F382432

General Info

Members Datasets Scaffolds Average Seq Length
278 189 556 105

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10761348|Ga0207681_107613482
Length 123
Sequence MRRKNSRPGTGGKTAIVTPGELLSEEFLKPMSITQYRLAKEIAVPAQRIGDIVAGKRAITADTDLRLCRFFGLSNGYWLRAQAAHDTEVAEREIGPQLGNIRPWTLAVREPSRKYRVRVAAKK

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
55 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
136 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
137 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
138 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
139 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
140 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
141 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
142 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
143 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
151 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
152 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 1.08
Rhizosphere 89.57
Stem 0
Stem Tuber 0
Unclassified 22.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10761348 3300025923 Bacteria 808
2 JGI25406J46586_10022438 3300003203 Bacteria 2514
3 rootH1_10310270 3300003323 Bacteria 3368
4 Ga0058860_11272936 3300004801 Bacteria 888
5 Ga0070658_10111282 3300005327 Bacteria 2269
6 Ga0070683_100048036 3300005329 Bacteria 3945
7 Ga0070683_100313650 3300005329 Bacteria 1492
8 Ga0070670_100530908 3300005331 Bacteria 1048
9 Ga0070670_101460971 3300005331 Bacteria 627
10 Ga0068869_100003049 3300005334 Bacteria 10191
11 Ga0068869_100913576 3300005334 Bacteria 760
12 Ga0070680_100032352 3300005336 Bacteria 4210
13 Ga0070680_100219124 3300005336 Bacteria 1606
14 Ga0070682_100128951 3300005337 Unclassified 1709
15 Ga0070682_100941108 3300005337 Unclassified 713
16 Ga0070661_100766378 3300005344 Unclassified 790
17 Ga0070692_11278020 3300005345 Unclassified 525
18 Ga0070675_100327722 3300005354 Bacteria 1354
19 Ga0070675_101457035 3300005354 Unclassified 631
20 Ga0070671_100031192 3300005355 Bacteria 4402
21 Ga0070671_101674440 3300005355 Bacteria 564
22 Ga0070667_100191989 3300005367 Bacteria 1810
23 Ga0070667_100221640 3300005367 Bacteria 1684
24 Ga0070709_10427231 3300005434 Bacteria 994
25 Ga0070713_100595624 3300005436 Bacteria 1050
26 Ga0070710_10039728 3300005437 Bacteria 2590
27 Ga0070711_101429621 3300005439 Bacteria 602
28 Ga0070694_100360730 3300005444 Bacteria 1128
29 Ga0070662_100197532 3300005457 Bacteria 1594
30 Ga0070681_10016798 3300005458 Bacteria 7308
31 Ga0068867_101065304 3300005459 Bacteria 736
32 Ga0070685_11246544 3300005466 Unclassified 566
33 Ga0070679_100228996 3300005530 Bacteria 1818
34 Ga0070684_100098992 3300005535 Bacteria 2602
35 Ga0068853_100190637 3300005539 Bacteria 1862
36 Ga0068853_100583202 3300005539 Bacteria 1061
37 Ga0070672_100033945 3300005543 Bacteria 3867
38 Ga0070686_100065422 3300005544 Bacteria 2362
39 Ga0070686_100824406 3300005544 Unclassified 749
40 Ga0070686_100971851 3300005544 Unclassified 695
41 Ga0070665_100587453 3300005548 Unclassified 1127
42 Ga0070704_100539874 3300005549 Bacteria 1017
43 Ga0068855_100427066 3300005563 Bacteria 1449
44 Ga0070664_101085309 3300005564 Bacteria 754
