 0.8794 | 6 | 72 | 3.30.920.30 |
| 6g26F00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. | 0.8717 | 10 | 66 | 3.30.920.30 |
| af_I1JVU1_126_189_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8585 | 21 | 45 | 2.40.50.140 |
| af_I1JTQ5_49_133_3.30.2020.30 | Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; | 0.8426 | 20 | 44 | 3.30.2020.30 |
| 1whzA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. | 0.8324 | 6 | 72 | 3.30.920.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D8F7W9-F1-model_v4 | Toxin-antitoxin system, toxin component, HicA family | 1.002 | 10 | 75 |
GO:0003729
GO:0004519 |
| AF-A0A1F6SXA8-F1-model_v4 | Addiction module toxin, HicA family | 0.9982 | 1 | 72 |
GO:0003729
GO:0004519 |
| AF-A0A1B7VCJ6-F1-model_v4 | Addiction module toxin, HicA family | 0.9923 | 1 | 72 |
GO:0003729
GO:0004519 |
| AF-W6FLT8-F1-model_v4 | deleted | 0.9868 | 1 | 72 |
|
| AF-A0A4P6L9Y7-F1-model_v4 | deleted | 0.9848 | 1 | 73 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar