F384287

General Info

Members Datasets Scaffolds Average Seq Length
281 206 562 436

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10022341|Ga0157370_100223413
Length 496
Sequence MFLSKSILKSITPNYCFYFDENAKLSLNLCLEMRPKQQPLTLHFLLETKNVPLQNISKNNMNNIVAIVGRPNVGKSTLFNRLIQRREAIVDSVSGVTRDRNYGKSEWNGKEFSVIDTGGYVRGSEDVFEGEIRKQVELAIDEADVIIFVVDVEEGITPMDDAVAKLLRKVTKPVLLAVNKVDNAMREKDAVEFYNLGLGDYYTFASISGSGTGELLDALIEAFPEKPEPTKEELELPRFAVVGRPNAGKSSFINALIGKDRYIVTDIAGTTRDAIDTKFDRFGFEFNLVDTAGIRRKAKVKEDLEFYSVMRSVRAIEHSDVCILIIDATRGFEGQDQNIFWLAEKNRKGVVILVNKWDLVEKDTMSTKEYEAKIRKELMPFTDVPIIFTSALTKQRLLKALEETVKVFESRKQRIATSKFNDHMLKIIENYPPPALKGKYVKIKFCMQLPTPTPQFVFFANLPQYVKEPYKRFLENKIRENWDFSGVPIDIYIREK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
56 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
57 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
85 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
122 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
126 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
132 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
133 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
134 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
135 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
136 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
137 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
138 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
139 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
140 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
141 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
142 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
143 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
144 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
145 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
146 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
147 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
148 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
149 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
150 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
151 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
152 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
153 2643221629 Devosia sp. Root105 Isolate Unclassified
154 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
155 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
156 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
157 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
158 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
159 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
160 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
161 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
162 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
163 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
164 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
165 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
166 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
167 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
168 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
169 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
170 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
171 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
172 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
173 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
174 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
175 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
176 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
177 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
178 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
179 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
180 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
181 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
182 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
183 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
184 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