45 Ga0068854_100370709 3300005578 Bacteria 1177
46 Ga0068854_100596846 3300005578 Bacteria 942
47 Ga0068851_10224055 3300005834 Unclassified 1058
48 Ga0068860_101633630 3300005843 Unclassified 666
49 Ga0081539_10000841 3300005985 Bacteria 58811
50 Ga0070717_10122425 3300006028 Bacteria 2230
51 Ga0097621_100210729 3300006237 Bacteria 1690
52 Ga0097621_100540345 3300006237 Bacteria 1060
53 Ga0097621_100660496 3300006237 Bacteria 960
54 Ga0068871_100165740 3300006358 Bacteria 1891
55 Ga0068871_100625238 3300006358 Bacteria 981
56 Ga0075428_100381793 3300006844 Bacteria 1510
57 Ga0075431_100561141 3300006847 Bacteria 1128
58 Ga0075433_10271767 3300006852 Bacteria 1502
59 Ga0075433_11623648 3300006852 Unclassified 557
60 Ga0075433_11766110 3300006852 Unclassified 532
61 Ga0075434_100004559 3300006871 Bacteria 12512
62 Ga0075434_100843843 3300006871 Bacteria 932
63 Ga0075436_100037999 3300006914 Bacteria 3323
64 Ga0075436_100218540 3300006914 Bacteria 1352
65 Ga0075435_100114866 3300007076 Bacteria 2241
66 Ga0075435_100423826 3300007076 Bacteria 1146
67 Ga0105240_10041298 3300009093 Bacteria 5889
68 Ga0111539_10777578 3300009094 Bacteria 1114
69 Ga0105242_10338462 3300009176 Bacteria 1386
70 Ga0105237_10727682 3300009545 Unclassified 999
71 Ga0105238_11487905 3300009551 Unclassified 706
72 Ga0105249_10415970 3300009553 Bacteria 1377
73 Ga0105246_10510621 3300011119 Unclassified 1022
74 Ga0157345_1002104 3300012498 Bacteria 1397
75 Ga0157324_1012848 3300012506 Unclassified 748
76 Ga0157370_10034584 3300013104 Bacteria 4918
77 Ga0157374_12106761 3300013296 Bacteria 591
78 Ga0157378_10000240 3300013297 Bacteria 53471
79 Ga0157378_10570588 3300013297 Bacteria 1139
80 Ga0163162_10215161 3300013306 Bacteria 2052
81 Ga0163162_10622983 3300013306 Unclassified 1204
82 Ga0163162_13204276 3300013306 Bacteria 525
83 Ga0157372_10071347 3300013307 Bacteria 3911
84 Ga0157372_10467401 3300013307 Bacteria 1470
85 Ga0157372_11268791 3300013307 Bacteria 850
86 Ga0157375_10000015 3300013308 Bacteria 308254
87 Ga0157375_10010402 3300013308 Bacteria 8191
88 Ga0157514_117518 3300013874 Unclassified 748
89 Ga0163163_10132220 3300014325 Bacteria 2535
90 Ga0157380_10453311 3300014326 Bacteria 1232
91 Ga0157380_10897544 3300014326 Bacteria 912
92 Ga0157380_10927802 3300014326 Bacteria 899
93 Ga0157380_11316264 3300014326 Unclassified 770
94 Ga0157376_10000019 3300014969 Bacteria 255553
95 Ga0157376_10519628 3300014969 Bacteria 1173
96 Ga0157376_10815572 3300014969 Bacteria 947
97 Ga0163161_10158425 3300017792 Bacteria 1725
98 Ga0163161_10334420 3300017792 Unclassified 1200
99 Ga0207705_10065543 3300025909 Bacteria 2626
100 Ga0207707_10158881 3300025912 Bacteria 1976
101 Ga0207707_11265646 3300025912 Unclassified 594
102 Ga0207693_11051368 3300025915 Bacteria 620
103 Ga0207660_10081577 3300025917 Bacteria 2377
104 Ga0207660_10168617 3300025917 Bacteria 1693
105 Ga0207660_10178906 3300025917 Bacteria 1646
106 Ga0207649_11226424 3300025920 Bacteria 593
107 Ga0207652_10070686 3300025921 Bacteria 3031
108 Ga0207650_10127959 3300025925 Bacteria 1984
109 Ga0207659_10548034 3300025926 Unclassified 983
110 Ga0207700_11460742 3300025928 Bacteria 607
111 Ga0207706_10124494 3300025933 Bacteria 2268
112 Ga0207669_10478973 3300025937 Unclassified 992
113 Ga0207691_10760125 3300025940 Unclassified 816
114 Ga0207689_10007384 3300025942 Bacteria 9638
115 Ga0207689_10200979 3300025942 Bacteria 1645
116 Ga0207661_10000524 3300025944 Bacteria 24747
117 Ga0207661_10374568 3300025944 Bacteria 1288
118 Ga0207679_10759179 3300025945 Unclassified 882
119 Ga0207667_10378850 3300025949 Bacteria 1442
120 Ga0207651_11821136 3300025960 Bacteria 548
121 Ga0207712_10308723 3300025961 Unclassified 1301
122 Ga0207668_12156370 3300025972 Unclassified 501
123 Ga0207640_10057481 3300025981 Bacteria 2559
124 Ga0207658_10279030 3300025986 Bacteria 1432
125 Ga0207658_10298880 3300025986 Bacteria 1386
126 Ga0207648_10531633 3300026089 Bacteria 1078
127 Ga0207676_11414202 3300026095 Unclassified 692
128 Ga0207675_100991917 3300026118 Unclassified 858
129 Ga0209974_10146268 3300027876 Bacteria 850
130 Ga0209974_10384611 3300027876 Unclassified 549
131 Ga0207428_10364049 3300027907 Bacteria 1063
132 Ga0268265_11507295 3300028380 Bacteria 676
133 Ga0268264_10255819 3300028381 Unclassified 1629
134 Ga0265334_10016982 3300028573 Bacteria 3010
135 Ga0265323_10265994 3300028653 Bacteria 532
136 Ga0265336_10000433 3300028666 Bacteria 25789
137 Ga0265324_10000018 3300029957 Bacteria 184238
138 Ga0307511_10024179 3300030521 Bacteria 5637
139 Ga0265330_10000735 3300031235 Bacteria 20673
140 Ga0265332_10066576 3300031238 Bacteria 1537
141 Ga0265325_10000359 3300031241 Bacteria 32086
142 Ga0265339_10423747 3300031249 Bacteria 620
143 Ga0265316_10018222 3300031344 Bacteria 6040
144 Ga0265316_10498698 3300031344 Bacteria 870
145 Ga0265316_10654421 3300031344 Bacteria 743
146 Ga0307408_100214496 3300031548 Bacteria 1567
147 Ga0316575_10112345 3300031665 Unclassified 1112
148 Ga0316575_10211357 3300031665 Bacteria 809
149 Ga0265314_10035133 3300031711 Bacteria 3655
150 Ga0265314_10169774 3300031711 Bacteria 1318
151 Ga0265342_10047265 3300031712 Bacteria 2583
152 Ga0316576_10281989 3300031727 Bacteria 1244
153 Ga0316576_10299651 3300031727 Bacteria 1202
154 Ga0316576_10397891 3300031727 Unclassified 1021
155 Ga0316576_11123228 3300031727 Bacteria 557
156 Ga0316578_10558920 3300031728 Bacteria 672
157 Ga0316577_10112165 3300031733 Bacteria 1530
158 Ga0316577_10207056 3300031733 Bacteria 1108
159 Ga0307410_10311060 3300031852 Unclassified 1246
160 Ga0307406_10468839 3300031901 Bacteria 1014
161 Ga0307407_10112248 3300031903 Unclassified 1713
162 Ga0307407_10439691 3300031903 Bacteria 944
163 Ga0307409_100060210 3300031995 Bacteria 2960
164 Ga0307416_100045092 3300032002 Bacteria 3469
165 Ga0307416_100205975 3300032002 Bacteria 1871
166 Ga0307414_10663268 3300032004 Unclassified 941
167 Ga0307414_10858602 3300032004 Bacteria 830
168 Ga0307411_10045046 3300032005 Unclassified 2835
169 Ga0307411_10094012 3300032005 Bacteria 2101
170 Ga0307415_100042506 3300032126 Unclassified 3025
171 Ga0307415_100118858 3300032126 Bacteria 1977
172 Ga0316583_10024502 3300032133 Bacteria 2155
173 Ga0373944_0342400 3300035089 Unclassified 568
174 Ga0373932_0143419 3300035112 Bacteria 814
175 Ga0373936_0394080 3300035113 Unclassified 635
176 Ga0373945_0280980 3300035116 Unclassified 709
