F382186

General Info

Members Datasets Scaffolds Average Seq Length
278 174 556 128

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100118715|Ga0070690_1001187153
Length 149
Sequence VTRYTVCLDPRPALADIRIRFGGENMSKVSVRYIVNDVDAAIPFYTEMLGFKVEMHPAPGFASLSLGDLQLLLNRPGAGGAGQAMADKQVPAPGGWNRIQIEVEDLGTTVEKLKRQGAHFRNTIVTGNGGKQILVDDPSGNPVELFQPF

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
88 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
139 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
146 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
169 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
170 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
171 2838061910 Rhizobium phaseoli L15 Isolate Nodule
172 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
173 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
174 8005430974 Rhizobium phaseoli Y20 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 2.52
Rhizoplane 5.04
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 25.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100118715 3300005330 Unclassified 1773
2 JGI25406J46586_10049051 3300003203 Unclassified 1427
3 Ga0065712_10003901 3300005290 Bacteria 3979
4 Ga0065715_10004206 3300005293 Bacteria 6646
5 Ga0065707_10141920 3300005295 Bacteria 1761
6 Ga0070676_10298607 3300005328 Bacteria 1091
7 Ga0070680_100268563 3300005336 Bacteria 1444
8 Ga0070660_100665674 3300005339 Bacteria 872
9 Ga0070689_100072433 3300005340 Bacteria 2693
10 Ga0070689_100652620 3300005340 Unclassified 915
11 Ga0070661_100553263 3300005344 Bacteria 926
12 Ga0070688_101272316 3300005365 Unclassified 593
13 Ga0070659_100115001 3300005366 Bacteria 2174
14 Ga0070709_10928307 3300005434 Unclassified 689
15 Ga0070694_100008044 3300005444 Bacteria 6442
16 Ga0070662_100068035 3300005457 Bacteria 2617
17 Ga0070681_10221286 3300005458 Bacteria 1808
18 Ga0070681_10229883 3300005458 Bacteria 1769
19 Ga0070706_100547871 3300005467 Bacteria 1076
20 Ga0070698_100659903 3300005471 Bacteria 987
21 Ga0070698_101705080 3300005471 Bacteria 582
22 Ga0070679_100037932 3300005530 Bacteria 4789
23 Ga0070697_100166072 3300005536 Unclassified 1866
24 Ga0068853_101526872 3300005539 Unclassified 647
25 Ga0070686_100184727 3300005544 Bacteria 1484
26 Ga0070665_100001449 3300005548 Bacteria 27784
27 Ga0070704_100011071 3300005549 Bacteria 5508
28 Ga0070664_101473918 3300005564 Unclassified 644
29 Ga0068857_101292245 3300005577 Unclassified 708
30 Ga0070702_101273233 3300005615 Unclassified 596
31 Ga0068859_100073704 3300005617 Bacteria 3452
32 Ga0068859_100388161 3300005617 Bacteria 1492
33 Ga0068866_10995271 3300005718 Bacteria 595
34 Ga0068861_101079640 3300005719 Bacteria 770
35 Ga0068858_101235055 3300005842 Bacteria 735
36 Ga0068862_102082244 3300005844 Bacteria 578
37 Ga0081455_10031894 3300005937 Bacteria 4757
38 Ga0081455_10060217 3300005937 Unclassified 3202
39 Ga0081455_10580678 3300005937 Bacteria 735
40 Ga0081538_10154671 3300005981 Bacteria 1031
41 Ga0081539_10017736 3300005985 Bacteria 4980
42 Ga0070716_100533386 3300006173 Bacteria 872
43 Ga0070712_101093447 3300006175 Unclassified 692
