F384888

General Info

Members Datasets Scaffolds Average Seq Length
282 210 282 74

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10255646|Ga0105240_102556463
Length 78
Sequence LLPEMGRLAGFRYREIRRKLKACGFEFDRQAAGSHEIWFNPTTKRYTTIPNHPGDMPEGTLRAILKQAGIDVDFFLAA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
100 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
122 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
123 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
124 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
125 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
149 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
150 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
151 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
205 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
206 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 2.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 2.84
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000972 3300005329 Bacteria 21350
2 Ga0070670_100546693 3300005331 Bacteria 1033
3 Ga0070670_101153333 3300005331 Unclassified 707
4 Ga0070666_10626913 3300005335 Bacteria 785
5 Ga0070680_100020330 3300005336 Bacteria 5270
6 Ga0070660_100075036 3300005339 Bacteria 2647
7 Ga0070691_10015751 3300005341 Bacteria 3474
8 Ga0070661_100173793 3300005344 Bacteria 1637
9 Ga0070668_100472478 3300005347 Bacteria 1082
10 Ga0070688_100030634 3300005365 Bacteria 3230
11 Ga0070667_100920030 3300005367 Bacteria 814
12 Ga0070667_101024414 3300005367 Bacteria 770
13 Ga0070663_101693057 3300005455 Unclassified 565
14 Ga0070681_10000569 3300005458 Bacteria 30428
15 Ga0070685_10001702 3300005466 Bacteria 11560
16 Ga0070706_100619766 3300005467 Unclassified 1005
17 Ga0070706_101041456 3300005467 Bacteria 754
18 Ga0070698_100000461 3300005471 Bacteria 43074
19 Ga0070679_100000840 3300005530 Bacteria 26739
20 Ga0070684_100002765 3300005535 Bacteria 12984
21 Ga0070697_100082461 3300005536 Bacteria 2651
22 Ga0070697_101833498 3300005536 Bacteria 543
23 Ga0068853_100218935 3300005539 Bacteria 1738
24 Ga0068853_100223282 3300005539 Bacteria 1721
25 Ga0068853_101849148 3300005539 Unclassified 585
26 Ga0070696_100014525 3300005546 Bacteria 5285
27 Ga0070665_100126431 3300005548 Bacteria 2559
28 Ga0068855_101022022 3300005563 Bacteria 867
29 Ga0068855_101410476 3300005563 Unclassified 718
30 Ga0068857_100003533 3300005577 Bacteria 13064
31 Ga0068856_100000415 3300005614 Bacteria 47035
32 Ga0070702_100446668 3300005615 Bacteria 937
33 Ga0070702_101051645 3300005615 Unclassified 647
34 Ga0068852_100126651 3300005616 Bacteria 2346
35 Ga0068852_100142140 3300005616 Bacteria 2222
36 Ga0068859_102552091 3300005617 Unclassified 562
37 Ga0068864_100273458 3300005618 Bacteria 1575
38 Ga0068851_11078636 3300005834 Unclassified 509
39 Ga0068863_101032319 3300005841 Bacteria 825
40 Ga0068863_101833455 3300005841 Unclassified 616
41 Ga0068858_100429858 3300005842 Bacteria 1270
42 Ga0068860_100498597 3300005843 Unclassified 1215
43 Ga0081455_10001165 3300005937 Bacteria 32867
44 Ga0081540_1095186 3300005983 Bacteria 1299
45 Ga0075433_10536602 3300006852 Bacteria 1029
46 Ga0068865_100074371 3300006881 Bacteria 2419
47 Ga0068865_100143183 3300006881 Bacteria 1805
48 Ga0097620_102552690 3300006931 Unclassified 562
49 Ga0099795_10202026 3300007788 Unclassified 839
50 Ga0105240_10003118 3300009093 Bacteria 26098
51 Ga0105240_10250357 3300009093 Bacteria 2049
52 Ga0105240_10255646 3300009093 Bacteria 2023
53 Ga0105245_10463386 3300009098 Bacteria 1278
54 Ga0105245_11494134 3300009098 Bacteria 726
55 Ga0105245_12656197 3300009098 Unclassified 554
56 Ga0105243_11318986 3300009148 Unclassified 739
57 Ga0105241_10039036 3300009174 Bacteria 3581
58 Ga0105241_11648367 3300009174 Unclassified 622
59 Ga0105241_11935381 3300009174 Unclassified 579
60 Ga0105242_10126004 3300009176 Unclassified 2204
61 Ga0105242_10889754 3300009176 Bacteria 889
62 Ga0105242_11184736 3300009176 Bacteria 782
63 Ga0105248_11115583 3300009177 Unclassified 892
64 Ga0105248_11127214 3300009177 Unclassified 887