185 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
186 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
187 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
188 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
189 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
190 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
191 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
192 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
193 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
194 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
195 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
196 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
197 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
198 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
199 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
200 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
201 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
202 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
203 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
204 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
205 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
206 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.6
Metatranscriptomes 0.36
Isolates 27.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 1.78
Nodule 2.14
Rhizoplane 1.07
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10022341 3300013104 Bacteria 6295
2 SwRhRL2b_contig_1224556 2162886007 Bacteria 2109
3 SwRhRL2b_contig_1707609 2162886007 Bacteria 2173
4 JGI24741J21665_1005160 3300001915 Bacteria 2774
5 rootH2_10030748 3300003320 Bacteria 3278
6 rootH2_10125467 3300003320 Bacteria 4612
7 rootL2_10083410 3300003322 Bacteria 2507
8 rootL2_10245969 3300003322 Bacteria 3905
9 rootH1_10276655 3300003323 Bacteria 4024
10 Ga0006562J51391_1029501 3300003578 Bacteria 1464
11 Ga0065714_10009174 3300005288 Bacteria 3402
12 Ga0065714_10065177 3300005288 Bacteria 12217
13 Ga0065704_10017050 3300005289 Bacteria 1545
14 Ga0065704_10077527 3300005289 Bacteria 4705
15 Ga0065704_10086148 3300005289 Bacteria 3149
16 Ga0065704_10097520 3300005289 Bacteria 2390
17 Ga0070658_10174538 3300005327 Bacteria 1807
18 Ga0070683_100088631 3300005329 Bacteria 2903
19 Ga0068869_100189486 3300005334 Bacteria 1617
20 Ga0070682_100000474 3300005337 Bacteria 25301
21 Ga0070682_100009379 3300005337 Bacteria 5539
22 Ga0070660_100001239 3300005339 Bacteria 17332
23 Ga0070660_100004040 3300005339 Bacteria 10127
24 Ga0070668_100046070 3300005347 Bacteria 3347
25 Ga0070669_100229740 3300005353 Bacteria 1470
26 Ga0070667_100194833 3300005367 Bacteria 1796
27 Ga0070681_10113502 3300005458 Bacteria 2649
28 Ga0070685_10004623 3300005466 Bacteria 6967
29 Ga0070684_100055067 3300005535 Bacteria 3466
30 Ga0068853_100008194 3300005539 Bacteria 8390
31 Ga0068855_100063755 3300005563 Bacteria 4299
32 Ga0068856_100200446 3300005614 Bacteria 2010
33 Ga0068860_100043261 3300005843 Bacteria 4298
34 Ga0081539_10000081 3300005985 Bacteria 222614
35 Ga0097621_100005280 3300006237 Bacteria 9095
36 Ga0099824_1018196 3300006942 Bacteria 5839
37 Ga0079104_1001172 3300006946 Bacteria 18940
38 Ga0099826_10003274 3300006948 Bacteria 10931
39 Ga0105244_10000001 3300009036 Bacteria 1034899
40 Ga0105244_10000083 3300009036 Bacteria 105563
41 Ga0105243_10000471 3300009148 Bacteria 41457
42 Ga0105242_10095768 3300009176 Bacteria 2506
43 Ga0105242_10174235 3300009176 Bacteria 1893
44 Ga0157373_10000054 3300013100 Bacteria 103861
45 Ga0157373_10000214 3300013100 Bacteria 47231
46 Ga0157371_10001559 3300013102 Bacteria 23578
47 Ga0157371_10078711 3300013102 Bacteria 2335
48 Ga0157370_10000899 3300013104 Bacteria 37736
49 Ga0157370_10002888 3300013104 Bacteria 20484
50 Ga0157370_10124926 3300013104 Bacteria 2402
51 Ga0157369_10003002 3300013105 Bacteria 20184
52 Ga0157369_10031305 3300013105 Bacteria 5858
53 Ga0157372_10095909 3300013307 Bacteria 3380
54 Ga0157375_10000174 3300013308 Bacteria 59683
55 Ga0157380_10000044 3300014326 Bacteria 74321
