F382515

General Info

Members Datasets Scaffolds Average Seq Length
278 185 278 292

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0032145|Ga0395900_0032145_2648_3703
Length 351
Sequence MMMKSKLPLLMSHWSNQSKNPYGDADVTVLGFVRIPKFPRRICKTIKGIPMPTMPPEAMSRPKPKMPHAQTFGDLPKPVVPKTENRKLLKGQKAIVTGASSGIGRSIALALGHAGASVCVNYVAGEDKAKAMVAELRRHGHTAFAFKADVSSEDDVAKMFEAVRDEFGTVDILVNNAGLQSDAPFDQMTLAQWNKVIGVNLTGQFLCAREAVREFKRRGVRPEISCCAGKIICVSSVHEVIPWAGHVNYAASKGGVMLMMKSIAQEVAPYRIRVNSIAPGAIRTPINMQAWDTPEHYNELLKLIPYKRIGEPEEIGRVAVWLASDESDYIQGTTLFVDGGMTLYPGFETGG

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.04
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10177237 3300003322 Bacteria 2842
2 Ga0065715_10001905 3300005293 Bacteria 5411
3 Ga0065707_10081836 3300005295 Bacteria 34923
4 Ga0070676_10011285 3300005328 Bacteria 4856
5 Ga0070676_10017162 3300005328 Bacteria 4005
6 Ga0070683_100613579 3300005329 Bacteria 1041
7 Ga0070690_100018750 3300005330 Bacteria 4185
8 Ga0068869_100008754 3300005334 Bacteria 6539
9 Ga0070682_100244498 3300005337 Bacteria 1290
10 Ga0070689_100005393 3300005340 Bacteria 8721
11 Ga0070661_100305659 3300005344 Bacteria 1239
12 Ga0070669_100088019 3300005353 Bacteria 2324
13 Ga0070673_100050257 3300005364 Bacteria 3259
14 Ga0070673_100320529 3300005364 Bacteria 1369
15 Ga0070688_100106247 3300005365 Bacteria 1859
16 Ga0070667_100079377 3300005367 Bacteria 2805
17 Ga0070713_100277474 3300005436 Unclassified 1537
18 Ga0070705_100272141 3300005440 Bacteria 1200
19 Ga0068867_100070358 3300005459 Bacteria 2615
20 Ga0070685_10146215 3300005466 Bacteria 1493
21 Ga0070707_100222160 3300005468 Unclassified 1839
22 Ga0070707_100414624 3300005468 Bacteria 1307
23 Ga0070698_100004870 3300005471 Bacteria 14735
24 Ga0070698_100028806 3300005471 Bacteria 5764
25 Ga0070679_100133014 3300005530 Bacteria 2468
26 Ga0070684_100206413 3300005535 Bacteria 1790
27 Ga0070697_100221775 3300005536 Bacteria 1611
28 Ga0068853_100000450 3300005539 Bacteria 27973
29 Ga0068853_100164372 3300005539 Bacteria 2005
30 Ga0070672_100323103 3300005543 Bacteria 1312
31 Ga0070686_100022842 3300005544 Bacteria 3731
32 Ga0070695_100004818 3300005545 Bacteria 7940
33 Ga0070695_100204579 3300005545 Bacteria 1413
34 Ga0070696_100008611 3300005546 Bacteria 6824
35 Ga0070665_100010263 3300005548 Bacteria 9478
36 Ga0070665_100015718 3300005548 Bacteria 7605
37 Ga0070665_100113134 3300005548 Bacteria 2717
38 Ga0068855_100059362 3300005563 Bacteria 4475
39 Ga0068855_100099044 3300005563 Bacteria 3358
40 Ga0070664_100018645 3300005564 Bacteria 5705
41 Ga0070664_100035827 3300005564 Bacteria 4167
42 Ga0068854_100011201 3300005578 Bacteria 5827
43 Ga0068856_100555063 3300005614 Bacteria 1170
44 Ga0070702_100007785 3300005615 Bacteria 5150
45 Ga0070702_100050702 3300005615 Bacteria 2372
46 Ga0068859_100026326 3300005617 Bacteria 5831
47 Ga0068859_100277086 3300005617 Bacteria 1770
48 Ga0068859_100524295 3300005617 Bacteria 1280
49 Ga0068864_100007748 3300005618 Bacteria 8849
50 Ga0068864_100200987 3300005618 Bacteria 1831
51 Ga0068866_10065761 3300005718 Bacteria 1897
52 Ga0068861_100033984 3300005719 Bacteria 3767
53 Ga0068863_100006837 3300005841 Bacteria 11183
54 Ga0068863_100081362 3300005841 Bacteria 3068
55 Ga0068863_100092100 3300005841 Bacteria 2875
56 Ga0068863_100162750 3300005841 Bacteria 2138
57 Ga0068863_100213493 3300005841 Bacteria 1858
58 Ga0068858_100006188 3300005842 Bacteria 11675
59 Ga0068860_100114151 3300005843 Bacteria 2583
60 Ga0068860_100121130 3300005843 Bacteria 2505
61 Ga0068860_100143269 3300005843 Bacteria 2298
62 Ga0068860_100288369 3300005843 Bacteria 1606
63 Ga0068862_100005478 3300005844 Bacteria 10610
64 Ga0068862_100207547 3300005844 Bacteria 1769
65 Ga0081455_10000935 3300005937 Bacteria 37321
66 Ga0081455_10054021 3300005937 Bacteria 3427
67 Ga0081538_10018636 3300005981 Bacteria 5200
68 Ga0070717_10008086 3300006028 Bacteria 7844
69 Ga0070717_10180610 3300006028 Bacteria 1839
70 Ga0097621_100109578 3300006237 Bacteria 2332