44 Ga0075367_10117472 3300006178 Bacteria 1637
45 Ga0075366_10021211 3300006195 Bacteria 3776
46 Ga0075370_10280791 3300006353 Bacteria 989
47 Ga0075428_101805654 3300006844 Unclassified 636
48 Ga0075428_101941992 3300006844 Unclassified 611
49 Ga0075431_100174304 3300006847 Bacteria 2209
50 Ga0075431_100176162 3300006847 Unclassified 2197
51 Ga0075431_100850991 3300006847 Unclassified 883
52 Ga0075433_10243729 3300006852 Bacteria 1595
53 Ga0075433_10266914 3300006852 Bacteria 1517
54 Ga0075433_10342397 3300006852 Unclassified 1322
55 Ga0075433_10513075 3300006852 Unclassified 1055
56 Ga0075434_100029183 3300006871 Bacteria 5424
57 Ga0075429_100457916 3300006880 Unclassified 1118
58 Ga0075429_101051482 3300006880 Unclassified 711
59 Ga0075429_101054313 3300006880 Bacteria 710
60 Ga0075436_100169417 3300006914 Unclassified 1542
61 Ga0097620_100073705 3300006931 Bacteria 3452
62 Ga0097620_100388156 3300006931 Bacteria 1492
63 Ga0075435_100322671 3300007076 Bacteria 1322
64 Ga0111539_10020521 3300009094 Bacteria 8137
65 Ga0114129_10034653 3300009147 Bacteria 7131
66 Ga0114129_10053898 3300009147 Bacteria 5640
67 Ga0114129_10100051 3300009147 Bacteria 4012
68 Ga0114129_10297290 3300009147 Bacteria 2153
69 Ga0114129_10638031 3300009147 Bacteria 1376
70 Ga0114129_11454468 3300009147 Bacteria 844
71 Ga0114129_12647369 3300009147 Bacteria 598
72 Ga0105237_10890258 3300009545 Bacteria 897
73 Ga0105249_11003295 3300009553 Bacteria 904
74 Ga0157379_12315692 3300014968 Unclassified 535
75 Ga0157376_10524009 3300014969 Unclassified 1169
76 Ga0207697_10028600 3300025315 Unclassified 2280
77 Ga0207684_10950486 3300025910 Bacteria 721
78 Ga0207707_10246511 3300025912 Bacteria 1552
79 Ga0207707_10432039 3300025912 Bacteria 1128
80 Ga0207671_10779720 3300025914 Bacteria 759
81 Ga0207693_10741594 3300025915 Unclassified 759
82 Ga0207660_10022457 3300025917 Bacteria 4251
83 Ga0207649_10499820 3300025920 Unclassified 925
84 Ga0207652_11135492 3300025921 Bacteria 682
85 Ga0207700_11158957 3300025928 Bacteria 690
86 Ga0207670_10065314 3300025936 Bacteria 2497
87 Ga0207665_10640261 3300025939 Bacteria 833
88 Ga0207702_11198763 3300026078 Bacteria 753
89 Ga0207674_11246986 3300026116 Unclassified 713
90 Ga0209974_10034859 3300027876 Unclassified 1671
91 Ga0207428_10306161 3300027907 Unclassified 1175
92 Ga0268266_10000984 3300028379 Bacteria 35994
93 Ga0268265_12284175 3300028380 Bacteria 548
94 Ga0307408_100120022 3300031548 Bacteria 2035
95 Ga0307408_100935308 3300031548 Bacteria 795
96 Ga0307408_100996294 3300031548 Unclassified 772
97 Ga0307408_101527698 3300031548 Bacteria 632
98 Ga0307408_102427859 3300031548 Unclassified 509
99 Ga0307405_10243327 3300031731 Bacteria 1334
100 Ga0307405_10345774 3300031731 Bacteria 1145
101 Ga0307405_10362492 3300031731 Bacteria 1122
102 Ga0307405_10866697 3300031731 Bacteria 761
103 Ga0307413_10126516 3300031824 Unclassified 1741
104 Ga0307413_10670809 3300031824 Bacteria 858
105 Ga0307413_10701783 3300031824 Bacteria 840
106 Ga0307410_10040954 3300031852 Bacteria 3052
107 Ga0307410_10110515 3300031852 Bacteria 1988
108 Ga0307410_10817597 3300031852 Bacteria 794
109 Ga0307410_11357028 3300031852 Bacteria 623