56 Ga0182008_10000016 3300014497 Bacteria 241246
57 Ga0182006_1000003 3300015261 Bacteria 826681
58 Ga0163161_10000009 3300017792 Bacteria 287918
59 Ga0163161_10001507 3300017792 Bacteria 17223
60 Ga0163161_10003787 3300017792 Bacteria 10600
61 Ga0163161_10022431 3300017792 Bacteria 4447
62 Ga0163161_10040303 3300017792 Bacteria 3354
63 Ga0209675_1000077 3300025291 Bacteria 156212
64 Ga0207655_1000013 3300025728 Bacteria 637510
65 Ga0207655_1000093 3300025728 Bacteria 196813
66 Ga0207713_1030405 3300025735 Bacteria 2405
67 Ga0207657_10000777 3300025919 Bacteria 33846
68 Ga0207657_10028341 3300025919 Bacteria 5110
69 Ga0207681_10235013 3300025923 Bacteria 1424
70 Ga0207709_10000161 3300025935 Bacteria 91314
71 Ga0207691_10104955 3300025940 Bacteria 2518
72 Ga0207689_10238483 3300025942 Bacteria 1503
73 Ga0207661_10064822 3300025944 Bacteria 2963
74 Ga0207679_10051484 3300025945 Bacteria 3014
75 Ga0207658_10124834 3300025986 Bacteria 2058
76 Ga0207678_10093219 3300026067 Bacteria 2573
77 Ga0207702_10167075 3300026078 Bacteria 2014
78 Ga0209281_1000158 3300027111 Bacteria 162280
79 Ga0209489_117816 3300027361 Bacteria 3054
80 Ga0209995_1008148 3300027471 Bacteria 1689
81 Ga0209974_10024372 3300027876 Bacteria 2002
82 Ga0268264_10040367 3300028381 Bacteria 3856
83 Ga0265336_10016379 3300028666 Bacteria 2424
84 Ga0265338_10001644 3300028800 Bacteria 35766
85 Ga0265338_10003957 3300028800 Bacteria 20412
86 Ga0265327_10001390 3300031251 Bacteria 30881
87 Ga0265327_10005599 3300031251 Bacteria 10408
88 Ga0265316_10079503 3300031344 Unclassified 2516
89 Ga0307408_100000552 3300031548 Bacteria 32326
90 Ga0307408_100007400 3300031548 Bacteria 7261
91 Ga0316576_10077104 3300031727 Bacteria 2468
92 Ga0307405_10000001 3300031731 Bacteria 1731270
93 Ga0307413_10000263 3300031824 Bacteria 15912
94 Ga0307413_10037756 3300031824 Bacteria 2793
95 Ga0307406_10000024 3300031901 Bacteria 96460
96 Ga0307407_10000135 3300031903 Bacteria 22605
97 Ga0307412_10000096 3300031911 Bacteria 74069
98 Ga0307412_10000389 3300031911 Bacteria 27301
99 Ga0307412_10007996 3300031911 Bacteria 6029
100 Ga0307416_100000013 3300032002 Bacteria 283585
101 Ga0307416_100007358 3300032002 Bacteria 6993
102 Ga0307414_10000004 3300032004 Bacteria 472218
103 Ga0307414_10000005 3300032004 Bacteria 452161
104 Ga0307414_10004680 3300032004 Bacteria 7461
105 Ga0307414_10005126 3300032004 Bacteria 7185
106 Ga0307414_10053515 3300032004 Bacteria 2815
107 Ga0307414_10095694 3300032004 Unclassified 2220
108 Ga0307411_10000010 3300032005 Bacteria 238134
109 Ga0316574_0060912 3300035398 Bacteria 2370
110 Ga0316582_0100324 3300036647 Bacteria 1916
111 Ga0316584_0021159 3300036712 Bacteria 4723
112 Ga0395900_0107300 3300037418 Bacteria 2869
113 Ga0395905_0001872 3300037471 Bacteria 24225
114 Ga0395901_0000598 3300038443 Bacteria 42043
115 Ga0400489_04930 3300039093 Bacteria 1846
116 Ga0439447_000066 3300041407 Bacteria 36978
117 Ga0439466_0000872 3300041411 Bacteria 11499
118 Ga0439465_0004844 3300041413 Bacteria 4324
119 Ga0439465_0018208 3300041413 Bacteria 2195
120 Ga0451795_0050022 3300041456 Bacteria 2200
121 Ga0451795_0745368 3300041456 Bacteria 1780
122 Ga0451855_1754331 3300041511 Bacteria 1318
123 Ga0439445_0000575 3300042004 Bacteria 7509
124 Ga0451577_0000048 3300042876 Bacteria 309377
125 Ga0451577_0002606 3300042876 Bacteria 21205
126 Ga0451577_0029694 3300042876 Bacteria 4941
127 Ga0451577_0128059 3300042876 Bacteria 2276
128 Ga0453683_0000022 3300044673 Bacteria 269593
129 Ga0453683_0000190 3300044673 Bacteria 85362
130 Ga0453684_0000051 3300044712 Bacteria 551033
131 Ga0453684_0000161 3300044712 Bacteria 298175
132 Ga0453684_0000213 3300044712 Bacteria 253663
133 Ga0453684_0000846 3300044712 Bacteria 103225
134 Ga0453684_0026213 3300044712 Bacteria 8431
135 Ga0453684_0072288 3300044712 Bacteria 4356
136 Ga0451576_0000002 3300045051 Bacteria 1670975
137 Ga0451576_0000059 3300045051 Bacteria 296795
138 Ga0451576_0000175 3300045051 Bacteria 161976
139 Ga0451576_0007385 3300045051 Bacteria 13157
140 Ga0451576_0009810 3300045051 Bacteria 11064