71 Ga0068871_100097197 3300006358 Bacteria 2461
72 Ga0075428_100034767 3300006844 Bacteria 5557
73 Ga0075430_100073413 3300006846 Bacteria 2869
74 Ga0075433_10022456 3300006852 Bacteria 5295
75 Ga0075429_100012887 3300006880 Bacteria 7255
76 Ga0075429_100149102 3300006880 Bacteria 2048
77 Ga0068865_100004482 3300006881 Bacteria 8427
78 Ga0068865_100066246 3300006881 Bacteria 2547
79 Ga0097620_100026324 3300006931 Bacteria 5831
80 Ga0097620_100277080 3300006931 Bacteria 1770
81 Ga0097620_100524307 3300006931 Bacteria 1280
82 Ga0099795_10000008 3300007788 Bacteria 103465
83 Ga0105240_10076310 3300009093 Bacteria 4132
84 Ga0105240_10102913 3300009093 Bacteria 3470
85 Ga0105240_10136691 3300009093 Bacteria 2935
86 Ga0111539_10008401 3300009094 Bacteria 13140
87 Ga0111539_10263040 3300009094 Bacteria 2008
88 Ga0105245_10013515 3300009098 Bacteria 7108
89 Ga0105245_10047673 3300009098 Bacteria 3830
90 Ga0114129_10041653 3300009147 Bacteria 6469
91 Ga0105243_10010128 3300009148 Bacteria 7170
92 Ga0105241_10058992 3300009174 Bacteria 2949
93 Ga0105242_10000396 3300009176 Bacteria 34574
94 Ga0105242_10174756 3300009176 Bacteria 1890
95 Ga0105248_10000770 3300009177 Bacteria 35976
96 Ga0105248_10011148 3300009177 Bacteria 9920
97 Ga0105248_10294300 3300009177 Bacteria 1828
98 Ga0105248_10637525 3300009177 Bacteria 1202
99 Ga0105248_10768745 3300009177 Bacteria 1087
100 Ga0105237_10162599 3300009545 Bacteria 2231
101 Ga0105238_10033690 3300009551 Bacteria 5211
102 Ga0105238_10577439 3300009551 Bacteria 1130
103 Ga0105249_10016268 3300009553 Bacteria 6597
104 Ga0105249_10055712 3300009553 Bacteria 3618
105 Ga0105249_10138362 3300009553 Bacteria 2332
106 Ga0099796_10000294 3300010159 Bacteria 7871
107 Ga0105239_10562786 3300010375 Bacteria 1299
108 Ga0157374_10057267 3300013296 Bacteria 3640
109 Ga0157374_10315619 3300013296 Bacteria 1548
110 Ga0157374_10387311 3300013296 Bacteria 1393
111 Ga0157378_10001572 3300013297 Bacteria 20629
112 Ga0163162_10023350 3300013306 Bacteria 6103
113 Ga0163162_10035663 3300013306 Bacteria 4956
114 Ga0163162_10038180 3300013306 Bacteria 4793
115 Ga0157375_10028256 3300013308 Bacteria 5254
116 Ga0157375_10162382 3300013308 Bacteria 2377
117 Ga0163163_10035811 3300014325 Bacteria 4818
118 Ga0163163_10588417 3300014325 Bacteria 1176
119 Ga0157379_10029449 3300014968 Bacteria 4883
120 Ga0157379_10198684 3300014968 Bacteria 1813
121 Ga0157376_10003078 3300014969 Bacteria 11445
122 Ga0163161_10023961 3300017792 Bacteria 4308
123 Ga0213871_10001846 3300021441 Bacteria 3718
124 Ga0207645_10048441 3300025907 Bacteria 2714
125 Ga0207684_10088453 3300025910 Bacteria 2639
126 Ga0207695_10003773 3300025913 Bacteria 21027
127 Ga0207695_10038756 3300025913 Bacteria 5126
128 Ga0207660_10024237 3300025917 Bacteria 4106
129 Ga0207646_10176308 3300025922 Bacteria 1931
130 Ga0207646_10177837 3300025922 Unclassified 1922
131 Ga0207681_10021986 3300025923 Bacteria 4062
132 Ga0207694_10020249 3300025924 Bacteria 5030
133 Ga0207694_10163323 3300025924 Bacteria 1800
134 Ga0207700_10580538 3300025928 Bacteria 997
135 Ga0207644_10247190 3300025931 Bacteria 1422
136 Ga0207706_10594263 3300025933 Bacteria 951
137 Ga0207709_10010711 3300025935 Bacteria 5051
138 Ga0207670_10021863 3300025936 Bacteria 3953
139 Ga0207704_10061080 3300025938 Bacteria 2335
140 Ga0207691_10456178 3300025940 Bacteria 1087
141 Ga0207711_10011164 3300025941 Bacteria 7466
142 Ga0207711_10031585 3300025941 Bacteria 4471
143 Ga0207711_10096192 3300025941 Bacteria 2613
144 Ga0207711_10187811 3300025941 Bacteria 1882
145 Ga0207711_10559323 3300025941 Bacteria 1067
146 Ga0207689_10005188 3300025942 Bacteria 11698
147 Ga0207679_10044260 3300025945 Bacteria 3211
148 Ga0207679_10228252 3300025945 Bacteria 1570
149 Ga0207667_10161641 3300025949 Bacteria 2303
150 Ga0207667_10171233 3300025949 Bacteria 2232
151 Ga0207712_10214695 3300025961 Bacteria 1534
152 Ga0207640_10010833 3300025981 Bacteria 5148
153 Ga0207658_10005433 3300025986 Bacteria 8738
154 Ga0207703_10037255 3300026035 Bacteria 3874