110 Ga0307406_10210168 3300031901 Bacteria 1439
111 Ga0307406_10429684 3300031901 Bacteria 1054
112 Ga0307406_11095025 3300031901 Unclassified 688
113 Ga0307406_11153100 3300031901 Unclassified 671
114 Ga0307407_10572655 3300031903 Bacteria 837
115 Ga0307407_10577535 3300031903 Bacteria 834
116 Ga0307407_10883383 3300031903 Unclassified 685
117 Ga0307412_10032327 3300031911 Bacteria 3314
118 Ga0307412_10087320 3300031911 Bacteria 2173
119 Ga0307412_10172368 3300031911 Unclassified 1619
120 Ga0307409_100004339 3300031995 Bacteria 7946
121 Ga0307409_100191824 3300031995 Bacteria 1819
122 Ga0307409_100620883 3300031995 Bacteria 1071
123 Ga0307409_100952740 3300031995 Bacteria 874
124 Ga0307409_100974681 3300031995 Bacteria 865
125 Ga0307409_101425808 3300031995 Bacteria 719
126 Ga0307409_101685929 3300031995 Bacteria 662
127 Ga0307409_101984955 3300031995 Bacteria 611
128 Ga0307416_100044663 3300032002 Bacteria 3481
129 Ga0307416_100065880 3300032002 Bacteria 2979
130 Ga0307416_100076535 3300032002 Plasmid 2805
131 Ga0307416_100179923 3300032002 Bacteria 1980
132 Ga0307416_100254186 3300032002 Bacteria 1713
133 Ga0307416_100276257 3300032002 Bacteria 1653
134 Ga0307416_101033380 3300032002 Bacteria 925
135 Ga0307416_102250387 3300032002 Unclassified 646
136 Ga0307414_10022353 3300032004 Bacteria 3987
137 Ga0307414_10240209 3300032004 Bacteria 1499
138 Ga0307414_10292422 3300032004 Bacteria 1374
139 Ga0307414_10732848 3300032004 Bacteria 897
140 Ga0307414_11102646 3300032004 Bacteria 733
141 Ga0307414_11740804 3300032004 Bacteria 581
142 Ga0307411_10359668 3300032005 Bacteria 1190
143 Ga0307411_10444413 3300032005 Bacteria 1083
144 Ga0307411_11610613 3300032005 Unclassified 599
145 Ga0307415_100038152 3300032126 Bacteria 3164
146 Ga0307415_100394208 3300032126 Bacteria 1180
147 Ga0307415_100590813 3300032126 Bacteria 986
148 Ga0307415_100727779 3300032126 Bacteria 898
149 Ga0307415_101415076 3300032126 Bacteria 662
150 Ga0373960_0147551 3300035121 Bacteria 801
151 Ga0373931_0785583 3300035691 Bacteria 634
152 Ga0395899_0591719 3300037312 Bacteria 708
153 Ga0439441_014737 3300042001 Unclassified 1375
154 Ga0439460_0290030 3300042461 Bacteria 571
155 Ga0451577_0169621 3300042876 Bacteria 1967
156 Ga0451577_0593869 3300042876 Unclassified 1005
157 Ga0451577_1688090 3300042876 Bacteria 557
158 Ga0466963_0051187 3300044694 Bacteria 2737
159 Ga0453684_1285140 3300044712 Bacteria 764
160 Ga0453684_1912542 3300044712 Bacteria 600
161 Ga0451576_0529220 3300045051 Bacteria 1238
162 Ga0451576_1882414 3300045051 Bacteria 617
163 Ga0466967_0017380 3300045976 Bacteria 5709
164 Ga0466967_0082634 3300045976 Bacteria 2903
165 Ga0495641_0022953 3300046461 Bacteria 3111
166 Ga0495664_0709856 3300046477 Unclassified 594
167 Ga0495635_0592997 3300046663 Bacteria 724
168 Ga0495658_0375472 3300046683 Bacteria 905
169 Ga0495624_0189010 3300046690 Bacteria 1253
170 Ga0495600_0308727 3300046809 Bacteria 997
171 Ga0495636_0146545 3300047318 Bacteria 1057
172 Ga0495602_0438336 3300048088 Unclassified 924
173 Ga0495615_0024660 3300048090 Bacteria 1389
174 Ga0496100_1066163 3300048903 Bacteria 636
