F383306

General Info

Members Datasets Scaffolds Average Seq Length
279 232 558 131

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0779497|Ga0496126_0779497_75_530
Length 151
Sequence LDDPCKKRSALDEAAGAVAKSGMTQTIATMTLVVADYDEAIDFYTKKLGFVLHADTDMGGGKRWVVVGPAGAGARLLLAQAVGAEQGAAVGNQTGGRVMGFLQTTDFAGDFAAMTAKGVRFLEQPRHEAYGSVAVFEDLYGNKWDLLEPRG

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
62 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
177 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
178 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
179 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
180 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
181 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
182 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
183 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
184 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
185 2643221568 Rhizobium sp. Root564 Isolate Unclassified
186 2643221583 Caulobacter sp. Root655 Isolate Unclassified
187 2643221584 Caulobacter sp. Root656 Isolate Unclassified
188 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
189 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
190 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
191 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
192 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
193 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
194 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
195 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
196 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
197 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
198 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
199 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
200 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
201 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
202 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
203 2791355262 Rhizobium sp. M1 Isolate Nodule
204 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
205 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
206 2841760612 Bosea sp. Tri-49 Isolate Nodule
207 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
208 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
209 2844104063 Bosea sp. Tri-39 Isolate Nodule
210 2849560528 Caulobacter zeae 410 Isolate Unclassified
211 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
212 2851246043 Bosea sp. Tri-54 Isolate Nodule
213 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
214 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
215 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
216 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
217 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
218 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
219 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
220 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
221 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
222 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
223 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
224 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
225 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
226 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
227 8005395548 Rhizobium sp. R339 Isolate Nodule
228 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