155 Ga0207678_10116304 3300026067 Bacteria 2281
156 Ga0207702_10567068 3300026078 Bacteria 1112
157 Ga0207641_10000373 3300026088 Bacteria 53247
158 Ga0207641_10028103 3300026088 Bacteria 4645
159 Ga0207641_10088728 3300026088 Bacteria 2701
160 Ga0207641_10388914 3300026088 Bacteria 1337
161 Ga0207648_10031841 3300026089 Bacteria 4661
162 Ga0207676_10086551 3300026095 Bacteria 2560
163 Ga0207675_100004213 3300026118 Bacteria 13918
164 Ga0207675_100116919 3300026118 Bacteria 2520
165 Ga0207675_100176996 3300026118 Bacteria 2041
166 Ga0207683_10436857 3300026121 Bacteria 1206
167 Ga0209179_1000030 3300027512 Bacteria 34481
168 Ga0207428_10186042 3300027907 Bacteria 1567
169 Ga0268266_10007183 3300028379 Bacteria 10087
170 Ga0268266_10087627 3300028379 Bacteria 2724
171 Ga0268266_10146594 3300028379 Bacteria 2123
172 Ga0268265_10125013 3300028380 Bacteria 2127
173 Ga0268265_10316813 3300028380 Bacteria 1411
174 Ga0268264_10000044 3300028381 Bacteria 368079
175 Ga0268264_10093872 3300028381 Bacteria 2593
176 Ga0268264_10460713 3300028381 Bacteria 1233
177 Ga0265323_10004063 3300028653 Bacteria 6344
178 Ga0265338_10000064 3300028800 Bacteria 190219
179 Ga0265338_10001461 3300028800 Bacteria 38300
180 Ga0265338_10002568 3300028800 Bacteria 26849
181 Ga0265324_10000700 3300029957 Bacteria 22374
182 Ga0265339_10186891 3300031249 Unclassified 1029
183 Ga0307509_10021263 3300031507 Bacteria 7342
184 Ga0316576_10132737 3300031727 Bacteria 1873
185 Ga0316578_10104380 3300031728 Bacteria 1700
186 Ga0316578_10224299 3300031728 Bacteria 1129
187 Ga0307516_10000124 3300031730 Bacteria 90831
188 Ga0316577_10113678 3300031733 Bacteria 1519
189 Ga0316577_10244902 3300031733 Bacteria 1014
190 Ga0307416_100211376 3300032002 Bacteria 1851
191 Ga0316593_10035671 3300032168 Bacteria 1637
192 Ga0316592_1015334 3300033524 Bacteria 1595
193 Ga0316588_1010308 3300033528 Bacteria 1967
194 Ga0316574_0024311 3300035398 Unclassified 3624
195 Ga0316574_0088732 3300035398 Bacteria 1969
196 Ga0373935_0252421 3300035692 Unclassified 1235
197 Ga0373927_0003381 3300035695 Bacteria 11491
198 Ga0373947_0009199 3300035725 Bacteria 5677
199 Ga0373937_0211346 3300036401 Bacteria 1826
200 Ga0316582_0245780 3300036647 Bacteria 1226
201 Ga0316584_0068299 3300036712 Bacteria 2664
202 Ga0316584_0148008 3300036712 Bacteria 1749
203 Ga0373925_0008345 3300037068 Bacteria 7542
204 Ga0373925_0174930 3300037068 Bacteria 1696
205 Ga0395899_0124994 3300037312 Bacteria 1840
206 Ga0395900_0032145 3300037418 Bacteria 5394
207 Ga0395900_0057735 3300037418 Bacteria 3996
208 Ga0395898_0002172 3300037466 Bacteria 24023
209 Ga0395898_0208393 3300037466 Bacteria 1865
210 Ga0395905_0041860 3300037471 Bacteria 4299
211 Ga0395905_0220089 3300037471 Bacteria 1777
212 Ga0395901_0000676 3300038443 Bacteria 39205
213 Ga0436360_0643716 3300039438 Bacteria 4776
214 Ga0439455_0007692 3300042012 Bacteria 2288
215 Ga0439460_0062062 3300042461 Bacteria 1143
216 Ga0451577_0000798 3300042876 Bacteria 47379
217 Ga0453684_0008936 3300044712 Bacteria 17730
218 Ga0451576_0000087 3300045051 Bacteria 234554
219 Ga0451576_0007811 3300045051 Bacteria 12681
220 Ga0451576_0264047 3300045051 Bacteria 1800
221 Ga0495603_0089188 3300046455 Bacteria 1804
222 Ga0495651_0167010 3300046462 Bacteria 1571
223 Ga0495616_0011431 3300046513 Bacteria 5086
224 Ga0495630_0010367 3300046517 Bacteria 6725
225 Ga0495666_0015769 3300046526 Bacteria 3765
226 Ga0495657_0098845 3300046675 Bacteria 1862
227 Ga0495658_0220400 3300046683 Bacteria 1187
228 Ga0495680_0166179 3300047322 Bacteria 1600
229 Ga0496100_0261918 3300048903 Bacteria 1283
230 Ga0496104_0084649 3300048907 Bacteria 3026
231 Ga0496105_0129391 3300048908 Bacteria 2082
232 Ga0496107_0229974 3300048910 Bacteria 1380
233 Ga0496108_0322015 3300048911 Bacteria 1348
234 Ga0496110_0151379 3300048913 Bacteria 2101
235 Ga0496112_0017499 3300048915 Bacteria 6735
236 Ga0496112_0339054 3300048915 Bacteria 1447
237 Ga0496113_0211696 3300048916 Bacteria 1543
238 Ga0496114_0007333 3300048917 Bacteria 8706