65 Ga0105237_10001708 3300009545 Bacteria 28398
66 Ga0105237_10823901 3300009545 Bacteria 935
67 Ga0105238_10000748 3300009551 Bacteria 33846
68 Ga0105238_11402758 3300009551 Unclassified 726
69 Ga0105249_10131494 3300009553 Bacteria 2390
70 Ga0105249_11250997 3300009553 Bacteria 814
71 Ga0105239_10004536 3300010375 Bacteria 16546
72 Ga0105239_10203074 3300010375 Bacteria 2221
73 Ga0105239_10742284 3300010375 Unclassified 1123
74 Ga0105239_11512901 3300010375 Bacteria 776
75 Ga0157371_10363592 3300013102 Bacteria 1055
76 Ga0157370_11620059 3300013104 Bacteria 581
77 Ga0157369_10005557 3300013105 Bacteria 14638
78 Ga0157369_10010621 3300013105 Bacteria 10481
79 Ga0157369_10710462 3300013105 Unclassified 1035
80 Ga0157374_10557521 3300013296 Bacteria 1154
81 Ga0157374_10677362 3300013296 Bacteria 1044
82 Ga0157374_11858943 3300013296 Bacteria 628
83 Ga0163162_10743024 3300013306 Bacteria 1101
84 Ga0157372_10002079 3300013307 Bacteria 21751
85 Ga0157372_10870216 3300013307 Bacteria 1046
86 Ga0157372_11244889 3300013307 Unclassified 859
87 Ga0157375_10551512 3300013308 Unclassified 1314
88 Ga0157375_11186202 3300013308 Bacteria 895
89 Ga0157375_11240569 3300013308 Bacteria 875
90 Ga0157375_13111895 3300013308 Bacteria 554
91 Ga0163163_10048163 3300014325 Bacteria 4190
92 Ga0163163_11539743 3300014325 Unclassified 726
93 Ga0157376_12932570 3300014969 Unclassified 516
94 Ga0163161_11434354 3300017792 Unclassified 604
95 Ga0206352_11198737 3300020078 Unclassified 561
96 Ga0154015_1385700 3300020610 Unclassified 595
97 Ga0213872_10011350 3300021361 Bacteria 4217
98 Ga0213872_10125098 3300021361 Bacteria 1135
99 Ga0224712_10309580 3300022467 Unclassified 740
100 Ga0224712_10479728 3300022467 Unclassified 599
101 Ga0207645_10445725 3300025907 Bacteria 873
102 Ga0207705_10702885 3300025909 Bacteria 786
103 Ga0207684_10475023 3300025910 Bacteria 1073
104 Ga0207654_10006041 3300025911 Bacteria 6089
105 Ga0207654_11110460 3300025911 Unclassified 576
106 Ga0207707_10000594 3300025912 Bacteria 36476
107 Ga0207695_10000597 3300025913 Bacteria 72390
108 Ga0207695_10121468 3300025913 Bacteria 2579
109 Ga0207695_10599693 3300025913 Bacteria 982
110 Ga0207671_10007132 3300025914 Bacteria 9755
111 Ga0207671_11454688 3300025914 Unclassified 530
112 Ga0207693_11047702 3300025915 Bacteria 621
113 Ga0207660_10003269 3300025917 Bacteria 10602
114 Ga0207649_10430312 3300025920 Bacteria 993
115 Ga0207652_10000972 3300025921 Bacteria 26766
116 Ga0207652_10797458 3300025921 Bacteria 839
117 Ga0207646_10762522 3300025922 Bacteria 863
118 Ga0207694_10000375 3300025924 Bacteria 41549
119 Ga0207694_10806551 3300025924 Unclassified 793
120 Ga0207650_10061868 3300025925 Bacteria 2796
121 Ga0207687_10269617 3300025927 Bacteria 1360
122 Ga0207704_11113546 3300025938 Bacteria 671
123 Ga0207661_10004738 3300025944 Bacteria 9527
124 Ga0207679_10100265 3300025945 Bacteria 2263
125 Ga0207667_10000779 3300025949 Bacteria 41333
126 Ga0207667_11393769 3300025949 Bacteria 675
127 Ga0207712_10483530 3300025961 Bacteria 1056
128 Ga0207712_10698303 3300025961 Bacteria 885
129 Ga0207658_10281961 3300025986 Bacteria 1425
130 Ga0207658_10494836 3300025986 Bacteria 1088
131 Ga0207703_10069971 3300026035 Unclassified 2895
132 Ga0207639_10067644 3300026041 Bacteria 2780
133 Ga0207639_10486425 3300026041 Bacteria 1125
134 Ga0207639_11895047 3300026041 Unclassified 557
135 Ga0207678_11581821 3300026067 Unclassified 577
136 Ga0207702_10004458 3300026078 Bacteria 12441
137 Ga0207676_10191994 3300026095 Bacteria 1798
138 Ga0207674_10000544 3300026116 Bacteria 49416
139 Ga0207698_10889645 3300026142 Bacteria 897
140 Ga0268266_11248067 3300028379 Unclassified 718
141 Ga0268265_10764616 3300028380 Bacteria 939
142 Ga0268264_10544379 3300028381 Unclassified 1138
143 Ga0268264_11425333 3300028381 Bacteria 703
144 Ga0265338_10649033 3300028800 Unclassified 732
145 Ga0265327_10019453 3300031251 Bacteria 4173
146 Ga0265327_10195273 3300031251 Bacteria 919
147 Ga0265316_10062605 3300031344 Bacteria 2887
148 Ga0265316_10179734 3300031344 Unclassified 1575