229 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
230 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
231 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
232 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.93
Metatranscriptomes 0
Isolates 20.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 10.39
Nodule 6.09
Rhizoplane 1.79
Rhizosphere 63.08
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0779497 3300048929 Bacteria 735
2 rootL2_10084126 3300003322 Bacteria 4462
3 rootH1_10159388 3300003323 Bacteria 2767
4 Ga0055526_1060142 3300003771 Bacteria 814
5 Ga0055537_1000904 3300003773 Bacteria 14000
6 Ga0055524_1003180 3300003775 Bacteria 8071
7 Ga0055536_1014757 3300003781 Bacteria 2717
8 Ga0055531_10022851 3300003794 Bacteria 2367
9 Ga0065165_1001156 3300005262 Bacteria 30809
10 Ga0070670_100015537 3300005331 Bacteria 6538
11 Ga0070666_10000641 3300005335 Bacteria 21120
12 Ga0068868_100120159 3300005338 Bacteria 2143
13 Ga0070661_100081679 3300005344 Bacteria 2386
14 Ga0070659_100838315 3300005366 Bacteria 801
15 Ga0070667_101019575 3300005367 Bacteria 772
16 Ga0070709_10000466 3300005434 Bacteria 24079
17 Ga0070709_10340814 3300005434 Bacteria 1105
18 Ga0070714_100006256 3300005435 Bacteria 9168
19 Ga0070714_101058622 3300005435 Bacteria 790
20 Ga0070713_100001703 3300005436 Bacteria 14145
21 Ga0070710_10000029 3300005437 Bacteria 72050
22 Ga0070711_100004925 3300005439 Bacteria 7927
23 Ga0070711_100019847 3300005439 Bacteria 4321
24 Ga0070663_100101381 3300005455 Bacteria 2148
25 Ga0070662_100016069 3300005457 Bacteria 5021
26 Ga0068867_100045414 3300005459 Bacteria 3222
27 Ga0070698_100098209 3300005471 Bacteria 2903
28 Ga0068853_101695946 3300005539 Bacteria 612
29 Ga0070665_100001437 3300005548 Bacteria 27924
30 Ga0068857_100087779 3300005577 Bacteria 2782
31 Ga0068854_100029357 3300005578 Bacteria 3806
32 Ga0068856_101000290 3300005614 Bacteria 854
33 Ga0068852_100019726 3300005616 Bacteria 5345
34 Ga0068852_100098736 3300005616 Bacteria 2630
35 Ga0068852_100324521 3300005616 Bacteria 1496
36 Ga0068851_10012284 3300005834 Bacteria 4033
37 Ga0068863_100285109 3300005841 Bacteria 1601
38 Ga0068858_100000269 3300005842 Bacteria 55685
39 Ga0081455_10470091 3300005937 Unclassified 853
40 Ga0081538_10000107 3300005981 Bacteria 82480
41 Ga0070717_10017989 3300006028 Bacteria 5513
42 Ga0070717_10589751 3300006028 Bacteria 1008
43 Ga0075365_10437155 3300006038 Bacteria 924
44 Ga0075364_10160712 3300006051 Bacteria 1516
45 Ga0070715_10394531 3300006163 Bacteria 767
46 Ga0070716_100000632 3300006173 Bacteria 14934
47 Ga0070716_100359788 3300006173 Bacteria 1033
48 Ga0070712_100000808 3300006175 Bacteria 18607
49 Ga0075370_10234511 3300006353 Bacteria 1086
50 Ga0075430_100041375 3300006846 Bacteria 3899
51 Ga0075434_100346667 3300006871 Bacteria 1506
52 Ga0068865_100105363 3300006881 Bacteria 2071
53 Ga0099795_10116271 3300007788 Unclassified 1065
54 Ga0105240_10082673 3300009093 Bacteria 3943
55 Ga0105240_10904267 3300009093 Bacteria 949
56 Ga0114129_10608455 3300009147 Bacteria 1415
57 Ga0114129_10995326 3300009147 Bacteria 1056
58 Ga0105241_10050717 3300009174 Bacteria 3163
59 Ga0105241_10062455 3300009174 Bacteria 2872
60 Ga0105237_10102907 3300009545 Bacteria 2847
61 Ga0105237_10122336 3300009545 Bacteria 2596
62 Ga0105237_10366206 3300009545 Bacteria 1446
63 Ga0105237_10930638 3300009545 Bacteria 876