239 Ga0496114_0026101 3300048917 Bacteria 4780
240 Ga0496114_0053776 3300048917 Bacteria 3356
241 Ga0496114_0113428 3300048917 Bacteria 2323
242 Ga0496115_0129934 3300048918 Bacteria 2076
243 Ga0496119_0000496 3300048922 Bacteria 53690
244 Ga0496120_0003559 3300048923 Bacteria 14072
245 Ga0496120_0118660 3300048923 Bacteria 1371
246 Ga0496121_0020750 3300048924 Bacteria 6478
247 Ga0496121_0033451 3300048924 Bacteria 4651
248 Ga0496125_0000488 3300048928 Bacteria 69299
249 Ga0496126_0005364 3300048929 Bacteria 14652
250 Ga0496126_0174322 3300048929 Bacteria 1830
251 Ga0501034_0029769 3300049571 Bacteria 5551
252 Ga0501036_0016860 3300049572 Bacteria 6102
253 Ga0501037_0103983 3300049573 Bacteria 2048
254 Ga0501047_0013011 3300049581 Bacteria 7879
255 Ga0501067_0012066 3300049583 Bacteria 4789
256 Ga0501067_0030289 3300049583 Bacteria 3001
257 Ga0501068_0056385 3300049584 Bacteria 2382
258 Ga0501070_0000108 3300049586 Bacteria 72665
259 Ga0501070_0085160 3300049586 Bacteria 2617
260 Ga0501073_0001471 3300049589 Bacteria 17451
261 Ga0501073_0003879 3300049589 Bacteria 11224
262 Ga0501073_0020647 3300049589 Bacteria 4750
263 Ga0501074_0079559 3300049590 Bacteria 2352
264 Ga0501080_0013292 3300049742 Bacteria 7565
265 Ga0501080_0073308 3300049742 Bacteria 3185
266 Ga0501083_0029292 3300049744 Bacteria 3788
267 Ga0501283_020757 3300049779 Bacteria 1049
268 Ga0501044_0001307 3300049823 Bacteria 29369
269 nmdc:mga05p37_39938_c1 3300050507 Bacteria 5762
270 nmdc:mga09592_18882_c1 3300050508 Bacteria 5655
271 nmdc:mga0qj67_42628_c1 3300050509 Bacteria 3572
272 nmdc:mga08y16_10176_c1 3300050511 Bacteria 9875
273 nmdc:mga0a205_250714_c1 3300050515 Bacteria 1650
274 nmdc:mga0a205_261454_c1 3300050515 Unclassified 1608
275 nmdc:mga0a205_525616_c1 3300050515 Bacteria 1039
276 Ga0495619_0093184 3300053085 Bacteria 2042
277 Ga0495619_0112794 3300053085 Bacteria 1859
278 Ga0501082_0209716 3300060353 Bacteria 1695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100305659 Ga0070661_1003056591 275
2 3300005364 Ga0070673_100320529 Ga0070673_1003205291 275
3 3300005564 Ga0070664_100018645 Ga0070664_1000186452 275
4 3300005614 Ga0068856_100555063 Ga0068856_1005550632 275
5 3300005618 Ga0068864_100007748 Ga0068864_1000077483 275
6 3300005841 Ga0068863_100081362 Ga0068863_1000813623 275
7 3300005842 Ga0068858_100006188 Ga0068858_1000061886 275
8 3300005843 Ga0068860_100114151 Ga0068860_1001141512 275
9 3300006237 Ga0097621_100109578 Ga0097621_1001095782 275
10 3300009177 Ga0105248_10011148 Ga0105248_100111482 275
11 3300013296 Ga0157374_10057267 Ga0157374_100572672 275
12 3300013306 Ga0163162_10038180 Ga0163162_100381802 275
13 3300014325 Ga0163163_10035811 Ga0163163_100358112 275
14 3300014968 Ga0157379_10029449 Ga0157379_100294494 275
15 3300014969 Ga0157376_10003078 Ga0157376_100030782 275
16 3300025941 Ga0207711_10031585 Ga0207711_100315854 275
17 3300025945 Ga0207679_10228252 Ga0207679_102282522 275
18 3300026035 Ga0207703_10037255 Ga0207703_100372554 275
19 3300048915 Ga0496112_0017499 Ga0496112_0017499_80_1042 275
20 3300037068 Ga0373925_0174930 Ga0373925_0174930_564_1463 277
21 3300045051 Ga0451576_0000087 Ga0451576_0000087_26811_27677 277
22 3300045051 Ga0451576_0007811 Ga0451576_0007811_2910_3770 277
23 3300006852 Ga0075433_10022456 Ga0075433_100224562 281
24 3300009094 Ga0111539_10263040 Ga0111539_102630401 281
25 3300009147 Ga0114129_10041653 Ga0114129_100416531 281
26 3300025941 Ga0207711_10096192 Ga0207711_100961922 281
27 3300032002 Ga0307416_100211376 Ga0307416_1002113762 281
28 3300046455 Ga0495603_0089188 Ga0495603_0089188_949_1794 281
29 3300050507 nmdc:mga05p37_39938_c1 nmdc:mga05p37_39938_c1_3541_4395 281
30 3300050515 nmdc:mga0a205_250714_c1 nmdc:mga0a205_250714_c1_20_874 281
31 3300005328 Ga0070676_10017162 Ga0070676_100171623 282
32 3300005329 Ga0070683_100613579 Ga0070683_1006135791 282
33 3300005330 Ga0070690_100018750 Ga0070690_1000187503 282
34 3300005334 Ga0068869_100008754 Ga0068869_1000087546 282
35 3300005353 Ga0070669_100088019 Ga0070669_1000880192 282