175 Ga0496102_0030498 3300048905 Bacteria 4827
176 Ga0496104_0081595 3300048907 Unclassified 3084
177 Ga0496104_0224565 3300048907 Bacteria 1790
178 Ga0496105_0890489 3300048908 Unclassified 671
179 Ga0496108_0405704 3300048911 Unclassified 1190
180 Ga0496109_0413979 3300048912 Bacteria 1274
181 Ga0496109_1691567 3300048912 Unclassified 566
182 Ga0496110_0136029 3300048913 Unclassified 2220
183 Ga0496111_0224185 3300048914 Unclassified 1396
184 Ga0496111_1098559 3300048914 Unclassified 567
185 Ga0496113_0188403 3300048916 Unclassified 1637
186 Ga0496115_0094087 3300048918 Bacteria 2451
187 Ga0496115_1301120 3300048918 Bacteria 541
188 Ga0496124_0665533 3300048927 Unclassified 666
189 Ga0501292_072653 3300049515 Unclassified 642
190 Ga0501298_039487 3300049521 Unclassified 953
191 Ga0501031_0571099 3300049568 Bacteria 728
192 Ga0501032_0228715 3300049569 Bacteria 1209
193 Ga0501033_0347449 3300049570 Bacteria 1039
194 Ga0501034_0130129 3300049571 Bacteria 2500
195 Ga0501036_0073966 3300049572 Bacteria 2881
196 Ga0501036_0169237 3300049572 Bacteria 1841
197 Ga0501037_0239681 3300049573 Bacteria 1271
198 Ga0501038_0014665 3300049574 Bacteria 7141
199 Ga0501038_0108210 3300049574 Bacteria 2305
200 Ga0501039_0002295 3300049575 Bacteria 14191
201 Ga0501039_0149477 3300049575 Bacteria 1835
202 Ga0501040_0001166 3300049576 Bacteria 16710
203 Ga0501040_1238374 3300049576 Unclassified 541
204 Ga0501041_0000696 3300049577 Bacteria 17858
205 Ga0501042_0002690 3300049578 Bacteria 10940
206 Ga0501043_0039312 3300049579 Bacteria 3718
207 Ga0501046_0082921 3300049580 Bacteria 2476
208 Ga0501048_0008777 3300049582 Bacteria 7617
209 Ga0501071_0001086 3300049587 Bacteria 15113
210 Ga0501071_0730249 3300049587 Unclassified 763
211 Ga0501072_0000719 3300049588 Bacteria 24044
212 Ga0501072_0279551 3300049588 Bacteria 1328
213 Ga0501073_0180012 3300049589 Bacteria 1463
214 Ga0501074_0028754 3300049590 Bacteria 4027
215 Ga0501074_0197869 3300049590 Bacteria 1432
216 Ga0501075_0002446 3300049591 Bacteria 12369
217 Ga0501076_0001456 3300049592 Bacteria 15907
218 Ga0501077_0000195 3300049593 Bacteria 34941
219 Ga0501216_120856 3300049660 Unclassified 598
220 Ga0501233_008023 3300049668 Bacteria 2027
221 Ga0501239_009432 3300049672 Bacteria 1061
222 Ga0501249_166067 3300049679 Unclassified 563
223 Ga0501079_0003961 3300049741 Bacteria 10941
224 Ga0501080_0006398 3300049742 Bacteria 10570
225 Ga0501080_0144969 3300049742 Bacteria 2195
226 Ga0501080_1211302 3300049742 Bacteria 649
227 Ga0501081_0000417 3300049743 Bacteria 23491
228 Ga0501081_1301927 3300049743 Bacteria 551
229 Ga0501083_0096560 3300049744 Bacteria 1950
230 Ga0501083_0126228 3300049744 Bacteria 1677
231 Ga0501264_023339 3300049761 Unclassified 670
232 Ga0501273_077469 3300049770 Bacteria 548
233 Ga0501035_0100945 3300049822 Bacteria 2533
234 Ga0501044_0178515 3300049823 Bacteria 2091
235 Ga0501045_0003647 3300049824 Bacteria 10587
236 nmdc:mga0k408_47549_c1 3300050493 Bacteria 2480
237 nmdc:mga06z11_36682_c1 3300050494 Bacteria 2421
238 nmdc:mga05p37_13472_c1 3300050507 Bacteria 9799
239 nmdc:mga05p37_365792_c1 3300050507 Bacteria 1694
240 nmdc:mga05p37_423061_c1 3300050507 Unclassified 1550