64 Ga0105238_10024790 3300009551 Bacteria 6113
65 Ga0105238_10054644 3300009551 Bacteria 4010
66 Ga0105238_10563226 3300009551 Bacteria 1145
67 Ga0105249_10058459 3300009553 Bacteria 3533
68 Ga0105239_10091819 3300010375 Bacteria 3351
69 Ga0105239_11643194 3300010375 Bacteria 743
70 Ga0157371_10021938 3300013102 Bacteria 4687
71 Ga0157369_10522653 3300013105 Bacteria 1228
72 Ga0157369_11290767 3300013105 Bacteria 744
73 Ga0157374_10078068 3300013296 Bacteria 3135
74 Ga0163162_10540551 3300013306 Bacteria 1294
75 Ga0157372_10701736 3300013307 Bacteria 1177
76 Ga0157379_10997549 3300014968 Bacteria 798
77 Ga0157376_10098796 3300014969 Bacteria 2545
78 Ga0214542_1015933 3300021321 Bacteria 7555
79 Ga0214543_1000027 3300021327 Bacteria 215065
80 Ga0209565_1000280 3300025263 Bacteria 51034
81 Ga0209676_1012157 3300025292 Bacteria 3411
82 Ga0209025_1002899 3300025294 Bacteria 17122
83 Ga0209025_1045243 3300025294 Bacteria 1827
84 Ga0209564_1004179 3300025295 Bacteria 9013
85 Ga0209564_1033127 3300025295 Bacteria 1542
86 Ga0209758_1003007 3300025297 Bacteria 16137
87 Ga0209758_1004515 3300025297 Bacteria 11533
88 Ga0209758_1026154 3300025297 Bacteria 2536
89 Ga0207692_10001090 3300025898 Bacteria 9947
90 Ga0207680_10007717 3300025903 Bacteria 5260
91 Ga0207680_10077268 3300025903 Unclassified 2082
92 Ga0207647_10001064 3300025904 Bacteria 21129
93 Ga0207699_10000144 3300025906 Bacteria 46869
94 Ga0207699_10484169 3300025906 Bacteria 891
95 Ga0207695_10064601 3300025913 Bacteria 3767
96 Ga0207695_10079257 3300025913 Bacteria 3330
97 Ga0207695_10269973 3300025913 Bacteria 1597
98 Ga0207671_10034579 3300025914 Bacteria 3754
99 Ga0207671_10082617 3300025914 Bacteria 2411
100 Ga0207671_10088180 3300025914 Bacteria 2334
101 Ga0207693_10006303 3300025915 Bacteria 9839
102 Ga0207663_10006529 3300025916 Bacteria 5978
103 Ga0207663_10015745 3300025916 Bacteria 4180
104 Ga0207649_10078498 3300025920 Bacteria 2130
105 Ga0207694_10004753 3300025924 Bacteria 10561
106 Ga0207694_10009986 3300025924 Bacteria 7157
107 Ga0207694_11480251 3300025924 Unclassified 573
108 Ga0207650_10023299 3300025925 Bacteria 4389
109 Ga0207700_10000287 3300025928 Bacteria 29887
110 Ga0207664_10003661 3300025929 Bacteria 10296
111 Ga0207706_10002660 3300025933 Bacteria 17388
112 Ga0207704_10046846 3300025938 Bacteria 2580
113 Ga0207665_10000019 3300025939 Bacteria 121429
114 Ga0207665_10638856 3300025939 Bacteria 833
115 Ga0207712_10000117 3300025961 Bacteria 86479
116 Ga0207640_10022568 3300025981 Bacteria 3769
117 Ga0207658_10199190 3300025986 Bacteria 1670
118 Ga0207677_10166453 3300026023 Bacteria 1719
119 Ga0207703_10000851 3300026035 Bacteria 29908
120 Ga0207639_10021399 3300026041 Bacteria 4644
121 Ga0207678_10009961 3300026067 Bacteria 8339
122 Ga0207702_10384510 3300026078 Bacteria 1350
123 Ga0207648_10054648 3300026089 Bacteria 3487
124 Ga0207674_10036765 3300026116 Bacteria 5098
125 Ga0207698_10435225 3300026142 Bacteria 1262
126 Ga0207698_10842727 3300026142 Bacteria 921
127 Ga0268266_10000007 3300028379 Bacteria 1372921
128 Ga0265337_1052458 3300028556 Bacteria 1145
129 Ga0265326_10069737 3300028558 Bacteria 994
130 Ga0265318_10002888 3300028577 Bacteria 8946
131 Ga0265322_10082265 3300028654 Bacteria 914
132 Ga0265336_10001947 3300028666 Bacteria 8880
133 Ga0307517_10175237 3300028786 Bacteria 1399
134 Ga0307515_10130161 3300028794 Bacteria 2778
135 Ga0265338_10037817 3300028800 Bacteria 4584