36 3300005364 Ga0070673_100050257 Ga0070673_1000502572 282
37 3300005468 Ga0070707_100222160 Ga0070707_1002221602 282
38 3300005545 Ga0070695_100004818 Ga0070695_10000481810 282
39 3300005546 Ga0070696_100008611 Ga0070696_1000086117 282
40 3300005563 Ga0068855_100059362 Ga0068855_1000593622 282
41 3300005578 Ga0068854_100011201 Ga0068854_1000112012 282
42 3300005615 Ga0070702_100050702 Ga0070702_1000507022 282
43 3300005841 Ga0068863_100006837 Ga0068863_1000068373 282
44 3300006881 Ga0068865_100004482 Ga0068865_1000044827 282
45 3300009098 Ga0105245_10013515 Ga0105245_100135152 282
46 3300009148 Ga0105243_10010128 Ga0105243_100101282 282
47 3300009176 Ga0105242_10000396 Ga0105242_1000039614 282
48 3300009177 Ga0105248_10000770 Ga0105248_1000077018 282
49 3300009553 Ga0105249_10016268 Ga0105249_100162689 282
50 3300009553 Ga0105249_10055712 Ga0105249_100557124 282
51 3300013306 Ga0163162_10023350 Ga0163162_100233506 282
52 3300025917 Ga0207660_10024237 Ga0207660_100242372 282
53 3300025922 Ga0207646_10177837 Ga0207646_101778372 282
54 3300025923 Ga0207681_10021986 Ga0207681_100219862 282
55 3300025935 Ga0207709_10010711 Ga0207709_100107112 282
56 3300025941 Ga0207711_10011164 Ga0207711_100111642 282
57 3300025942 Ga0207689_10005188 Ga0207689_100051887 282
58 3300025981 Ga0207640_10010833 Ga0207640_100108333 282
59 3300037418 Ga0395900_0057735 Ga0395900_0057735_448_1314 282
60 3300037466 Ga0395898_0208393 Ga0395898_0208393_513_1379 282
61 3300048910 Ga0496107_0229974 Ga0496107_0229974_326_1174 282
62 3300013297 Ga0157378_10001572 Ga0157378_1000157216 283
63 3300013308 Ga0157375_10028256 Ga0157375_100282566 283
64 3300036712 Ga0316584_0148008 Ga0316584_0148008_461_1321 283
65 3300005295 Ga0065707_10081836 Ga0065707_100818369 284
66 3300005536 Ga0070697_100221775 Ga0070697_1002217752 284
67 3300031728 Ga0316578_10104380 Ga0316578_101043801 284
68 3300035398 Ga0316574_0024311 Ga0316574_0024311_1918_2775 284
69 3300036401 Ga0373937_0211346 Ga0373937_0211346_32_895 284
70 3300036647 Ga0316582_0245780 Ga0316582_0245780_39_896 284
71 3300050515 nmdc:mga0a205_525616_c1 nmdc:mga0a205_525616_c1_76_981 284
72 3300005328 Ga0070676_10011285 Ga0070676_100112853 285
73 3300005459 Ga0068867_100070358 Ga0068867_1000703582 285
74 3300005466 Ga0070685_10146215 Ga0070685_101462151 285
75 3300005543 Ga0070672_100323103 Ga0070672_1003231032 285
76 3300005564 Ga0070664_100035827 Ga0070664_1000358274 285
77 3300005617 Ga0068859_100524295 Ga0068859_1005242952 285
78 3300005718 Ga0068866_10065761 Ga0068866_100657612 285
79 3300005981 Ga0081538_10018636 Ga0081538_100186362 285
80 3300006358 Ga0068871_100097197 Ga0068871_1000971972 285
81 3300006881 Ga0068865_100066246 Ga0068865_1000662463 285
82 3300006931 Ga0097620_100524307 Ga0097620_1005243071 285
83 3300009176 Ga0105242_10174756 Ga0105242_101747561 285
84 3300009177 Ga0105248_10294300 Ga0105248_102943002 285
85 3300009177 Ga0105248_10768745 Ga0105248_107687451 285
86 3300013308 Ga0157375_10162382 Ga0157375_101623823 285
87 3300014968 Ga0157379_10198684 Ga0157379_101986842 285
88 3300017792 Ga0163161_10023961 Ga0163161_100239613 285
89 3300025907 Ga0207645_10048441 Ga0207645_100484412 285
90 3300025933 Ga0207706_10594263 Ga0207706_105942631 285
91 3300025938 Ga0207704_10061080 Ga0207704_100610802 285
92 3300025940 Ga0207691_10456178 Ga0207691_104561781 285
93 3300025941 Ga0207711_10187811 Ga0207711_101878112 285
94 3300025945 Ga0207679_10044260 Ga0207679_100442602 285
95 3300026089 Ga0207648_10031841 Ga0207648_100318412 285
96 3300026121 Ga0207683_10436857 Ga0207683_104368571 285
97 3300031727 Ga0316576_10132737 Ga0316576_101327372 285
98 3300031728 Ga0316578_10224299 Ga0316578_102242991 285
99 3300031733 Ga0316577_10113678 Ga0316577_101136781 285
100 3300031733 Ga0316577_10244902 Ga0316577_102449022 285
101 3300032168 Ga0316593_10035671 Ga0316593_100356711 285
102 3300033524 Ga0316592_1015334 Ga0316592_10153342 285
103 3300033528 Ga0316588_1010308 Ga0316588_10103082 285