141 Ga0451576_0015351 3300045051 Bacteria 8486
142 Ga0451576_0055352 3300045051 Bacteria 4151
143 Ga0451576_0074800 3300045051 Bacteria 3524
144 Ga0451576_0151491 3300045051 Unclassified 2419
145 Ga0451576_0201885 3300045051 Bacteria 2076
146 Ga0466967_0165356 3300045976 Bacteria 2079
147 Ga0495627_000219 3300046453 Bacteria 61845
148 Ga0495590_0001941 3300046457 Bacteria 8740
149 Ga0495596_0000647 3300046500 Bacteria 21867
150 Ga0495607_0009919 3300046501 Bacteria 6416
151 Ga0495606_0010801 3300046507 Bacteria 7524
152 Ga0495606_0033590 3300046507 Bacteria 3536
153 Ga0495610_0000006 3300046512 Bacteria 856822
154 Ga0495632_0000601 3300046519 Bacteria 33346
155 Ga0495643_0007660 3300046522 Bacteria 6927
156 Ga0495643_0061224 3300046522 Bacteria 1997
157 Ga0495643_0075000 3300046522 Bacteria 1770
158 Ga0495663_0000105 3300046525 Bacteria 34550
159 Ga0495654_0000006 3300046530 Bacteria 451432
160 Ga0495609_0000017 3300046538 Bacteria 306684
161 Ga0495621_0024365 3300046539 Unclassified 2021
162 Ga0495633_0000037 3300046558 Bacteria 184006
163 Ga0495633_0002549 3300046558 Bacteria 12789
164 Ga0495625_0001048 3300046660 Bacteria 36295
165 Ga0495684_0124301 3300047471 Bacteria 1941
166 Ga0495686_0000242 3300047472 Bacteria 98653
167 Ga0496115_0010350 3300048918 Bacteria 6965
168 Ga0496116_0000052 3300048919 Bacteria 295469
169 Ga0496116_0000212 3300048919 Bacteria 109276
170 Ga0496117_0000027 3300048920 Bacteria 412234
171 Ga0496118_0000141 3300048921 Bacteria 126552
172 Ga0496118_0039769 3300048921 Bacteria 3748
173 Ga0496119_0000006 3300048922 Bacteria 505999
174 Ga0496121_0022648 3300048924 Bacteria 6083
175 Ga0496121_0075831 3300048924 Bacteria 2685
176 Ga0496122_0000229 3300048925 Bacteria 125600
177 Ga0496122_0000397 3300048925 Bacteria 92511
178 Ga0496122_0002363 3300048925 Bacteria 27111
179 Ga0496122_0002499 3300048925 Bacteria 25974
180 Ga0496122_0004955 3300048925 Bacteria 16134
181 Ga0496123_0003892 3300048926 Bacteria 16242
182 Ga0496123_0006136 3300048926 Bacteria 11783
183 Ga0496124_0004845 3300048927 Bacteria 15478
184 Ga0496124_0072724 3300048927 Bacteria 2846
185 Ga0496125_0000062 3300048928 Bacteria 259277
186 Ga0496125_0001071 3300048928 Bacteria 42210
187 Ga0496125_0003041 3300048928 Bacteria 20967
188 Ga0496125_0014869 3300048928 Bacteria 7558
189 Ga0496126_0001395 3300048929 Bacteria 38244
190 Ga0496126_0009824 3300048929 Bacteria 10130
191 Ga0496126_0020702 3300048929 Bacteria 6442
192 Ga0501034_0025275 3300049571 Bacteria 6045
193 Ga0501047_0044793 3300049581 Bacteria 4276
194 Ga0501223_000457 3300049663 Bacteria 9864
195 Ga0501238_000007 3300049671 Bacteria 38945
196 Ga0501249_000055 3300049679 Bacteria 42892
197 Ga0501241_000003 3300049758 Bacteria 178857
198 Ga0501241_013028 3300049758 Bacteria 1510
199 Ga0501266_000009 3300049763 Bacteria 233584
200 Ga0501269_000050 3300049766 Bacteria 37244
201 Ga0501035_0009688 3300049822 Bacteria 8960
202 Ga0500646_0004672 3300053090 Bacteria 3463
203 Ga0500641_0000029 3300053096 Bacteria 103994
204 Ga0500641_0000105 3300053096 Bacteria 32240
205 Ga0500658_0000006 3300053134 Bacteria 290380
206 2511234379 2511231000 Bacteria 4488346
207 2513235985 2513020052 Bacteria 5120511
208 2520881168 2519899754 Bacteria 5336938
209 2524006844 2523533629 Bacteria 2982326
210 2585145017 2582581278 Bacteria 5296881
211 2585158416 2582581281 Bacteria 4487904
212 2585162627 2582581282 Bacteria 4495830
213 2585426962 2582581873 Bacteria 3032664
214 2587678572 2585428045 Bacteria 5203023
215 2587746265 2585428060 Bacteria 5304711
216 2587753358 2585428061 Bacteria 3939663
217 2587867110 2585428095 Bacteria 3789702
218 2587941674 2585428115 Bacteria 4420269
219 2588210367 2585428182 Bacteria 5007281
220 2588214389 2585428183 Bacteria 5166119
221 2588217645 2585428184 Bacteria 4978681
222 2588223165 2585428185 Bacteria 4969476
223 2588232856 2585428187 Bacteria 4629388
224 2588443972 2588253712 Bacteria 5403181
225 2590601626 2588254255 Bacteria 5014294
226 2590613670 2588254257 Bacteria 5436094
227 2644010962 2643221600 Bacteria 5530138