177 Ga0373956_0095475 3300035119 Bacteria 1375
178 Ga0373943_0615606 3300035170 Unclassified 640
179 Ga0373946_0250016 3300035171 Unclassified 864
180 Ga0316574_0088578 3300035398 Bacteria 1971
181 Ga0373935_0302843 3300035692 Unclassified 1130
182 Ga0373927_0582973 3300035695 Unclassified 739
183 Ga0373947_0615894 3300035725 Bacteria 740
184 Ga0373937_0370942 3300036401 Bacteria 1357
185 Ga0316582_0553781 3300036647 Bacteria 792
186 Ga0316582_0670613 3300036647 Unclassified 713
187 Ga0316584_0131324 3300036712 Bacteria 1871
188 Ga0316584_0446582 3300036712 Bacteria 915
189 Ga0316584_0610574 3300036712 Bacteria 755
190 Ga0400484_00011 3300038725 Bacteria 2261
191 Ga0400484_36937 3300038725 Bacteria 1220
192 Ga0400490_08283 3300038726 Bacteria 1371
193 Ga0400490_47060 3300038726 Bacteria 1802
194 Ga0400490_60004 3300038726 Bacteria 44745
195 Ga0400491_01775 3300038727 Bacteria 3600
196 Ga0400491_16574 3300038727 Bacteria 2142
197 Ga0400485_02487 3300038735 Bacteria 3850
198 Ga0400485_08940 3300038735 Bacteria 1538
199 Ga0400488_52004 3300038741 Bacteria 2238
200 Ga0400486_05110 3300038742 Bacteria 3090
201 Ga0400486_10345 3300038742 Unclassified 2362
202 Ga0400486_33141 3300038742 Bacteria 1501
203 Ga0400483_045923 3300039062 Bacteria 1083
204 Ga0400483_109819 3300039062 Unclassified 1027
205 Ga0400489_15206 3300039093 Bacteria 1008
206 Ga0400489_38654 3300039093 Bacteria 1710
207 Ga0400489_77927 3300039093 Bacteria 2728
208 Ga0400487_02606 3300039110 Unclassified 1004
209 Ga0451789_0313420 3300041443 Bacteria 859
210 Ga0451807_2182915 3300041486 Bacteria 1147
211 Ga0451851_0598144 3300041507 Unclassified 565
212 Ga0451853_3866478 3300041512 Bacteria 1220
213 Ga0439441_062411 3300042001 Bacteria 786
214 Ga0439443_060222 3300042003 Bacteria 678
215 Ga0450923_134408 3300042125 Bacteria 591
216 Ga0450895_011031 3300042132 Bacteria 776
217 Ga0450910_017735 3300042147 Bacteria 1061
218 Ga0439446_0143762 3300042156 Bacteria 780
219 Ga0450908_025872 3300042184 Bacteria 1024
220 Ga0439434_0106267 3300042435 Bacteria 907
221 Ga0439444_0011588 3300042437 Bacteria 1430
222 Ga0451577_0016139 3300042876 Bacteria 6923
223 Ga0451577_0017229 3300042876 Bacteria 6679
224 Ga0451577_0156991 3300042876 Bacteria 2048
225 Ga0451577_0810560 3300042876 Bacteria 845
226 Ga0451577_1194200 3300042876 Bacteria 679
227 Ga0451577_1405624 3300042876 Bacteria 619
228 Ga0451577_1892599 3300042876 Bacteria 522
229 Ga0453683_0000145 3300044673 Bacteria 104430
230 Ga0453683_0006802 3300044673 Bacteria 7812
231 Ga0453683_0015826 3300044673 Bacteria 4876
232 Ga0453684_0000424 3300044712 Bacteria 172336
233 Ga0453684_0006218 3300044712 Bacteria 22890
234 Ga0453684_0012834 3300044712 Bacteria 13731
235 Ga0453684_0042792 3300044712 Bacteria 6099
236 Ga0453684_0209895 3300044712 Unclassified 2264
237 Ga0453684_0389315 3300044712 Bacteria 1564
238 Ga0453684_0534332 3300044712 Bacteria 1294
239 Ga0451576_0147741 3300045051 Bacteria 2451
240 Ga0451576_0733909 3300045051 Bacteria 1037
241 Ga0451576_0831257 3300045051 Bacteria 970
242 Ga0495603_0644276 3300046455 Unclassified 606
243 Ga0495580_0572074 3300046472 Bacteria 749
244 Ga0495666_0263395 3300046526 Unclassified 784
245 Ga0495586_0107509 3300046535 Bacteria 1552