104 3300035398 Ga0316574_0088732 Ga0316574_0088732_703_1560 285
105 3300036712 Ga0316584_0068299 Ga0316584_0068299_738_1595 285
106 3300046683 Ga0495658_0220400 Ga0495658_0220400_148_1047 285
107 3300048903 Ga0496100_0261918 Ga0496100_0261918_414_1271 285
108 3300048907 Ga0496104_0084649 Ga0496104_0084649_1281_2138 285
109 3300048908 Ga0496105_0129391 Ga0496105_0129391_213_1070 285
110 3300048911 Ga0496108_0322015 Ga0496108_0322015_80_937 285
111 3300048913 Ga0496110_0151379 Ga0496110_0151379_952_1809 285
112 3300048917 Ga0496114_0026101 Ga0496114_0026101_2965_3822 285
113 3300048917 Ga0496114_0053776 Ga0496114_0053776_927_1784 285
114 3300048918 Ga0496115_0129934 Ga0496115_0129934_843_1700 285
115 3300049571 Ga0501034_0029769 Ga0501034_0029769_891_1781 285
116 3300049573 Ga0501037_0103983 Ga0501037_0103983_964_1854 285
117 3300049581 Ga0501047_0013011 Ga0501047_0013011_5317_6207 285
118 3300049586 Ga0501070_0085160 Ga0501070_0085160_945_1835 285
119 3300049823 Ga0501044_0001307 Ga0501044_0001307_27963_28853 285
120 3300050515 nmdc:mga0a205_261454_c1 nmdc:mga0a205_261454_c1_243_1187 285
121 3300053085 Ga0495619_0093184 Ga0495619_0093184_264_1121 285
122 3300060353 Ga0501082_0209716 Ga0501082_0209716_639_1529 285
123 3300005337 Ga0070682_100244498 Ga0070682_1002444982 286
124 3300005340 Ga0070689_100005393 Ga0070689_1000053932 286
125 3300005365 Ga0070688_100106247 Ga0070688_1001062472 286
126 3300005367 Ga0070667_100079377 Ga0070667_1000793773 286
127 3300005440 Ga0070705_100272141 Ga0070705_1002721411 286
128 3300005468 Ga0070707_100414624 Ga0070707_1004146242 286
129 3300005471 Ga0070698_100004870 Ga0070698_1000048703 286
130 3300005530 Ga0070679_100133014 Ga0070679_1001330142 286
131 3300005535 Ga0070684_100206413 Ga0070684_1002064132 286
132 3300005539 Ga0068853_100164372 Ga0068853_1001643722 286
133 3300005544 Ga0070686_100022842 Ga0070686_1000228423 286
134 3300005545 Ga0070695_100204579 Ga0070695_1002045791 286
135 3300005548 Ga0070665_100010263 Ga0070665_1000102635 286
136 3300005548 Ga0070665_100015718 Ga0070665_1000157182 286
137 3300005548 Ga0070665_100113134 Ga0070665_1001131342 286
138 3300005563 Ga0068855_100099044 Ga0068855_1000990443 286
139 3300005615 Ga0070702_100007785 Ga0070702_1000077855 286
140 3300005617 Ga0068859_100026326 Ga0068859_1000263263 286
141 3300005617 Ga0068859_100277086 Ga0068859_1002770862 286
142 3300005618 Ga0068864_100200987 Ga0068864_1002009872 286
143 3300005719 Ga0068861_100033984 Ga0068861_1000339842 286
144 3300005841 Ga0068863_100092100 Ga0068863_1000921003 286
145 3300005841 Ga0068863_100162750 Ga0068863_1001627502 286
146 3300005841 Ga0068863_100213493 Ga0068863_1002134932 286
147 3300005843 Ga0068860_100121130 Ga0068860_1001211303 286
148 3300005843 Ga0068860_100288369 Ga0068860_1002883692 286
149 3300005844 Ga0068862_100005478 Ga0068862_1000054783 286
150 3300005937 Ga0081455_10000935 Ga0081455_1000093519 286
151 3300006028 Ga0070717_10008086 Ga0070717_100080863 286
152 3300006844 Ga0075428_100034767 Ga0075428_1000347674 286
153 3300006880 Ga0075429_100149102 Ga0075429_1001491022 286
154 3300006931 Ga0097620_100026324 Ga0097620_1000263243 286
155 3300006931 Ga0097620_100277080 Ga0097620_1002770802 286
156 3300007788 Ga0099795_10000008 Ga0099795_100000087 286
157 3300009093 Ga0105240_10076310 Ga0105240_100763102 286
158 3300009093 Ga0105240_10102913 Ga0105240_101029133 286
159 3300009177 Ga0105248_10637525 Ga0105248_106375252 286
160 3300009545 Ga0105237_10162599 Ga0105237_101625993 286
161 3300009551 Ga0105238_10577439 Ga0105238_105774392 286
162 3300009553 Ga0105249_10138362 Ga0105249_101383623 286
163 3300010159 Ga0099796_10000294 Ga0099796_100002944 286
164 3300010375 Ga0105239_10562786 Ga0105239_105627861 286
165 3300013306 Ga0163162_10035663 Ga0163162_100356632 286
166 3300014325 Ga0163163_10588417 Ga0163163_105884172 286
167 3300021441 Ga0213871_10001846 Ga0213871_100018462 286
168 3300025913 Ga0207695_10003773 Ga0207695_100037737 286
169 3300025922 Ga0207646_10176308 Ga0207646_101763081 286