149 Ga0307513_10314095 3300031456 Archaea 1328
150 Ga0307408_101006072 3300031548 Unclassified 768
151 Ga0316575_10003689 3300031665 Bacteria 5313
152 Ga0316575_10265698 3300031665 Bacteria 721
153 Ga0316579_10491797 3300031691 Bacteria 594
154 Ga0316576_11083714 3300031727 Bacteria 569
155 Ga0316576_11223176 3300031727 Unclassified 530
156 Ga0316578_10345254 3300031728 Unclassified 886
157 Ga0307405_10068871 3300031731 Bacteria 2266
158 Ga0316577_10220003 3300031733 Bacteria 1073
159 Ga0307407_10879512 3300031903 Bacteria 686
160 Ga0307416_100382377 3300032002 Bacteria 1438
161 Ga0307411_10551189 3300032005 Bacteria 984
162 Ga0307411_11228451 3300032005 Bacteria 680
163 Ga0316593_10112361 3300032168 Unclassified 973
164 Ga0316588_1062368 3300033528 Unclassified 910
165 Ga0316596_1120630 3300033541 Unclassified 714
166 Ga0373955_0322977 3300035172 Unclassified 933
167 Ga0316574_0049172 3300035398 Bacteria 2621
168 Ga0373947_0193895 3300035725 Bacteria 1327
169 Ga0373937_0448077 3300036401 Bacteria 1226
170 Ga0316582_0795990 3300036647 Unclassified 648
171 Ga0395899_0001218 3300037312 Bacteria 22536
172 Ga0395898_0023433 3300037466 Bacteria 6239
173 Ga0395905_0310836 3300037471 Bacteria 1464
174 Ga0436364_1390408 3300037853 Bacteria 1551
175 Ga0395901_0078477 3300038443 Bacteria 3447
176 Ga0400484_05355 3300038725 Bacteria 1177
177 Ga0400484_25124 3300038725 Unclassified 1329
178 Ga0400490_47077 3300038726 Bacteria 4972
179 Ga0400491_28034 3300038727 Bacteria 1330
180 Ga0400488_13305 3300038741 Bacteria 2579
181 Ga0400488_38086 3300038741 Bacteria 2100
182 Ga0400486_08262 3300038742 Bacteria 1573
183 Ga0400483_024816 3300039062 Bacteria 2081
184 Ga0400483_160395 3300039062 Bacteria 3335
185 Ga0400487_35887 3300039110 Bacteria 2503
186 Ga0436360_1069154 3300039438 Bacteria 1465
187 Ga0436361_0240997 3300039447 Bacteria 1307
188 Ga0436361_0334611 3300039447 Bacteria 1855
189 Ga0436361_0489833 3300039447 Bacteria 1790
190 Ga0436361_0743953 3300039447 Unclassified 637
191 Ga0436363_0356776 3300039450 Unclassified 565
192 Ga0439436_0001772 3300041404 Bacteria 6347
193 Ga0439466_0071506 3300041411 Bacteria 1104
194 Ga0451791_0693467 3300041451 Bacteria 2266
195 Ga0451797_1253825 3300041453 Bacteria 1221
196 Ga0451804_0340791 3300041463 Bacteria 1183
197 Ga0451807_0104252 3300041486 Bacteria 2140
198 Ga0451843_0320898 3300041509 Bacteria 1945
199 Ga0451853_2738728 3300041512 Bacteria 504
200 Ga0439431_0015010 3300041997 Bacteria 1800
201 Ga0439433_0022708 3300041999 Bacteria 1409
202 Ga0439442_006496 3300042002 Bacteria 2348
203 Ga0439432_010838 3300042006 Bacteria 3149
204 Ga0439449_0049632 3300042007 Bacteria 1552
205 Ga0439452_011190 3300042010 Bacteria 2586
206 Ga0439457_010648 3300042014 Bacteria 2109
207 Ga0439462_0010820 3300042015 Bacteria 2315
208 Ga0450923_020516 3300042125 Bacteria 1281
209 Ga0450897_000064 3300042128 Bacteria 4806
210 Ga0450894_007190 3300042131 Bacteria 1436
211 Ga0450896_019585 3300042133 Bacteria 986
212 Ga0450906_010043 3300042145 Bacteria 1795
213 Ga0439446_0028184 3300042156 Bacteria 1616
214 Ga0450909_008111 3300042185 Bacteria 1524
215 Ga0439434_0206553 3300042435 Bacteria 663
216 Ga0453683_0006561 3300044673 Bacteria 7973
217 Ga0466961_0118658 3300044693 Bacteria 1662
218 Ga0453684_0197550 3300044712 Bacteria 2347
219 Ga0451576_0243020 3300045051 Bacteria 1880
220 Ga0451576_0350839 3300045051 Bacteria 1545
221 Ga0451576_1780738 3300045051 Unclassified 637
222 Ga0495580_0019784 3300046472 Bacteria 4996
223 Ga0495639_0534182 3300046475 Unclassified 600
224 Ga0495645_0743885 3300046543 Bacteria 592
225 Ga0495635_1007755 3300046663 Unclassified 530
226 Ga0495686_0061032 3300047472 Bacteria 2343
227 Ga0496101_0567872 3300048904 Unclassified 897
228 Ga0496103_0229431 3300048906 Bacteria 1194
229 Ga0496104_1419692 3300048907 Unclassified 597
230 Ga0496114_0210928 3300048917 Bacteria 1703
231 Ga0496117_0093780 3300048920 Bacteria 1924
232 Ga0496117_0570082 3300048920 Bacteria 535
233 Ga0496118_0018575 3300048921 Bacteria 6263
234 Ga0496122_0000178 3300048925 Bacteria 150162