246 Ga0495633_0529947 3300046558 Bacteria 531
247 Ga0495657_0789941 3300046675 Bacteria 543
248 Ga0495615_0022324 3300048090 Unclassified 1438
249 Ga0496106_0130609 3300048909 Bacteria 1969
250 Ga0501034_0134134 3300049571 Bacteria 2458
251 Ga0501067_0004468 3300049583 Bacteria 7714
252 Ga0501067_0040912 3300049583 Bacteria 2574
253 Ga0501068_0026009 3300049584 Bacteria 3445
254 Ga0501069_0518032 3300049585 Unclassified 712
255 Ga0501073_0038270 3300049589 Bacteria 3403
256 Ga0501074_0746328 3300049590 Unclassified 690
257 Ga0501076_0151370 3300049592 Unclassified 1887
258 Ga0501077_0617179 3300049593 Bacteria 697
259 Ga0501080_0055628 3300049742 Bacteria 3685
260 Ga0501080_1096553 3300049742 Bacteria 687
261 Ga0501083_0058331 3300049744 Bacteria 2583
262 nmdc:mga06r32_337790_c1 3300050510 Bacteria 1491
263 nmdc:mga08y16_29751_c1 3300050511 Bacteria 5750
264 nmdc:mga0n895_714753_c1 3300050512 Viruses 997
265 nmdc:mga0n895_8264_c1 3300050512 Bacteria 9002
266 nmdc:mga0rr50_406611_c1 3300050513 Bacteria 1150
267 nmdc:mga0rr50_47303_c1 3300050513 Unclassified 3172
268 nmdc:mga08x19_31142_c1 3300050514 Bacteria 3354
269 nmdc:mga08x19_912819_c1 3300050514 Unclassified 624
270 nmdc:mga0a205_1215771_c1 3300050515 Unclassified 601
271 nmdc:mga0a205_1231551_c1 3300050515 Unclassified 596
272 nmdc:mga0a205_158583_c1 3300050515 Bacteria 2160
273 nmdc:mga0a205_771841_c1 3300050515 Bacteria 809
274 Ga0500651_0017531 3300053093 Bacteria 4420
275 Ga0500620_076186 3300053155 Bacteria 1158
276 Ga0501084_0151133 3300054114 Bacteria 1957
277 Ga0501082_0107207 3300060353 Bacteria 2417
278 Ga0530510_1133070 3300061734 Bacteria 599
279 Ga0207681_10761348
280 JGI25406J46586_10022438
281 rootH1_10310270
282 Ga0058860_11272936
283 Ga0070658_10111282
284 Ga0070683_100048036
285 Ga0070683_100313650
286 Ga0070670_100530908
287 Ga0070670_101460971
288 Ga0068869_100003049
289 Ga0068869_100913576
290 Ga0070680_100032352
291 Ga0070680_100219124
292 Ga0070682_100128951
293 Ga0070682_100941108
294 Ga0070661_100766378
295 Ga0070692_11278020
296 Ga0070675_100327722
297 Ga0070675_101457035
298 Ga0070671_100031192
299 Ga0070671_101674440
300 Ga0070667_100191989
301 Ga0070667_100221640
302 Ga0070709_10427231
303 Ga0070713_100595624
304 Ga0070710_10039728
305 Ga0070711_101429621
306 Ga0070694_100360730
307 Ga0070662_100197532
308 Ga0070681_10016798
309 Ga0068867_101065304
310 Ga0070685_11246544
311 Ga0070679_100228996
312 Ga0070684_100098992
313 Ga0068853_100190637
314 Ga0068853_100583202
315 Ga0070672_100033945
316 Ga0070686_100065422
317 Ga0070686_100824406
318 Ga0070686_100971851
319 Ga0070665_100587453
320 Ga0070704_100539874
321 Ga0068855_100427066
322 Ga0070664_101085309
323 Ga0068854_100370709
324 Ga0068854_100596846
325 Ga0068851_10224055
326 Ga0068860_101633630
327 Ga0081539_10000841
328 Ga0070717_10122425
329 Ga0097621_100210729
330 Ga0097621_100540345
331 Ga0097621_100660496
332 Ga0068871_100165740
333 Ga0068871_100625238
334 Ga0075428_100381793
335 Ga0075431_100561141
336 Ga0075433_10271767
337 Ga0075433_11623648
338 Ga0075433_11766110
339 Ga0075434_100004559
340 Ga0075434_100843843
341 Ga0075436_100037999
342 Ga0075436_100218540
343 Ga0075435_100114866
344 Ga0075435_100423826