241 nmdc:mga05p37_491462_c1 3300050507 Bacteria 1411
242 nmdc:mga09592_1338674_c1 3300050508 Bacteria 587
243 nmdc:mga09592_516166_c1 3300050508 Unclassified 1028
244 nmdc:mga09592_898253_c1 3300050508 Unclassified 745
245 nmdc:mga0qj67_353791_c1 3300050509 Bacteria 1187
246 nmdc:mga0qj67_376880_c1 3300050509 Unclassified 1146
247 nmdc:mga0qj67_476778_c1 3300050509 Bacteria 1004
248 nmdc:mga06r32_208573_c1 3300050510 Unclassified 1942
249 nmdc:mga06r32_641834_c1 3300050510 Unclassified 1030
250 nmdc:mga06r32_785598_c1 3300050510 Unclassified 913
251 nmdc:mga08y16_1171814_c1 3300050511 Unclassified 740
252 nmdc:mga08y16_159995_c1 3300050511 Unclassified 2339
253 nmdc:mga0rr50_341124_c1 3300050513 Bacteria 1259
254 nmdc:mga08x19_1213824_c1 3300050514 Unclassified 535
255 nmdc:mga0a205_134866_c1 3300050515 Bacteria 2369
256 nmdc:mga0a205_346227_c1 3300050515 Bacteria 1354
257 nmdc:mga0a205_75494_c1 3300050515 Unclassified 3257
258 nmdc:mga0a205_816196_c1 3300050515 Unclassified 780
259 Ga0495655_0079828 3300053083 Bacteria 933
260 Ga0495619_0273017 3300053085 Bacteria 1171
261 Ga0495619_0792609 3300053085 Unclassified 641
262 Ga0501084_0002197 3300054114 Bacteria 15646
263 Ga0590071_010558 3300059421 Bacteria 2163
264 Ga0590071_024574 3300059421 Bacteria 1428
265 Ga0590074_010672 3300059423 Bacteria 1536
266 Ga0590075_074381 3300059424 Bacteria 879
267 Ga0501082_0038495 3300060353 Bacteria 4126
268 Ga0501082_0091902 3300060353 Bacteria 2621
269 Ga0501082_0509229 3300060353 Bacteria 1052
270 Ga0530510_0005869 3300061734 Bacteria 8508
271 Ga0530510_0601528 3300061734 Unclassified 836
272 2719666003 2718217997 Bacteria 6740740
273 2720492423 2718218199 Bacteria 6740745
274 2724110605 2721755823 Bacteria 6752556
275 2838068320 2838061910 Bacteria 6794874
276 2842315064 2842311132 Bacteria 6616990
277 2842454467 2842447887 Bacteria 6754142
278 8005434998 8005430974 Bacteria 6689030
279 Ga0070690_100118715
280 JGI25406J46586_10049051
281 Ga0065712_10003901
282 Ga0065715_10004206
283 Ga0065707_10141920
284 Ga0070676_10298607
285 Ga0070680_100268563
286 Ga0070660_100665674
287 Ga0070689_100072433
288 Ga0070689_100652620
289 Ga0070661_100553263
290 Ga0070688_101272316
291 Ga0070659_100115001
292 Ga0070709_10928307
293 Ga0070694_100008044
294 Ga0070662_100068035
295 Ga0070681_10221286
296 Ga0070681_10229883
297 Ga0070706_100547871
298 Ga0070698_100659903
299 Ga0070698_101705080
300 Ga0070679_100037932
301 Ga0070697_100166072
302 Ga0068853_101526872
303 Ga0070686_100184727
304 Ga0070665_100001449
305 Ga0070704_100011071
306 Ga0070664_101473918
307 Ga0068857_101292245
308 Ga0070702_101273233
309 Ga0068859_100073704
310 Ga0068859_100388161
311 Ga0068866_10995271
312 Ga0068861_101079640
313 Ga0068858_101235055
314 Ga0068862_102082244
315 Ga0081455_10031894
316 Ga0081455_10060217
317 Ga0081455_10580678
318 Ga0081538_10154671
319 Ga0081539_10017736
320 Ga0070716_100533386
321 Ga0070712_101093447
322 Ga0075367_10117472
323 Ga0075366_10021211
324 Ga0075370_10280791
325 Ga0075428_101805654
326 Ga0075428_101941992
327 Ga0075431_100174304
328 Ga0075431_100176162
329 Ga0075431_100850991
330 Ga0075433_10243729