136 Ga0265338_10050301 3300028800 Bacteria 3768
137 Ga0265324_10001190 3300029957 Bacteria 15510
138 Ga0265320_10002883 3300031240 Bacteria 11793
139 Ga0265325_10015170 3300031241 Bacteria 4339
140 Ga0265339_10391646 3300031249 Bacteria 650
141 Ga0265327_10002846 3300031251 Bacteria 17453
142 Ga0265316_10052510 3300031344 Bacteria 3197
143 Ga0307513_10001052 3300031456 Bacteria 40103
144 Ga0307513_10150648 3300031456 Bacteria 2235
145 Ga0307508_10008594 3300031616 Bacteria 9428
146 Ga0265314_10013789 3300031711 Bacteria 6510
147 Ga0265342_10116470 3300031712 Bacteria 1508
148 Ga0307406_10035913 3300031901 Bacteria 3051
149 Ga0373927_0749617 3300035695 Bacteria 645
150 Ga0395899_0054426 3300037312 Bacteria 2961
151 Ga0400483_235610 3300039062 Bacteria 4204
152 Ga0436360_0868404 3300039438 Unclassified 992
153 Ga0436361_0766371 3300039447 Bacteria 7388
154 Ga0436361_0833168 3300039447 Bacteria 1085
155 Ga0436363_1590300 3300039450 Bacteria 743
156 Ga0451789_1074769 3300041443 Bacteria 759
157 Ga0451807_1629790 3300041486 Bacteria 687
158 Ga0451835_0901258 3300041492 Bacteria 1014
159 Ga0451841_0659000 3300041498 Bacteria 894
160 Ga0451841_0998363 3300041498 Bacteria 1137
161 Ga0439446_0115695 3300042156 Bacteria 859
162 Ga0451577_0249173 3300042876 Bacteria 1608
163 Ga0451577_1169248 3300042876 Bacteria 687
164 Ga0466969_0041703 3300044656 Bacteria 2295
165 Ga0453684_0001089 3300044712 Bacteria 85906
166 Ga0453684_0188784 3300044712 Bacteria 2412
167 Ga0466971_0012314 3300044719 Bacteria 3747
168 Ga0466960_0195490 3300044901 Bacteria 1103
169 Ga0451576_0000201 3300045051 Bacteria 150175
170 Ga0466967_1352942 3300045976 Bacteria 709
171 Ga0495627_002250 3300046453 Bacteria 9557
172 Ga0495638_0015323 3300046460 Bacteria 5150
173 Ga0495638_0029923 3300046460 Bacteria 3510
174 Ga0495580_0635845 3300046472 Bacteria 703
175 Ga0495664_0091722 3300046477 Bacteria 1827
176 Ga0495620_0139871 3300046515 Bacteria 947
177 Ga0495628_0075847 3300046516 Bacteria 2618
178 Ga0495637_0024100 3300046520 Bacteria 2754
179 Ga0495586_0348369 3300046535 Bacteria 851
180 Ga0495609_0099153 3300046538 Bacteria 1263
181 Ga0495645_0074775 3300046543 Bacteria 2439
182 Ga0495668_0021526 3300046616 Bacteria 3696
183 Ga0495624_0572007 3300046690 Bacteria 674
184 Ga0495674_0159063 3300047319 Bacteria 1890
185 Ga0495679_009846 3300047446 Bacteria 3794
186 Ga0495673_0000272 3300047469 Bacteria 71031
187 Ga0496116_0000240 3300048919 Bacteria 100232
188 Ga0496116_0053439 3300048919 Bacteria 2667
189 Ga0496119_0021523 3300048922 Bacteria 4657
190 Ga0496120_0022508 3300048923 Bacteria 3963
191 Ga0496121_0000220 3300048924 Bacteria 123930
192 Ga0496122_0249630 3300048925 Bacteria 993
193 Ga0496123_0243630 3300048926 Bacteria 891
194 Ga0496124_0053970 3300048927 Bacteria 3403
195 Ga0496125_0000001 3300048928 Bacteria 1766138
196 Ga0496126_0000322 3300048929 Bacteria 102330
197 Ga0496126_0047410 3300048929 Bacteria 3933
198 Ga0496126_0442455 3300048929 Bacteria 1047
199 Ga0501033_0004072 3300049570 Bacteria 11798
200 Ga0501036_1534359 3300049572 Bacteria 539
201 Ga0501046_0738189 3300049580 Bacteria 692
202 Ga0501047_0076014 3300049581 Bacteria 3232
203 Ga0501069_0482365 3300049585 Bacteria 739
204 Ga0501073_0134739 3300049589 Bacteria 1712
205 Ga0501073_0249688 3300049589 Bacteria 1225
206 Ga0501080_0027515 3300049742 Bacteria 5288
207 Ga0501080_0370842 3300049742 Bacteria 1291