235 Ga0496123_0000559 3300048926 Bacteria 63800
236 Ga0496126_0157351 3300048929 Bacteria 1944
237 Ga0501031_0077434 3300049568 Unclassified 2166
238 Ga0501032_0829270 3300049569 Unclassified 583
239 Ga0501033_0031146 3300049570 Plasmid 4010
240 Ga0501033_0753427 3300049570 Bacteria 660
241 Ga0501036_0014429 3300049572 Bacteria 6581
242 Ga0501037_0176041 3300049573 Unclassified 1519
243 Ga0501038_0060225 3300049574 Bacteria 3249
244 Ga0501038_0358851 3300049574 Bacteria 1134
245 Ga0501039_0062290 3300049575 Unclassified 2890
246 Ga0501040_0005890 3300049576 Bacteria 7934
247 Ga0501041_0010493 3300049577 Bacteria 5459
248 Ga0501043_0232505 3300049579 Bacteria 1424
249 Ga0501043_0432295 3300049579 Unclassified 991
250 Ga0501043_0966775 3300049579 Unclassified 608
251 Ga0501046_0359326 3300049580 Unclassified 1056
252 Ga0501046_0840916 3300049580 Bacteria 642
253 Ga0501047_0173009 3300049581 Bacteria 2028
254 Ga0501047_0409135 3300049581 Bacteria 1189
255 Ga0501048_0000253 3300049582 Bacteria 35754
256 Ga0501068_0729200 3300049584 Unclassified 648
257 Ga0501071_0200997 3300049587 Unclassified 1497
258 Ga0501072_0041638 3300049588 Bacteria 3609
259 Ga0501074_0106588 3300049590 Unclassified 2006
260 Ga0501075_0010119 3300049591 Bacteria 6617
261 Ga0501076_0002739 3300049592 Bacteria 12201
262 Ga0501077_0015580 3300049593 Bacteria 4786
263 Ga0501079_0006658 3300049741 Bacteria 8690
264 Ga0501080_0157621 3300049742 Bacteria 2097
265 Ga0501080_0525628 3300049742 Unclassified 1055
266 Ga0501081_0003769 3300049743 Bacteria 9709
267 Ga0501035_0228265 3300049822 Unclassified 1587
268 Ga0501044_0684341 3300049823 Unclassified 912
269 Ga0501045_0000612 3300049824 Bacteria 22530
270 nmdc:mga05p37_1207692_c1 3300050507 Bacteria 780
271 nmdc:mga0a205_286127_c1 3300050515 Bacteria 1523
272 Ga0500635_0084977 3300053080 Bacteria 1143
273 Ga0500643_008082 3300053087 Bacteria 4168
274 Ga0500556_0053166 3300053104 Bacteria 1472
275 Ga0500638_212202 3300053162 Bacteria 810
276 Ga0500639_056576 3300053163 Bacteria 2031
277 Ga0500637_0044387 3300053178 Bacteria 2518
278 Ga0501084_0018078 3300054114 Bacteria 5872
279 Ga0587128_131312 3300059630 Bacteria 554
280 Ga0501082_0040433 3300060353 Bacteria 4022
281 Ga0501082_1317379 3300060353 Unclassified 631
282 Ga0530510_0000518 3300061734 Bacteria 24630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_101833498 Ga0070697_1018334982 71
2 3300005546 Ga0070696_100014525 Ga0070696_1000145253 71
3 3300060353 Ga0501082_1317379 Ga0501082_1317379_310_525 71
4 3300031728 Ga0316578_10345254 Ga0316578_103452541 72
5 3300033541 Ga0316596_1120630 Ga0316596_11206301 72
6 3300005331 Ga0070670_100546693 Ga0070670_1005466932 74
7 3300005331 Ga0070670_101153333 Ga0070670_1011533333 74
8 3300005335 Ga0070666_10626913 Ga0070666_106269131 74
9 3300005347 Ga0070668_100472478 Ga0070668_1004724783 74
10 3300005365 Ga0070688_100030634 Ga0070688_1000306342 74
11 3300005367 Ga0070667_100920030 Ga0070667_1009200301 74
12 3300005367 Ga0070667_101024414 Ga0070667_1010244141 74
13 3300005455 Ga0070663_101693057 Ga0070663_1016930572 74
14 3300005466 Ga0070685_10001702 Ga0070685_1000170213 74
15 3300005467 Ga0070706_100619766 Ga0070706_1006197662 74
16 3300005467 Ga0070706_101041456 Ga0070706_1010414563 74
17 3300005471 Ga0070698_100000461 Ga0070698_1000004616 74
18 3300005536 Ga0070697_100082461 Ga0070697_1000824613 74
19 3300005539 Ga0068853_100223282 Ga0068853_1002232822 74
20 3300005539 Ga0068853_101849148 Ga0068853_1018491482 74
21 3300005548 Ga0070665_100126431 Ga0070665_1001264312 74
22 3300005563 Ga0068855_101022022 Ga0068855_1010220223 74
23 3300005563 Ga0068855_101410476 Ga0068855_1014104762 74
24 3300005615 Ga0070702_100446668 Ga0070702_1004466683 74
25 3300005616 Ga0068852_100126651 Ga0068852_1001266512 74
26 3300005618 Ga0068864_100273458 Ga0068864_1002734582 74
27 3300005834 Ga0068851_11078636 Ga0068851_110786362 74
28 3300005841 Ga0068863_101032319 Ga0068863_1010323193 74
29 3300005841 Ga0068863_101833455 Ga0068863_1018334552 74
30 3300005842 Ga0068858_100429858 Ga0068858_1004298583 74
31 3300005843 Ga0068860_100498597 Ga0068860_1004985972 74