345 Ga0105240_10041298
346 Ga0111539_10777578
347 Ga0105242_10338462
348 Ga0105237_10727682
349 Ga0105238_11487905
350 Ga0105249_10415970
351 Ga0105246_10510621
352 Ga0157345_1002104
353 Ga0157324_1012848
354 Ga0157370_10034584
355 Ga0157374_12106761
356 Ga0157378_10000240
357 Ga0157378_10570588
358 Ga0163162_10215161
359 Ga0163162_10622983
360 Ga0163162_13204276
361 Ga0157372_10071347
362 Ga0157372_10467401
363 Ga0157372_11268791
364 Ga0157375_10000015
365 Ga0157375_10010402
366 Ga0157514_117518
367 Ga0163163_10132220
368 Ga0157380_10453311
369 Ga0157380_10897544
370 Ga0157380_10927802
371 Ga0157380_11316264
372 Ga0157376_10000019
373 Ga0157376_10519628
374 Ga0157376_10815572
375 Ga0163161_10158425
376 Ga0163161_10334420
377 Ga0207705_10065543
378 Ga0207707_10158881
379 Ga0207707_11265646
380 Ga0207693_11051368
381 Ga0207660_10081577
382 Ga0207660_10168617
383 Ga0207660_10178906
384 Ga0207649_11226424
385 Ga0207652_10070686
386 Ga0207650_10127959
387 Ga0207659_10548034
388 Ga0207700_11460742
389 Ga0207706_10124494
390 Ga0207669_10478973
391 Ga0207691_10760125
392 Ga0207689_10007384
393 Ga0207689_10200979
394 Ga0207661_10000524
395 Ga0207661_10374568
396 Ga0207679_10759179
397 Ga0207667_10378850
398 Ga0207651_11821136
399 Ga0207712_10308723
400 Ga0207668_12156370
401 Ga0207640_10057481
402 Ga0207658_10279030
403 Ga0207658_10298880
404 Ga0207648_10531633
405 Ga0207676_11414202
406 Ga0207675_100991917
407 Ga0209974_10146268
408 Ga0209974_10384611
409 Ga0207428_10364049
410 Ga0268265_11507295
411 Ga0268264_10255819
412 Ga0265334_10016982
413 Ga0265323_10265994
414 Ga0265336_10000433
415 Ga0265324_10000018
416 Ga0307511_10024179
417 Ga0265330_10000735
418 Ga0265332_10066576
419 Ga0265325_10000359
420 Ga0265339_10423747
421 Ga0265316_10018222
422 Ga0265316_10498698
423 Ga0265316_10654421
424 Ga0307408_100214496
425 Ga0316575_10112345
426 Ga0316575_10211357
427 Ga0265314_10035133
428 Ga0265314_10169774
429 Ga0265342_10047265
430 Ga0316576_10281989
431 Ga0316576_10299651
432 Ga0316576_10397891
433 Ga0316576_11123228
434 Ga0316578_10558920
435 Ga0316577_10112165
436 Ga0316577_10207056
437 Ga0307410_10311060
438 Ga0307406_10468839
439 Ga0307407_10112248
440 Ga0307407_10439691
441 Ga0307409_100060210
442 Ga0307416_100045092
443 Ga0307416_100205975
444 Ga0307414_10663268
445 Ga0307414_10858602
446 Ga0307411_10045046
447 Ga0307411_10094012
448 Ga0307415_100042506
449 Ga0307415_100118858
450 Ga0316583_10024502
451 Ga0373944_0342400
452 Ga0373932_0143419
453 Ga0373936_0394080
454 Ga0373945_0280980
455 Ga0373956_0095475
456 Ga0373943_0615606
457 Ga0373946_0250016
458 Ga0316574_0088578
459 Ga0373935_0302843
460 Ga0373927_0582973
461 Ga0373947_0615894
462 Ga0373937_0370942
463 Ga0316582_0553781
464 Ga0316582_0670613
465 Ga0316584_0131324
466 Ga0316584_0446582
467 Ga0316584_0610574
468 Ga0400484_00011
469 Ga0400484_36937
470 Ga0400490_08283
471 Ga0400490_47060
472 Ga0400490_60004
473 Ga0400491_01775
474 Ga0400491_16574
475 Ga0400485_02487
476 Ga0400485_08940
477 Ga0400488_52004
478 Ga0400486_05110
479 Ga0400486_10345
480 Ga0400486_33141
481 Ga0400483_045923
482 Ga0400483_109819
483 Ga0400489_15206
484 Ga0400489_38654
485 Ga0400489_77927
486 Ga0400487_02606
487 Ga0451789_0313420