170 3300025924 Ga0207694_10020249 Ga0207694_100202492 286
171 3300025924 Ga0207694_10163323 Ga0207694_101633232 286
172 3300025928 Ga0207700_10580538 Ga0207700_105805381 286
173 3300025931 Ga0207644_10247190 Ga0207644_102471902 286
174 3300025936 Ga0207670_10021863 Ga0207670_100218633 286
175 3300025941 Ga0207711_10559323 Ga0207711_105593232 286
176 3300025949 Ga0207667_10161641 Ga0207667_101616412 286
177 3300025961 Ga0207712_10214695 Ga0207712_102146952 286
178 3300025986 Ga0207658_10005433 Ga0207658_100054334 286
179 3300026067 Ga0207678_10116304 Ga0207678_101163042 286
180 3300026088 Ga0207641_10000373 Ga0207641_1000037320 286
181 3300026088 Ga0207641_10088728 Ga0207641_100887282 286
182 3300026088 Ga0207641_10388914 Ga0207641_103889142 286
183 3300026095 Ga0207676_10086551 Ga0207676_100865513 286
184 3300026118 Ga0207675_100004213 Ga0207675_1000042132 286
185 3300026118 Ga0207675_100176996 Ga0207675_1001769963 286
186 3300027512 Ga0209179_1000030 Ga0209179_10000303 286
187 3300028379 Ga0268266_10007183 Ga0268266_100071834 286
188 3300028379 Ga0268266_10087627 Ga0268266_100876273 286
189 3300028379 Ga0268266_10146594 Ga0268266_101465941 286
190 3300028380 Ga0268265_10125013 Ga0268265_101250133 286
191 3300028381 Ga0268264_10000044 Ga0268264_10000044140 286
192 3300028381 Ga0268264_10093872 Ga0268264_100938722 286
193 3300028381 Ga0268264_10460713 Ga0268264_104607132 286
194 3300028653 Ga0265323_10004063 Ga0265323_100040632 286
195 3300031507 Ga0307509_10021263 Ga0307509_100212632 286
196 3300031730 Ga0307516_10000124 Ga0307516_1000012466 286
197 3300039438 Ga0436360_0643716 Ga0436360_0643716_2391_3251 286
198 3300042461 Ga0439460_0062062 Ga0439460_0062062_29_889 286
199 3300046513 Ga0495616_0011431 Ga0495616_0011431_3150_4010 286
200 3300047322 Ga0495680_0166179 Ga0495680_0166179_658_1518 286
201 3300048922 Ga0496119_0000496 Ga0496119_0000496_45785_46645 286
202 3300048923 Ga0496120_0003559 Ga0496120_0003559_6155_7015 286
203 3300048923 Ga0496120_0118660 Ga0496120_0118660_168_1028 286
204 3300048924 Ga0496121_0020750 Ga0496121_0020750_1107_1967 286
205 3300048924 Ga0496121_0033451 Ga0496121_0033451_3459_4319 286
206 3300048928 Ga0496125_0000488 Ga0496125_0000488_24010_24870 286
207 3300048929 Ga0496126_0005364 Ga0496126_0005364_5039_5899 286
208 3300048929 Ga0496126_0174322 Ga0496126_0174322_219_1079 286
209 3300005539 Ga0068853_100000450 Ga0068853_1000004505 287
210 3300025910 Ga0207684_10088453 Ga0207684_100884532 287
211 3300026118 Ga0207675_100116919 Ga0207675_1001169192 287
212 3300048917 Ga0496114_0007333 Ga0496114_0007333_5125_6012 287
213 3300049583 Ga0501067_0012066 Ga0501067_0012066_703_1590 287
214 3300049583 Ga0501067_0030289 Ga0501067_0030289_559_1428 287
215 3300049589 Ga0501073_0020647 Ga0501073_0020647_3118_4005 287
216 3300006846 Ga0075430_100073413 Ga0075430_1000734132 288
217 3300006880 Ga0075429_100012887 Ga0075429_1000128873 288
218 3300009094 Ga0111539_10008401 Ga0111539_100084018 288
219 3300013296 Ga0157374_10387311 Ga0157374_103873112 288
220 3300027907 Ga0207428_10186042 Ga0207428_101860422 288
221 3300037471 Ga0395905_0220089 Ga0395905_0220089_146_1048 288
222 3300049779 Ga0501283_020757 Ga0501283_020757_85_990 288
223 3300050508 nmdc:mga09592_18882_c1 nmdc:mga09592_18882_c1_225_1160 288
224 3300050509 nmdc:mga0qj67_42628_c1 nmdc:mga0qj67_42628_c1_1900_2835 288
225 3300050511 nmdc:mga08y16_10176_c1 nmdc:mga08y16_10176_c1_1908_2843 288
226 3300049572 Ga0501036_0016860 Ga0501036_0016860_4535_5428 289
227 3300049589 Ga0501073_0001471 Ga0501073_0001471_3894_4802 289
228 3300049742 Ga0501080_0073308 Ga0501080_0073308_108_1016 289
229 3300049744 Ga0501083_0029292 Ga0501083_0029292_1419_2327 289
230 3300003322 rootL2_10177237 rootL2_101772371 290
231 3300005293 Ga0065715_10001905 Ga0065715_100019052 290
232 3300005436 Ga0070713_100277474 Ga0070713_1002774741 290
233 3300005471 Ga0070698_100028806 Ga0070698_1000288062 290
234 3300005843 Ga0068860_100143269 Ga0068860_1001432692 290
235 3300005844 Ga0068862_100207547 Ga0068862_1002075472 290