208 Ga0501035_0230022 3300049822 Bacteria 1580
209 Ga0501044_0051502 3300049823 Bacteria 4244
210 Ga0501044_1501526 3300049823 Unclassified 539
211 nmdc:mga03n38_970257_c1 3300050490 Bacteria 502
212 nmdc:mga00v17_25705_c1 3300050491 Bacteria 3425
213 nmdc:mga0yw44_852415_c1 3300050492 Bacteria 618
214 nmdc:mga0k408_361469_c1 3300050493 Bacteria 865
215 nmdc:mga07m45_230172_c1 3300050496 Bacteria 1078
216 nmdc:mga0qj67_80880_c1 3300050509 Bacteria 2604
217 nmdc:mga0n895_586148_c1 3300050512 Bacteria 1118
218 Ga0500641_0254917 3300053096 Bacteria 734
219 Ga0500618_000195 3300053125 Bacteria 49434
220 Ga0500618_003902 3300053125 Bacteria 4963
221 Ga0500658_0119991 3300053134 Bacteria 1165
222 Ga0500577_0006676 3300053142 Bacteria 3198
223 Ga0500611_002903 3300053727 Bacteria 2123
224 2511125063 2510917020 Bacteria 5657507
225 2511391688 2511231027 Bacteria 5013807
226 2558866401 2558860100 Bacteria 8458965
227 2572254397 2571042365 Bacteria 3289345
228 2585273695 2582581307 Bacteria 6597605
229 2616556309 2615840698 Bacteria 7319877
230 2643750996 2643221545 Bacteria 5083237
231 2643782721 2643221552 Bacteria 5708754
232 2643857385 2643221568 Bacteria 5187270
233 2643925626 2643221583 Bacteria 5218014
234 2643928031 2643221584 Bacteria 5511711
235 2644087242 2643221614 Bacteria 4260023
236 2644342195 2643221661 Bacteria 4267604
237 2644368481 2643221666 Bacteria 4265935
238 2644510071 2643221691 Bacteria 5093099
239 2671113910 2667528174 Bacteria 6435400
240 2671585253 2671180115 Bacteria 5353919
241 2720618221 2718218233 Bacteria 6662049
242 2723024999 2721755556 Bacteria 6745503
243 2723558577 2721755684 Bacteria 6859907
244 2730105935 2728369352 Bacteria 6745171
245 2765467770 2765235802 Bacteria 5618596
246 2776269078 2775506902 Bacteria 6208009
247 2776283783 2775506904 Bacteria 5954060
248 2778177073 2775507266 Bacteria 7392367
249 2792625352 2791355092 Bacteria 6248105
250 2793336270 2791355262 Bacteria 6774204
251 2819608651 2818991448 Bacteria 6772224
252 2839993744 2839993093 Bacteria 5512535
253 2841763830 2841760612 Bacteria 6454112
254 2842875274 2842871566 Bacteria 4827117
255 2843747153 2843744320 Bacteria 5659202
256 2844109267 2844104063 Bacteria 6440972
257 2849560689 2849560528 Bacteria 5393480
258 2849574213 2849573788 Bacteria 5421256
259 2851251374 2851246043 Bacteria 6439203
260 2898331010 2898329390 Bacteria 5168154
261 2904579549 2904578770 Bacteria 5302906
262 2912763630 2912757875 Bacteria 7940295
263 2919120786 2919119836 Bacteria 5208557
264 2919166638 2919166419 Bacteria 4952238
265 2919408546 2919408235 Bacteria 6149349
266 2928522341 2928521798 Bacteria 4960112
267 2929142154 2929138655 Bacteria 5810547
268 2954014237 2954011201 Bacteria 4762601
269 2978973027 2978969890 Bacteria 5400756
270 2984591273 2984587000 Bacteria 5263363
271 2995953195 2995948881 Bacteria 6358104
272 3005456568 3005452660 Bacteria 5889319
273 8005291452 8005289223 Bacteria 6634003
274 8005399803 8005395548 Bacteria 6806915
275 8005628071 8005626139 Bacteria 6534237
276 8005649393 8005645114 Bacteria 6950293
277 8005685367 8005682033 Bacteria 6726518
278 8008581413 8008574985 Bacteria 7815457
279 8025532804 8025530807 Bacteria 8495698
280 Ga0496126_0779497
281 rootL2_10084126
282 rootH1_10159388
283 Ga0055526_1060142
284 Ga0055537_1000904
285 Ga0055524_1003180
286 Ga0055536_1014757
287 Ga0055531_10022851
288 Ga0065165_1001156
289 Ga0070670_100015537