488 Ga0451807_2182915
489 Ga0451851_0598144
490 Ga0451853_3866478
491 Ga0439441_062411
492 Ga0439443_060222
493 Ga0450923_134408
494 Ga0450895_011031
495 Ga0450910_017735
496 Ga0439446_0143762
497 Ga0450908_025872
498 Ga0439434_0106267
499 Ga0439444_0011588
500 Ga0451577_0016139
501 Ga0451577_0017229
502 Ga0451577_0156991
503 Ga0451577_0810560
504 Ga0451577_1194200
505 Ga0451577_1405624
506 Ga0451577_1892599
507 Ga0453683_0000145
508 Ga0453683_0006802
509 Ga0453683_0015826
510 Ga0453684_0000424
511 Ga0453684_0006218
512 Ga0453684_0012834
513 Ga0453684_0042792
514 Ga0453684_0209895
515 Ga0453684_0389315
516 Ga0453684_0534332
517 Ga0451576_0147741
518 Ga0451576_0733909
519 Ga0451576_0831257
520 Ga0495603_0644276
521 Ga0495580_0572074
522 Ga0495666_0263395
523 Ga0495586_0107509
524 Ga0495633_0529947
525 Ga0495657_0789941
526 Ga0495615_0022324
527 Ga0496106_0130609
528 Ga0501034_0134134
529 Ga0501067_0004468
530 Ga0501067_0040912
531 Ga0501068_0026009
532 Ga0501069_0518032
533 Ga0501073_0038270
534 Ga0501074_0746328
535 Ga0501076_0151370
536 Ga0501077_0617179
537 Ga0501080_0055628
538 Ga0501080_1096553
539 Ga0501083_0058331
540 nmdc:mga06r32_337790_c1
541 nmdc:mga08y16_29751_c1
542 nmdc:mga0n895_714753_c1
543 nmdc:mga0n895_8264_c1
544 nmdc:mga0rr50_406611_c1
545 nmdc:mga0rr50_47303_c1
546 nmdc:mga08x19_31142_c1
547 nmdc:mga08x19_912819_c1
548 nmdc:mga0a205_1215771_c1
549 nmdc:mga0a205_1231551_c1
550 nmdc:mga0a205_158583_c1
551 nmdc:mga0a205_771841_c1
552 Ga0500651_0017531
553 Ga0500620_076186
554 Ga0501084_0151133
555 Ga0501082_0107207
556 Ga0530510_1133070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

25

78

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lb3-assembly2.cif.gz_H crystal structure of pa4674 in complex with its operator dna (18bp) from pseudomonas aeruginosa 0.9525 8 98
6lb3-assembly2.cif.gz_B crystal structure of pa4674 in complex with its operator dna (18bp) from pseudomonas aeruginosa 0.9507 8 96
6jpi-assembly1.cif.gz_C crystal structure of pa4674 in complex with its operator dna (28bp) from pseudomonas aeruginosa 0.945 8 96
7csy-assembly1.cif.gz_A pseudomonas aeruginosa antitoxin higa with higba promoter 0.9255 8 97
3trb-assembly1.cif.gz_A structure of an addiction module antidote protein of a higa (higa) family from coxiella burnetii 0.9166 6 96
ID Description Score Start End Superfamily
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9618 8 84 1.10.260.40
6chvA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9458 9 84 1.10.260.40
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.927 8 84 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9157 12 64 1.10.260.40
2icpA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9136 11 84 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1F1QWP1-F1-model_v4 deleted 0.9877 1 84
AF-A0A363UMM0-F1-model_v4 Addiction module antidote protein, HigA family 0.9872 6 87 GO:0003677
AF-A0A7K2HQ54-F1-model_v4 HigA family addiction module antidote protein 0.9872 7 87 GO:0003677
AF-A0A4Z0NV02-F1-model_v4 Addiction module antidote protein, HigA family 0.9862 6 82 GO:0003677
AF-A0A6B1CU56-F1-model_v4 HigA family addiction module antidote protein 0.9828 6 98 GO:0003677

Map