32 3300005937 Ga0081455_10001165 Ga0081455_1000116513 74
33 3300005983 Ga0081540_1095186 Ga0081540_10951862 74
34 3300006881 Ga0068865_100074371 Ga0068865_1000743714 74
35 3300006881 Ga0068865_100143183 Ga0068865_1001431835 74
36 3300009093 Ga0105240_10250357 Ga0105240_102503574 74
37 3300009093 Ga0105240_10255646 Ga0105240_102556463 74
38 3300009098 Ga0105245_10463386 Ga0105245_104633862 74
39 3300009098 Ga0105245_11494134 Ga0105245_114941342 74
40 3300009098 Ga0105245_12656197 Ga0105245_126561971 74
41 3300009174 Ga0105241_11648367 Ga0105241_116483672 74
42 3300009176 Ga0105242_10126004 Ga0105242_101260043 74
43 3300009176 Ga0105242_10889754 Ga0105242_108897542 74
44 3300009176 Ga0105242_11184736 Ga0105242_111847362 74
45 3300009177 Ga0105248_11115583 Ga0105248_111155832 74
46 3300009177 Ga0105248_11127214 Ga0105248_111272142 74
47 3300009545 Ga0105237_10823901 Ga0105237_108239012 74
48 3300009551 Ga0105238_11402758 Ga0105238_114027582 74
49 3300009553 Ga0105249_10131494 Ga0105249_101314943 74
50 3300009553 Ga0105249_11250997 Ga0105249_112509972 74
51 3300010375 Ga0105239_10203074 Ga0105239_102030743 74
52 3300010375 Ga0105239_10742284 Ga0105239_107422843 74
53 3300010375 Ga0105239_11512901 Ga0105239_115129013 74
54 3300013104 Ga0157370_11620059 Ga0157370_116200592 74
55 3300013105 Ga0157369_10010621 Ga0157369_100106219 74
56 3300013105 Ga0157369_10710462 Ga0157369_107104621 74
57 3300013296 Ga0157374_10557521 Ga0157374_105575212 74
58 3300013296 Ga0157374_10677362 Ga0157374_106773621 74
59 3300013296 Ga0157374_11858943 Ga0157374_118589431 74
60 3300013306 Ga0163162_10743024 Ga0163162_107430242 74
61 3300013307 Ga0157372_10870216 Ga0157372_108702161 74
62 3300013307 Ga0157372_11244889 Ga0157372_112448891 74
63 3300013308 Ga0157375_10551512 Ga0157375_105515122 74
64 3300013308 Ga0157375_11186202 Ga0157375_111862022 74
65 3300013308 Ga0157375_11240569 Ga0157375_112405692 74
66 3300013308 Ga0157375_13111895 Ga0157375_131118952 74
67 3300014325 Ga0163163_10048163 Ga0163163_100481634 74
68 3300014325 Ga0163163_11539743 Ga0163163_115397432 74
69 3300014969 Ga0157376_12932570 Ga0157376_129325701 74
70 3300017792 Ga0163161_11434354 Ga0163161_114343541 74
71 3300021361 Ga0213872_10125098 Ga0213872_101250982 74
72 3300022467 Ga0224712_10309580 Ga0224712_103095802 74
73 3300025907 Ga0207645_10445725 Ga0207645_104457251 74
74 3300025910 Ga0207684_10475023 Ga0207684_104750233 74
75 3300025913 Ga0207695_10121468 Ga0207695_101214683 74
76 3300025913 Ga0207695_10599693 Ga0207695_105996934 74
77 3300025914 Ga0207671_11454688 Ga0207671_114546882 74
78 3300025915 Ga0207693_11047702 Ga0207693_110477021 74
79 3300025921 Ga0207652_10797458 Ga0207652_107974582 74
80 3300025922 Ga0207646_10762522 Ga0207646_107625223 74
81 3300025924 Ga0207694_10806551 Ga0207694_108065512 74
82 3300025925 Ga0207650_10061868 Ga0207650_100618682 74
83 3300025927 Ga0207687_10269617 Ga0207687_102696174 74
84 3300025938 Ga0207704_11113546 Ga0207704_111135462 74
85 3300025949 Ga0207667_11393769 Ga0207667_113937692 74
86 3300025961 Ga0207712_10483530 Ga0207712_104835302 74
87 3300025961 Ga0207712_10698303 Ga0207712_106983032 74
88 3300025986 Ga0207658_10281961 Ga0207658_102819612 74
89 3300025986 Ga0207658_10494836 Ga0207658_104948363 74
90 3300026035 Ga0207703_10069971 Ga0207703_100699711 74
91 3300026041 Ga0207639_10486425 Ga0207639_104864253 74
92 3300026041 Ga0207639_11895047 Ga0207639_118950472 74
93 3300026067 Ga0207678_11581821 Ga0207678_115818211 74
94 3300026095 Ga0207676_10191994 Ga0207676_101919942 74
95 3300026142 Ga0207698_10889645 Ga0207698_108896453 74
96 3300028379 Ga0268266_11248067 Ga0268266_112480672 74
97 3300028380 Ga0268265_10764616 Ga0268265_107646161 74
98 3300028381 Ga0268264_10544379 Ga0268264_105443792 74
99 3300028381 Ga0268264_11425333 Ga0268264_114253331 74
100 3300028800 Ga0265338_10649033 Ga0265338_106490332 74
101 3300031251 Ga0265327_10019453 Ga0265327_100194535 74
102 3300031344 Ga0265316_10062605 Ga0265316_100626055 74
103 3300031344 Ga0265316_10179734 Ga0265316_101797344 74