290 Ga0070666_10000641
291 Ga0068868_100120159
292 Ga0070661_100081679
293 Ga0070659_100838315
294 Ga0070667_101019575
295 Ga0070709_10000466
296 Ga0070709_10340814
297 Ga0070714_100006256
298 Ga0070714_101058622
299 Ga0070713_100001703
300 Ga0070710_10000029
301 Ga0070711_100004925
302 Ga0070711_100019847
303 Ga0070663_100101381
304 Ga0070662_100016069
305 Ga0068867_100045414
306 Ga0070698_100098209
307 Ga0068853_101695946
308 Ga0070665_100001437
309 Ga0068857_100087779
310 Ga0068854_100029357
311 Ga0068856_101000290
312 Ga0068852_100019726
313 Ga0068852_100098736
314 Ga0068852_100324521
315 Ga0068851_10012284
316 Ga0068863_100285109
317 Ga0068858_100000269
318 Ga0081455_10470091
319 Ga0081538_10000107
320 Ga0070717_10017989
321 Ga0070717_10589751
322 Ga0075365_10437155
323 Ga0075364_10160712
324 Ga0070715_10394531
325 Ga0070716_100000632
326 Ga0070716_100359788
327 Ga0070712_100000808
328 Ga0075370_10234511
329 Ga0075430_100041375
330 Ga0075434_100346667
331 Ga0068865_100105363
332 Ga0099795_10116271
333 Ga0105240_10082673
334 Ga0105240_10904267
335 Ga0114129_10608455
336 Ga0114129_10995326
337 Ga0105241_10050717
338 Ga0105241_10062455
339 Ga0105237_10102907
340 Ga0105237_10122336
341 Ga0105237_10366206
342 Ga0105237_10930638
343 Ga0105238_10024790
344 Ga0105238_10054644
345 Ga0105238_10563226
346 Ga0105249_10058459
347 Ga0105239_10091819
348 Ga0105239_11643194
349 Ga0157371_10021938
350 Ga0157369_10522653
351 Ga0157369_11290767
352 Ga0157374_10078068
353 Ga0163162_10540551
354 Ga0157372_10701736
355 Ga0157379_10997549
356 Ga0157376_10098796
357 Ga0214542_1015933
358 Ga0214543_1000027
359 Ga0209565_1000280
360 Ga0209676_1012157
361 Ga0209025_1002899
362 Ga0209025_1045243
363 Ga0209564_1004179
364 Ga0209564_1033127
365 Ga0209758_1003007
366 Ga0209758_1004515
367 Ga0209758_1026154
368 Ga0207692_10001090
369 Ga0207680_10007717
370 Ga0207680_10077268
371 Ga0207647_10001064
372 Ga0207699_10000144
373 Ga0207699_10484169
374 Ga0207695_10064601
375 Ga0207695_10079257
376 Ga0207695_10269973
377 Ga0207671_10034579
378 Ga0207671_10082617
379 Ga0207671_10088180
380 Ga0207693_10006303
381 Ga0207663_10006529
382 Ga0207663_10015745
383 Ga0207649_10078498
384 Ga0207694_10004753
385 Ga0207694_10009986
386 Ga0207694_11480251
387 Ga0207650_10023299
388 Ga0207700_10000287
389 Ga0207664_10003661
390 Ga0207706_10002660
391 Ga0207704_10046846
392 Ga0207665_10000019
393 Ga0207665_10638856
394 Ga0207712_10000117
395 Ga0207640_10022568
396 Ga0207658_10199190
397 Ga0207677_10166453
398 Ga0207703_10000851
399 Ga0207639_10021399
400 Ga0207678_10009961
401 Ga0207702_10384510
402 Ga0207648_10054648
403 Ga0207674_10036765
404 Ga0207698_10435225
405 Ga0207698_10842727
406 Ga0268266_10000007
407 Ga0265337_1052458
408 Ga0265326_10069737
409 Ga0265318_10002888
410 Ga0265322_10082265
411 Ga0265336_10001947
412 Ga0307517_10175237
413 Ga0307515_10130161
414 Ga0265338_10037817
415 Ga0265338_10050301
416 Ga0265324_10001190
417 Ga0265320_10002883
418 Ga0265325_10015170
419 Ga0265339_10391646
420 Ga0265327_10002846
421 Ga0265316_10052510
422 Ga0307513_10001052
423 Ga0307513_10150648
424 Ga0307508_10008594
425 Ga0265314_10013789
426 Ga0265342_10116470
427 Ga0307406_10035913
428 Ga0373927_0749617
429 Ga0395899_0054426
430 Ga0400483_235610
431 Ga0436360_0868404
432 Ga0436361_0766371
433 Ga0436361_0833168
434 Ga0436363_1590300
435 Ga0451789_1074769
436 Ga0451807_1629790
437 Ga0451835_0901258