228 2644166664 2643221629 Bacteria 5850260
229 2644373817 2643221667 Bacteria 5627472
230 2644643454 2643221716 Bacteria 4986332
231 2644684004 2643221725 Bacteria 5087956
232 2729200152 2728369107 Bacteria 5082720
233 2738699863 2738541273 Bacteria 4048577
234 2738736286 2738541279 Bacteria 6149495
235 2738768729 2738541285 Bacteria 6150075
236 2739217868 2738543007 Bacteria 6149845
237 2739253612 2738543014 Bacteria 4048139
238 2739999496 2739367857 Bacteria 5433684
239 2740004313 2739367858 Bacteria 5432813
240 2740059143 2739367874 Bacteria 4872888
241 2753673198 2751185877 Bacteria 4921427
242 2765574279 2765235839 Bacteria 5314748
243 2772603771 2772190705 Bacteria 4666226
244 2775671891 2775506739 Bacteria 3855222
245 2802652103 2802428842 Bacteria 4926114
246 2816874489 2816332188 Bacteria 5133218
247 2817414967 2816332280 Bacteria 5109718
248 2842088438 2842083920 Bacteria 4857652
249 2857617577 2857613821 Bacteria 4917088
250 2857621200 2857618242 Bacteria 5635925
251 2871724174 2871720351 Bacteria 4862476
252 2881249902 2881247448 Bacteria 3717788
253 2881360021 2881359912 Bacteria 4935907
254 2889295191 2889290771 Bacteria 5530962
255 2890805262 2890804823 Bacteria 3717572
256 2903896074 2903895155 Bacteria 5258610
257 2904421882 2904419702 Bacteria 5166287
258 2904559803 2904555929 Bacteria 5218588
259 2906000117 2905999023 Bacteria 4591259
260 2919098669 2919097161 Bacteria 3860339
261 2919195683 2919191525 Bacteria 5765973
262 2919403818 2919399522 Bacteria 5164947
263 2919510265 2919509842 Bacteria 4104664
264 2919685080 2919683626 Bacteria 5534354
265 2929152134 2929150217 Bacteria 5462483
266 2945925957 2945924605 Bacteria 4296724
267 2946022762 2946019816 Bacteria 4621265
268 2958460162 2958458903 Bacteria 5301041
269 2958515996 2958512119 Bacteria 4528530
270 2965322958 2965320100 Bacteria 3975600
271 2977244883 2977243572 Bacteria 4374394
272 2977268833 2977268062 Bacteria 5243061
273 2984573209 2984572630 Bacteria 4186940
274 2984610662 2984606641 Bacteria 4186971
275 2993374700 2993372514 Bacteria 4214139
276 2993481583 2993480792 Bacteria 4022225
277 8036739484 8036736890 Bacteria 2944828
278 8054308466 8054307821 Bacteria 5212224
279 8055419214 8055419101 Bacteria 5289643
280 8055592804 8055592153 Bacteria 5961247
281 8056442580 8056440228 Bacteria 4946504
282 Ga0157370_10022341
283 SwRhRL2b_contig_1224556
284 SwRhRL2b_contig_1707609
285 JGI24741J21665_1005160
286 rootH2_10030748
287 rootH2_10125467
288 rootL2_10083410
289 rootL2_10245969
290 rootH1_10276655
291 Ga0006562J51391_1029501
292 Ga0065714_10009174
293 Ga0065714_10065177
294 Ga0065704_10017050
295 Ga0065704_10077527
296 Ga0065704_10086148
297 Ga0065704_10097520
298 Ga0070658_10174538
299 Ga0070683_100088631
300 Ga0068869_100189486
301 Ga0070682_100000474
302 Ga0070682_100009379
303 Ga0070660_100001239
304 Ga0070660_100004040
305 Ga0070668_100046070
306 Ga0070669_100229740
307 Ga0070667_100194833
308 Ga0070681_10113502
309 Ga0070685_10004623
310 Ga0070684_100055067
311 Ga0068853_100008194
312 Ga0068855_100063755
313 Ga0068856_100200446
314 Ga0068860_100043261
315 Ga0081539_10000081
316 Ga0097621_100005280
317 Ga0099824_1018196
318 Ga0079104_1001172
319 Ga0099826_10003274
320 Ga0105244_10000001
321 Ga0105244_10000083
322 Ga0105243_10000471
323 Ga0105242_10095768
324 Ga0105242_10174235
325 Ga0157373_10000054
326 Ga0157373_10000214
327 Ga0157371_10001559
328 Ga0157371_10078711
329 Ga0157370_10000899
330 Ga0157370_10002888
331 Ga0157370_10124926
332 Ga0157369_10003002
333 Ga0157369_10031305
334 Ga0157372_10095909
335 Ga0157375_10000174
336 Ga0157380_10000044
337 Ga0182008_10000016
338 Ga0182006_1000003
339 Ga0163161_10000009
340 Ga0163161_10001507
341 Ga0163161_10003787
342 Ga0163161_10022431
343 Ga0163161_10040303
344 Ga0209675_1000077
345 Ga0207655_1000013
346 Ga0207655_1000093
347 Ga0207713_1030405
348 Ga0207657_10000777
349 Ga0207657_10028341
350 Ga0207681_10235013
351 Ga0207709_10000161
352 Ga0207691_10104955
353 Ga0207689_10238483
354 Ga0207661_10064822
355 Ga0207679_10051484
356 Ga0207658_10124834