104 3300031548 Ga0307408_101006072 Ga0307408_1010060722 74
105 3300031665 Ga0316575_10003689 Ga0316575_100036895 74
106 3300031665 Ga0316575_10265698 Ga0316575_102656982 74
107 3300031691 Ga0316579_10491797 Ga0316579_104917972 74
108 3300031727 Ga0316576_11223176 Ga0316576_112231761 74
109 3300031731 Ga0307405_10068871 Ga0307405_100688713 74
110 3300031903 Ga0307407_10879512 Ga0307407_108795122 74
111 3300032002 Ga0307416_100382377 Ga0307416_1003823773 74
112 3300032005 Ga0307411_10551189 Ga0307411_105511892 74
113 3300032005 Ga0307411_11228451 Ga0307411_112284512 74
114 3300035172 Ga0373955_0322977 Ga0373955_0322977_265_489 74
115 3300035398 Ga0316574_0049172 Ga0316574_0049172_954_1178 74
116 3300035725 Ga0373947_0193895 Ga0373947_0193895_42_266 74
117 3300036401 Ga0373937_0448077 Ga0373937_0448077_650_886 74
118 3300036647 Ga0316582_0795990 Ga0316582_0795990_11_235 74
119 3300037312 Ga0395899_0001218 Ga0395899_0001218_2603_2827 74
120 3300037466 Ga0395898_0023433 Ga0395898_0023433_654_878 74
121 3300037471 Ga0395905_0310836 Ga0395905_0310836_1135_1359 74
122 3300038443 Ga0395901_0078477 Ga0395901_0078477_2569_2793 74
123 3300038725 Ga0400484_05355 Ga0400484_05355_105_329 74
124 3300038741 Ga0400488_13305 Ga0400488_13305_1292_1516 74
125 3300039110 Ga0400487_35887 Ga0400487_35887_1293_1517 74
126 3300039438 Ga0436360_1069154 Ga0436360_1069154_1140_1364 74
127 3300039447 Ga0436361_0240997 Ga0436361_0240997_389_613 74
128 3300039447 Ga0436361_0489833 Ga0436361_0489833_208_432 74
129 3300039447 Ga0436361_0743953 Ga0436361_0743953_78_302 74
130 3300041404 Ga0439436_0001772 Ga0439436_0001772_4936_5160 74
131 3300041411 Ga0439466_0071506 Ga0439466_0071506_582_806 74
132 3300041451 Ga0451791_0693467 Ga0451791_0693467_1235_1459 74
133 3300041453 Ga0451797_1253825 Ga0451797_1253825_772_996 74
134 3300041463 Ga0451804_0340791 Ga0451804_0340791_34_258 74
135 3300041486 Ga0451807_0104252 Ga0451807_0104252_598_822 74
136 3300041509 Ga0451843_0320898 Ga0451843_0320898_1172_1396 74
137 3300041512 Ga0451853_2738728 Ga0451853_2738728_183_407 74
138 3300041997 Ga0439431_0015010 Ga0439431_0015010_660_884 74
139 3300041999 Ga0439433_0022708 Ga0439433_0022708_782_1006 74
140 3300042002 Ga0439442_006496 Ga0439442_006496_1733_1957 74
141 3300042006 Ga0439432_010838 Ga0439432_010838_695_919 74
142 3300042007 Ga0439449_0049632 Ga0439449_0049632_1225_1449 74
143 3300042010 Ga0439452_011190 Ga0439452_011190_729_953 74
144 3300042014 Ga0439457_010648 Ga0439457_010648_172_396 74
145 3300042015 Ga0439462_0010820 Ga0439462_0010820_844_1068 74
146 3300042125 Ga0450923_020516 Ga0450923_020516_743_967 74
147 3300042128 Ga0450897_000064 Ga0450897_000064_725_949 74
148 3300042131 Ga0450894_007190 Ga0450894_007190_489_713 74
149 3300042133 Ga0450896_019585 Ga0450896_019585_621_845 74
150 3300042145 Ga0450906_010043 Ga0450906_010043_432_656 74
151 3300042156 Ga0439446_0028184 Ga0439446_0028184_437_661 74
152 3300042185 Ga0450909_008111 Ga0450909_008111_731_955 74
153 3300042435 Ga0439434_0206553 Ga0439434_0206553_104_328 74
154 3300044693 Ga0466961_0118658 Ga0466961_0118658_1123_1347 74
155 3300044712 Ga0453684_0197550 Ga0453684_0197550_1531_1755 74
156 3300045051 Ga0451576_0243020 Ga0451576_0243020_964_1188 74
157 3300045051 Ga0451576_0350839 Ga0451576_0350839_446_670 74
158 3300046472 Ga0495580_0019784 Ga0495580_0019784_1423_1647 74
159 3300046475 Ga0495639_0534182 Ga0495639_0534182_28_252 74
160 3300046543 Ga0495645_0743885 Ga0495645_0743885_351_575 74
161 3300046663 Ga0495635_1007755 Ga0495635_1007755_272_496 74
162 3300047472 Ga0495686_0061032 Ga0495686_0061032_159_383 74
163 3300048904 Ga0496101_0567872 Ga0496101_0567872_433_657 74
164 3300048906 Ga0496103_0229431 Ga0496103_0229431_77_301 74
165 3300048907 Ga0496104_1419692 Ga0496104_1419692_283_507 74
166 3300048917 Ga0496114_0210928 Ga0496114_0210928_114_338 74
167 3300048920 Ga0496117_0093780 Ga0496117_0093780_780_1004 74
168 3300048920 Ga0496117_0570082 Ga0496117_0570082_249_473 74
169 3300048921 Ga0496118_0018575 Ga0496118_0018575_5230_5454 74
170 3300048925 Ga0496122_0000178 Ga0496122_0000178_125063_125287 74