236 3300005937 Ga0081455_10054021 Ga0081455_100540212 290
237 3300006028 Ga0070717_10180610 Ga0070717_101806103 290
238 3300009093 Ga0105240_10136691 Ga0105240_101366914 290
239 3300009098 Ga0105245_10047673 Ga0105245_100476734 290
240 3300009174 Ga0105241_10058992 Ga0105241_100589924 290
241 3300009551 Ga0105238_10033690 Ga0105238_100336902 290
242 3300013296 Ga0157374_10315619 Ga0157374_103156192 290
243 3300025913 Ga0207695_10038756 Ga0207695_100387563 290
244 3300025949 Ga0207667_10171233 Ga0207667_101712331 290
245 3300026078 Ga0207702_10567068 Ga0207702_105670682 290
246 3300026088 Ga0207641_10028103 Ga0207641_100281032 290
247 3300028380 Ga0268265_10316813 Ga0268265_103168132 290
248 3300028800 Ga0265338_10000064 Ga0265338_1000006497 290
249 3300028800 Ga0265338_10001461 Ga0265338_1000146134 290
250 3300028800 Ga0265338_10002568 Ga0265338_1000256818 290
251 3300029957 Ga0265324_10000700 Ga0265324_1000070014 290
252 3300031249 Ga0265339_10186891 Ga0265339_101868911 290
253 3300035692 Ga0373935_0252421 Ga0373935_0252421_154_1077 290
254 3300035695 Ga0373927_0003381 Ga0373927_0003381_9344_10273 290
255 3300035725 Ga0373947_0009199 Ga0373947_0009199_980_1909 290
256 3300037068 Ga0373925_0008345 Ga0373925_0008345_818_1747 290
257 3300037312 Ga0395899_0124994 Ga0395899_0124994_898_1803 290
258 3300037418 Ga0395900_0032145 Ga0395900_0032145_2648_3703 290
259 3300037466 Ga0395898_0002172 Ga0395898_0002172_1505_2560 290
260 3300037471 Ga0395905_0041860 Ga0395905_0041860_2811_3716 290
261 3300038443 Ga0395901_0000676 Ga0395901_0000676_22883_23938 290
262 3300042012 Ga0439455_0007692 Ga0439455_0007692_632_1528 290
263 3300042876 Ga0451577_0000798 Ga0451577_0000798_8313_9236 290
264 3300044712 Ga0453684_0008936 Ga0453684_0008936_1020_1943 290
265 3300045051 Ga0451576_0264047 Ga0451576_0264047_869_1759 290
266 3300046462 Ga0495651_0167010 Ga0495651_0167010_217_1122 290
267 3300046517 Ga0495630_0010367 Ga0495630_0010367_4907_5836 290
268 3300046526 Ga0495666_0015769 Ga0495666_0015769_909_1838 290
269 3300046675 Ga0495657_0098845 Ga0495657_0098845_444_1349 290
270 3300048915 Ga0496112_0339054 Ga0496112_0339054_261_1166 290
271 3300048916 Ga0496113_0211696 Ga0496113_0211696_533_1438 290
272 3300048917 Ga0496114_0113428 Ga0496114_0113428_214_1173 290
273 3300049584 Ga0501068_0056385 Ga0501068_0056385_49_957 290
274 3300049586 Ga0501070_0000108 Ga0501070_0000108_38481_39389 290
275 3300049589 Ga0501073_0003879 Ga0501073_0003879_9027_9935 290
276 3300049590 Ga0501074_0079559 Ga0501074_0079559_1014_1922 290
277 3300049742 Ga0501080_0013292 Ga0501080_0013292_50_958 290
278 3300053085 Ga0495619_0112794 Ga0495619_0112794_278_1183 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

92

295

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

98

342

0.95

PF08659

KR

KR domain

93

283

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9526 27 282
4rzh-assembly1.cif.gz_B crystal structure of fabg from synechocystis sp. pcc 6803 0.9525 31 282
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9522 31 282
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9509 31 282
3osu-assembly1.cif.gz_B crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9508 31 282
ID Description Score Start End Superfamily
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 26 279 3.40.50.720
af_C6TLW3_3_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 24 281 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 30 282 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 27 279 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9437 28 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A074LKV4-F1-model_v4 Oxidoreductase 0.9901 27 109 GO:0016614
AF-A0A562VFE8-F1-model_v4 Short subunit dehydrogenase 0.9828 26 151
AF-A0A2V8XGZ2-F1-model_v4 Oxidoreductase 0.9788 25 148
AF-A0A3C1QWH6-F1-model_v4 Oxidoreductase 0.9734 25 116
AF-A0A4Q3HY53-F1-model_v4 deleted 0.9672 31 145

Feature Viewer

pLDDT pTM Quality
90.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map