357 Ga0207678_10093219
358 Ga0207702_10167075
359 Ga0209281_1000158
360 Ga0209489_117816
361 Ga0209995_1008148
362 Ga0209974_10024372
363 Ga0268264_10040367
364 Ga0265336_10016379
365 Ga0265338_10001644
366 Ga0265338_10003957
367 Ga0265327_10001390
368 Ga0265327_10005599
369 Ga0265316_10079503
370 Ga0307408_100000552
371 Ga0307408_100007400
372 Ga0316576_10077104
373 Ga0307405_10000001
374 Ga0307413_10000263
375 Ga0307413_10037756
376 Ga0307406_10000024
377 Ga0307407_10000135
378 Ga0307412_10000096
379 Ga0307412_10000389
380 Ga0307412_10007996
381 Ga0307416_100000013
382 Ga0307416_100007358
383 Ga0307414_10000004
384 Ga0307414_10000005
385 Ga0307414_10004680
386 Ga0307414_10005126
387 Ga0307414_10053515
388 Ga0307414_10095694
389 Ga0307411_10000010
390 Ga0316574_0060912
391 Ga0316582_0100324
392 Ga0316584_0021159
393 Ga0395900_0107300
394 Ga0395905_0001872
395 Ga0395901_0000598
396 Ga0400489_04930
397 Ga0439447_000066
398 Ga0439466_0000872
399 Ga0439465_0004844
400 Ga0439465_0018208
401 Ga0451795_0050022
402 Ga0451795_0745368
403 Ga0451855_1754331
404 Ga0439445_0000575
405 Ga0451577_0000048
406 Ga0451577_0002606
407 Ga0451577_0029694
408 Ga0451577_0128059
409 Ga0453683_0000022
410 Ga0453683_0000190
411 Ga0453684_0000051
412 Ga0453684_0000161
413 Ga0453684_0000213
414 Ga0453684_0000846
415 Ga0453684_0026213
416 Ga0453684_0072288
417 Ga0451576_0000002
418 Ga0451576_0000059
419 Ga0451576_0000175
420 Ga0451576_0007385
421 Ga0451576_0009810
422 Ga0451576_0015351
423 Ga0451576_0055352
424 Ga0451576_0074800
425 Ga0451576_0151491
426 Ga0451576_0201885
427 Ga0466967_0165356
428 Ga0495627_000219
429 Ga0495590_0001941
430 Ga0495596_0000647
431 Ga0495607_0009919
432 Ga0495606_0010801
433 Ga0495606_0033590
434 Ga0495610_0000006
435 Ga0495632_0000601
436 Ga0495643_0007660
437 Ga0495643_0061224
438 Ga0495643_0075000
439 Ga0495663_0000105
440 Ga0495654_0000006
441 Ga0495609_0000017
442 Ga0495621_0024365
443 Ga0495633_0000037
444 Ga0495633_0002549
445 Ga0495625_0001048
446 Ga0495684_0124301
447 Ga0495686_0000242
448 Ga0496115_0010350
449 Ga0496116_0000052
450 Ga0496116_0000212
451 Ga0496117_0000027
452 Ga0496118_0000141
453 Ga0496118_0039769
454 Ga0496119_0000006
455 Ga0496121_0022648
456 Ga0496121_0075831
457 Ga0496122_0000229
458 Ga0496122_0000397
459 Ga0496122_0002363
460 Ga0496122_0002499
461 Ga0496122_0004955
462 Ga0496123_0003892
463 Ga0496123_0006136
464 Ga0496124_0004845
465 Ga0496124_0072724
466 Ga0496125_0000062
467 Ga0496125_0001071
468 Ga0496125_0003041
469 Ga0496125_0014869
470 Ga0496126_0001395
471 Ga0496126_0009824
472 Ga0496126_0020702
473 Ga0501034_0025275
474 Ga0501047_0044793
475 Ga0501223_000457
476 Ga0501238_000007
477 Ga0501249_000055
478 Ga0501241_000003
479 Ga0501241_013028
480 Ga0501266_000009
481 Ga0501269_000050
482 Ga0501035_0009688
483 Ga0500646_0004672
484 Ga0500641_0000029
485 Ga0500641_0000105
486 Ga0500658_0000006
487 2511234379
488 2513235985
489 2520881168
490 2524006844
491 2585145017
492 2585158416
493 2585162627
494 2585426962
495 2587678572
496 2587746265
497 2587753358
498 2587867110
499 2587941674
500 2588210367
501 2588214389
502 2588217645
503 2588223165
504 2588232856
505 2588443972
506 2590601626
507 2590613670
508 2644010962
509 2644166664
510 2644373817
511 2644643454
512 2644684004
513 2729200152
514 2738699863
515 2738736286
516 2738768729
517 2739217868
518 2739253612
519 2739999496
520 2740004313
521 2740059143
522 2753673198
523 2765574279
524 2772603771
525 2775671891
526 2802652103
527 2816874489
528 2817414967
529 2842088438
530 2857617577
531 2857621200
532 2871724174
533 2881249902
534 2881360021
535 2889295191
536 2890805262
537 2903896074
538 2904421882
539 2904559803
540 2906000117
541 2919098669
542 2919195683
543 2919403818
544 2919510265
545 2919685080
546 2929152134
547 2945925957
548 2946022762
549 2958460162
550 2958515996
551 2965322958
552 2977244883
553 2977268833
554 2984573209
555 2984610662
556 2993374700
557 2993481583
558 8036739484
559 8054308466
560 8055419214
561 8055592804
562 8056442580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14714