438 Ga0451841_0659000
439 Ga0451841_0998363
440 Ga0439446_0115695
441 Ga0451577_0249173
442 Ga0451577_1169248
443 Ga0466969_0041703
444 Ga0453684_0001089
445 Ga0453684_0188784
446 Ga0466971_0012314
447 Ga0466960_0195490
448 Ga0451576_0000201
449 Ga0466967_1352942
450 Ga0495627_002250
451 Ga0495638_0015323
452 Ga0495638_0029923
453 Ga0495580_0635845
454 Ga0495664_0091722
455 Ga0495620_0139871
456 Ga0495628_0075847
457 Ga0495637_0024100
458 Ga0495586_0348369
459 Ga0495609_0099153
460 Ga0495645_0074775
461 Ga0495668_0021526
462 Ga0495624_0572007
463 Ga0495674_0159063
464 Ga0495679_009846
465 Ga0495673_0000272
466 Ga0496116_0000240
467 Ga0496116_0053439
468 Ga0496119_0021523
469 Ga0496120_0022508
470 Ga0496121_0000220
471 Ga0496122_0249630
472 Ga0496123_0243630
473 Ga0496124_0053970
474 Ga0496125_0000001
475 Ga0496126_0000322
476 Ga0496126_0047410
477 Ga0496126_0442455
478 Ga0501033_0004072
479 Ga0501036_1534359
480 Ga0501046_0738189
481 Ga0501047_0076014
482 Ga0501069_0482365
483 Ga0501073_0134739
484 Ga0501073_0249688
485 Ga0501080_0027515
486 Ga0501080_0370842
487 Ga0501035_0230022
488 Ga0501044_0051502
489 Ga0501044_1501526
490 nmdc:mga03n38_970257_c1
491 nmdc:mga00v17_25705_c1
492 nmdc:mga0yw44_852415_c1
493 nmdc:mga0k408_361469_c1
494 nmdc:mga07m45_230172_c1
495 nmdc:mga0qj67_80880_c1
496 nmdc:mga0n895_586148_c1
497 Ga0500641_0254917
498 Ga0500618_000195
499 Ga0500618_003902
500 Ga0500658_0119991
501 Ga0500577_0006676
502 Ga0500611_002903
503 2511125063
504 2511391688
505 2558866401
506 2572254397
507 2585273695
508 2616556309
509 2643750996
510 2643782721
511 2643857385
512 2643925626
513 2643928031
514 2644087242
515 2644342195
516 2644368481
517 2644510071
518 2671113910
519 2671585253
520 2720618221
521 2723024999
522 2723558577
523 2730105935
524 2765467770
525 2776269078
526 2776283783
527 2778177073
528 2792625352
529 2793336270
530 2819608651
531 2839993744
532 2841763830
533 2842875274
534 2843747153
535 2844109267
536 2849560689
537 2849574213
538 2851251374
539 2898331010
540 2904579549
541 2912763630
542 2919120786
543 2919166638
544 2919408546
545 2928522341
546 2929142154
547 2954014237
548 2978973027
549 2984591273
550 2995953195
551 3005456568
552 8005291452
553 8005399803
554 8005628071
555 8005649393
556 8005685367
557 8008581413
558 8025532804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

146

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8723 1 124
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8709 1 128
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8657 1 127
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8646 1 128
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8522 2 125
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8916 77 127 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8389 1 58 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.837 77 128 3.30.720.110
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8339 3 125 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8299 1 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A840VT45-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9937 1 128 GO:0016829
GO:0051213
AF-A0A542FAU1-F1-model_v4 deleted 0.9937 1 128
AF-A0A4Y4KGV7-F1-model_v4 VOC domain-containing protein 0.9923 1 127
AF-A0A7W1AHX0-F1-model_v4 VOC family protein 0.9923 64 127
AF-A0A2N1XZC7-F1-model_v4 Extradiol dioxygenase 0.9912 1 128 GO:0051213

Map