331 Ga0075433_10266914
332 Ga0075433_10342397
333 Ga0075433_10513075
334 Ga0075434_100029183
335 Ga0075429_100457916
336 Ga0075429_101051482
337 Ga0075429_101054313
338 Ga0075436_100169417
339 Ga0097620_100073705
340 Ga0097620_100388156
341 Ga0075435_100322671
342 Ga0111539_10020521
343 Ga0114129_10034653
344 Ga0114129_10053898
345 Ga0114129_10100051
346 Ga0114129_10297290
347 Ga0114129_10638031
348 Ga0114129_11454468
349 Ga0114129_12647369
350 Ga0105237_10890258
351 Ga0105249_11003295
352 Ga0157379_12315692
353 Ga0157376_10524009
354 Ga0207697_10028600
355 Ga0207684_10950486
356 Ga0207707_10246511
357 Ga0207707_10432039
358 Ga0207671_10779720
359 Ga0207693_10741594
360 Ga0207660_10022457
361 Ga0207649_10499820
362 Ga0207652_11135492
363 Ga0207700_11158957
364 Ga0207670_10065314
365 Ga0207665_10640261
366 Ga0207702_11198763
367 Ga0207674_11246986
368 Ga0209974_10034859
369 Ga0207428_10306161
370 Ga0268266_10000984
371 Ga0268265_12284175
372 Ga0307408_100120022
373 Ga0307408_100935308
374 Ga0307408_100996294
375 Ga0307408_101527698
376 Ga0307408_102427859
377 Ga0307405_10243327
378 Ga0307405_10345774
379 Ga0307405_10362492
380 Ga0307405_10866697
381 Ga0307413_10126516
382 Ga0307413_10670809
383 Ga0307413_10701783
384 Ga0307410_10040954
385 Ga0307410_10110515
386 Ga0307410_10817597
387 Ga0307410_11357028
388 Ga0307406_10210168
389 Ga0307406_10429684
390 Ga0307406_11095025
391 Ga0307406_11153100
392 Ga0307407_10572655
393 Ga0307407_10577535
394 Ga0307407_10883383
395 Ga0307412_10032327
396 Ga0307412_10087320
397 Ga0307412_10172368
398 Ga0307409_100004339
399 Ga0307409_100191824
400 Ga0307409_100620883
401 Ga0307409_100952740
402 Ga0307409_100974681
403 Ga0307409_101425808
404 Ga0307409_101685929
405 Ga0307409_101984955
406 Ga0307416_100044663
407 Ga0307416_100065880
408 Ga0307416_100076535
409 Ga0307416_100179923
410 Ga0307416_100254186
411 Ga0307416_100276257
412 Ga0307416_101033380
413 Ga0307416_102250387
414 Ga0307414_10022353
415 Ga0307414_10240209
416 Ga0307414_10292422
417 Ga0307414_10732848
418 Ga0307414_11102646
419 Ga0307414_11740804
420 Ga0307411_10359668
421 Ga0307411_10444413
422 Ga0307411_11610613
423 Ga0307415_100038152
424 Ga0307415_100394208
425 Ga0307415_100590813
426 Ga0307415_100727779
427 Ga0307415_101415076
428 Ga0373960_0147551
429 Ga0373931_0785583
430 Ga0395899_0591719
431 Ga0439441_014737
432 Ga0439460_0290030
433 Ga0451577_0169621
434 Ga0451577_0593869
435 Ga0451577_1688090
436 Ga0466963_0051187
437 Ga0453684_1285140
438 Ga0453684_1912542
439 Ga0451576_0529220
440 Ga0451576_1882414
441 Ga0466967_0017380
442 Ga0466967_0082634
443 Ga0495641_0022953
444 Ga0495664_0709856
445 Ga0495635_0592997
446 Ga0495658_0375472
447 Ga0495624_0189010
448 Ga0495600_0308727
449 Ga0495636_0146545
450 Ga0495602_0438336
451 Ga0495615_0024660
452 Ga0496100_1066163
453 Ga0496102_0030498
454 Ga0496104_0081595
455 Ga0496104_0224565
456 Ga0496105_0890489
457 Ga0496108_0405704
458 Ga0496109_0413979
459 Ga0496109_1691567
460 Ga0496110_0136029
461 Ga0496111_0224185
462 Ga0496111_1098559
463 Ga0496113_0188403
464 Ga0496115_0094087
465 Ga0496115_1301120
466 Ga0496124_0665533
467 Ga0501292_072653