KH_dom-like

KH-domain-like of EngA bacterial GTPase enzymes, C-terminal

414

494

0.99

PF04548

AIG1

AIG1 family

62

174

0.91

PF01926

MMR_HSR1

50S ribosome-binding GTPase

238

356

0.9

PF01926

MMR_HSR1

50S ribosome-binding GTPase

64

180

0.88

PF02421

FeoB_N

Ferrous iron transport protein B

63

200

0.86

PF02421

FeoB_N

Ferrous iron transport protein B

237

405

0.8

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

59

225

0.75

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

234

410

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x4b-assembly2.cif.gz_B crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.9123 2 163
5x4b-assembly2.cif.gz_B crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.9062 2 163
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8793 3 164
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8682 3 164
5x4b-assembly1.cif.gz_A crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.8618 1 161
ID Description Score Start End Superfamily
af_I1LQJ5_519_603_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9301 354 436 3.30.300.20
af_P9WNL3_375_455_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9268 354 436 3.30.300.20
af_P0A6P5_373_459_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9235 349 435 3.30.300.20
af_A0A144A297_839_927_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9209 350 436 3.30.300.20
af_O77338_818_899_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9164 355 436 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7X9FBT4-F1-model_v4 Ribosome biogenesis GTPase Der 0.9747 243 436 GO:0003924
GO:0005525
GO:0043022
AF-A0A521VQL5-F1-model_v4 Ribosome biogenesis GTPase Der 0.9714 301 436 GO:0043022
AF-A0A2E8VGT4-F1-model_v4 Ribosome biogenesis GTPase Der 0.959 251 436 GO:0003924
GO:0005525
GO:0043022
AF-A0A521VQL5-F1-model_v4 Ribosome biogenesis GTPase Der 0.9575 301 436 GO:0043022
AF-A0A645FFK5-F1-model_v4 GTPase Der 0.9539 227 436 GO:0003924
GO:0005525
GO:0043022

Map