171 3300048926 Ga0496123_0000559 Ga0496123_0000559_62174_62398 74
172 3300048929 Ga0496126_0157351 Ga0496126_0157351_1344_1568 74
173 3300049570 Ga0501033_0753427 Ga0501033_0753427_333_557 74
174 3300049574 Ga0501038_0358851 Ga0501038_0358851_563_787 74
175 3300049579 Ga0501043_0232505 Ga0501043_0232505_484_708 74
176 3300049579 Ga0501043_0966775 Ga0501043_0966775_79_303 74
177 3300049580 Ga0501046_0840916 Ga0501046_0840916_84_308 74
178 3300049581 Ga0501047_0173009 Ga0501047_0173009_301_525 74
179 3300049581 Ga0501047_0409135 Ga0501047_0409135_243_467 74
180 3300049742 Ga0501080_0157621 Ga0501080_0157621_1816_2040 74
181 3300050507 nmdc:mga05p37_1207692_c1 nmdc:mga05p37_1207692_c1_208_432 74
182 3300053087 Ga0500643_008082 Ga0500643_008082_11_235 74
183 3300053104 Ga0500556_0053166 Ga0500556_0053166_1059_1283 74
184 3300005329 Ga0070683_100000972 Ga0070683_10000097221 75
185 3300005336 Ga0070680_100020330 Ga0070680_1000203301 75
186 3300005339 Ga0070660_100075036 Ga0070660_1000750363 75
187 3300005341 Ga0070691_10015751 Ga0070691_100157515 75
188 3300005344 Ga0070661_100173793 Ga0070661_1001737932 75
189 3300005458 Ga0070681_10000569 Ga0070681_100005699 75
190 3300005530 Ga0070679_100000840 Ga0070679_10000084022 75
191 3300005535 Ga0070684_100002765 Ga0070684_10000276514 75
192 3300005539 Ga0068853_100218935 Ga0068853_1002189353 75
193 3300005577 Ga0068857_100003533 Ga0068857_1000035339 75
194 3300005614 Ga0068856_100000415 Ga0068856_10000041519 75
195 3300005615 Ga0070702_101051645 Ga0070702_1010516451 75
196 3300005616 Ga0068852_100142140 Ga0068852_1001421402 75
197 3300005617 Ga0068859_102552091 Ga0068859_1025520912 75
198 3300006852 Ga0075433_10536602 Ga0075433_105366023 75
199 3300006931 Ga0097620_102552690 Ga0097620_1025526902 75
200 3300007788 Ga0099795_10202026 Ga0099795_102020262 75
201 3300009093 Ga0105240_10003118 Ga0105240_1000311814 75
202 3300009148 Ga0105243_11318986 Ga0105243_113189862 75
203 3300009174 Ga0105241_10039036 Ga0105241_100390364 75
204 3300009174 Ga0105241_11935381 Ga0105241_119353812 75
205 3300009545 Ga0105237_10001708 Ga0105237_100017087 75
206 3300009551 Ga0105238_10000748 Ga0105238_1000074813 75
207 3300010375 Ga0105239_10004536 Ga0105239_1000453616 75
208 3300013102 Ga0157371_10363592 Ga0157371_103635923 75
209 3300013105 Ga0157369_10005557 Ga0157369_100055574 75
210 3300013307 Ga0157372_10002079 Ga0157372_100020794 75
211 3300020078 Ga0206352_11198737 Ga0206352_111987372 75
212 3300020610 Ga0154015_1385700 Ga0154015_13857002 75
213 3300021361 Ga0213872_10011350 Ga0213872_100113504 75
214 3300022467 Ga0224712_10479728 Ga0224712_104797282 75
215 3300025909 Ga0207705_10702885 Ga0207705_107028851 75
216 3300025911 Ga0207654_10006041 Ga0207654_100060416 75
217 3300025911 Ga0207654_11110460 Ga0207654_111104602 75
218 3300025912 Ga0207707_10000594 Ga0207707_1000059418 75
219 3300025913 Ga0207695_10000597 Ga0207695_1000059727 75
220 3300025914 Ga0207671_10007132 Ga0207671_100071323 75
221 3300025917 Ga0207660_10003269 Ga0207660_100032698 75
222 3300025920 Ga0207649_10430312 Ga0207649_104303123 75
223 3300025921 Ga0207652_10000972 Ga0207652_1000097223 75
224 3300025924 Ga0207694_10000375 Ga0207694_1000037511 75
225 3300025944 Ga0207661_10004738 Ga0207661_100047384 75
226 3300025945 Ga0207679_10100265 Ga0207679_101002654 75
227 3300025949 Ga0207667_10000779 Ga0207667_1000077918 75
228 3300026041 Ga0207639_10067644 Ga0207639_100676443 75
229 3300026078 Ga0207702_10004458 Ga0207702_100044587 75
230 3300026116 Ga0207674_10000544 Ga0207674_1000054425 75
231 3300031251 Ga0265327_10195273 Ga0265327_101952732 75
232 3300031456 Ga0307513_10314095 Ga0307513_103140951 75
233 3300031727 Ga0316576_11083714 Ga0316576_110837141 75
234 3300031733 Ga0316577_10220003 Ga0316577_102200033 75
235 3300032168 Ga0316593_10112361 Ga0316593_101123611 75
236 3300033528 Ga0316588_1062368 Ga0316588_10623682 75
237 3300037853 Ga0436364_1390408 Ga0436364_1390408_376_603 75
238 3300038725 Ga0400484_25124 Ga0400484_25124_336_563 75
239 3300038726 Ga0400490_47077 Ga0400490_47077_4474_4701 75