468 Ga0501298_039487
469 Ga0501031_0571099
470 Ga0501032_0228715
471 Ga0501033_0347449
472 Ga0501034_0130129
473 Ga0501036_0073966
474 Ga0501036_0169237
475 Ga0501037_0239681
476 Ga0501038_0014665
477 Ga0501038_0108210
478 Ga0501039_0002295
479 Ga0501039_0149477
480 Ga0501040_0001166
481 Ga0501040_1238374
482 Ga0501041_0000696
483 Ga0501042_0002690
484 Ga0501043_0039312
485 Ga0501046_0082921
486 Ga0501048_0008777
487 Ga0501071_0001086
488 Ga0501071_0730249
489 Ga0501072_0000719
490 Ga0501072_0279551
491 Ga0501073_0180012
492 Ga0501074_0028754
493 Ga0501074_0197869
494 Ga0501075_0002446
495 Ga0501076_0001456
496 Ga0501077_0000195
497 Ga0501216_120856
498 Ga0501233_008023
499 Ga0501239_009432
500 Ga0501249_166067
501 Ga0501079_0003961
502 Ga0501080_0006398
503 Ga0501080_0144969
504 Ga0501080_1211302
505 Ga0501081_0000417
506 Ga0501081_1301927
507 Ga0501083_0096560
508 Ga0501083_0126228
509 Ga0501264_023339
510 Ga0501273_077469
511 Ga0501035_0100945
512 Ga0501044_0178515
513 Ga0501045_0003647
514 nmdc:mga0k408_47549_c1
515 nmdc:mga06z11_36682_c1
516 nmdc:mga05p37_13472_c1
517 nmdc:mga05p37_365792_c1
518 nmdc:mga05p37_423061_c1
519 nmdc:mga05p37_491462_c1
520 nmdc:mga09592_1338674_c1
521 nmdc:mga09592_516166_c1
522 nmdc:mga09592_898253_c1
523 nmdc:mga0qj67_353791_c1
524 nmdc:mga0qj67_376880_c1
525 nmdc:mga0qj67_476778_c1
526 nmdc:mga06r32_208573_c1
527 nmdc:mga06r32_641834_c1
528 nmdc:mga06r32_785598_c1
529 nmdc:mga08y16_1171814_c1
530 nmdc:mga08y16_159995_c1
531 nmdc:mga0rr50_341124_c1
532 nmdc:mga08x19_1213824_c1
533 nmdc:mga0a205_134866_c1
534 nmdc:mga0a205_346227_c1
535 nmdc:mga0a205_75494_c1
536 nmdc:mga0a205_816196_c1
537 Ga0495655_0079828
538 Ga0495619_0273017
539 Ga0495619_0792609
540 Ga0501084_0002197
541 Ga0590071_010558
542 Ga0590071_024574
543 Ga0590074_010672
544 Ga0590075_074381
545 Ga0501082_0038495
546 Ga0501082_0091902
547 Ga0501082_0509229
548 Ga0530510_0005869
549 Ga0530510_0601528
550 2719666003
551 2720492423
552 2724110605
553 2838068320
554 2842315064
555 2842454467
556 8005434998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

145

0.77

PF18029

Glyoxalase_6

Glyoxalase-like domain

28

146

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8631 11 131
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8514 10 131
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8373 9 131
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8318 11 131
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8313 12 132
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.926 80 128 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8768 80 131 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8614 81 127 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8597 80 127 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8591 80 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A534MV64-F1-model_v4 VOC family protein 0.9907 8 59
AF-A0A0B2AKU2-F1-model_v4 Glyoxalase 0.9859 8 132 GO:0004493
GO:0046491
AF-A0A0E9N2W3-F1-model_v4 VOC domain-containing protein 0.9843 12 132
AF-A0A364Y823-F1-model_v4 VOC family protein 0.9829 8 132
AF-A0A2V5LUB2-F1-model_v4 Glyoxalase 0.9814 8 132

Map