240 3300038727 Ga0400491_28034 Ga0400491_28034_819_1046 75
241 3300038741 Ga0400488_38086 Ga0400488_38086_1089_1316 75
242 3300038742 Ga0400486_08262 Ga0400486_08262_422_649 75
243 3300039062 Ga0400483_024816 Ga0400483_024816_1233_1460 75
244 3300039062 Ga0400483_160395 Ga0400483_160395_1194_1421 75
245 3300039447 Ga0436361_0334611 Ga0436361_0334611_968_1195 75
246 3300039450 Ga0436363_0356776 Ga0436363_0356776_302_529 75
247 3300044673 Ga0453683_0006561 Ga0453683_0006561_2720_2947 75
248 3300045051 Ga0451576_1780738 Ga0451576_1780738_19_246 75
249 3300049568 Ga0501031_0077434 Ga0501031_0077434_882_1109 75
250 3300049569 Ga0501032_0829270 Ga0501032_0829270_332_559 75
251 3300049570 Ga0501033_0031146 Ga0501033_0031146_1106_1333 75
252 3300049572 Ga0501036_0014429 Ga0501036_0014429_4291_4518 75
253 3300049573 Ga0501037_0176041 Ga0501037_0176041_249_476 75
254 3300049574 Ga0501038_0060225 Ga0501038_0060225_10_237 75
255 3300049575 Ga0501039_0062290 Ga0501039_0062290_1142_1369 75
256 3300049576 Ga0501040_0005890 Ga0501040_0005890_4624_4851 75
257 3300049577 Ga0501041_0010493 Ga0501041_0010493_4929_5156 75
258 3300049579 Ga0501043_0432295 Ga0501043_0432295_166_393 75
259 3300049580 Ga0501046_0359326 Ga0501046_0359326_519_746 75
260 3300049582 Ga0501048_0000253 Ga0501048_0000253_4690_4917 75
261 3300049584 Ga0501068_0729200 Ga0501068_0729200_383_610 75
262 3300049587 Ga0501071_0200997 Ga0501071_0200997_122_349 75
263 3300049588 Ga0501072_0041638 Ga0501072_0041638_3076_3303 75
264 3300049590 Ga0501074_0106588 Ga0501074_0106588_1555_1782 75
265 3300049591 Ga0501075_0010119 Ga0501075_0010119_5462_5689 75
266 3300049592 Ga0501076_0002739 Ga0501076_0002739_3350_3577 75
267 3300049593 Ga0501077_0015580 Ga0501077_0015580_4016_4243 75
268 3300049741 Ga0501079_0006658 Ga0501079_0006658_3643_3870 75
269 3300049742 Ga0501080_0525628 Ga0501080_0525628_695_922 75
270 3300049743 Ga0501081_0003769 Ga0501081_0003769_3624_3851 75
271 3300049822 Ga0501035_0228265 Ga0501035_0228265_362_589 75
272 3300049823 Ga0501044_0684341 Ga0501044_0684341_316_543 75
273 3300049824 Ga0501045_0000612 Ga0501045_0000612_4102_4329 75
274 3300050515 nmdc:mga0a205_286127_c1 nmdc:mga0a205_286127_c1_378_605 75
275 3300053080 Ga0500635_0084977 Ga0500635_0084977_431_658 75
276 3300053162 Ga0500638_212202 Ga0500638_212202_93_320 75
277 3300053163 Ga0500639_056576 Ga0500639_056576_214_441 75
278 3300053178 Ga0500637_0044387 Ga0500637_0044387_107_334 75
279 3300054114 Ga0501084_0018078 Ga0501084_0018078_129_356 75
280 3300059630 Ga0587128_131312 Ga0587128_131312_129_356 75
281 3300060353 Ga0501082_0040433 Ga0501082_0040433_51_278 75
282 3300061734 Ga0530510_0000518 Ga0530510_0000518_23162_23389 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

13

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8824 6 72
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8717 10 66
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8146 6 72
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8077 10 66
4c26-assembly1.cif.gz_A solution nmr structure of the hica toxin from burkholderia pseudomallei 0.7824 13 66
ID Description Score Start End Superfamily
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8794 6 72 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8717 10 66 3.30.920.30
af_I1JVU1_126_189_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8585 21 45 2.40.50.140
af_I1JTQ5_49_133_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8426 20 44 3.30.2020.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8324 6 72 3.30.920.30
ID Description Score Start End GO Terms
AF-D8F7W9-F1-model_v4 Toxin-antitoxin system, toxin component, HicA family 1.002 10 75 GO:0003729
GO:0004519
AF-A0A1F6SXA8-F1-model_v4 Addiction module toxin, HicA family 0.9982 1 72 GO:0003729
GO:0004519
AF-A0A1B7VCJ6-F1-model_v4 Addiction module toxin, HicA family 0.9923 1 72 GO:0003729
GO:0004519
AF-W6FLT8-F1-model_v4 deleted 0.9868 1 72
AF-A0A4P6L9Y7-F1-model_v4 deleted 0.9848 1 73

Feature Viewer

pLDDT pTM Quality
92.51 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map