F382013

General Info

Members Datasets Scaffolds Average Seq Length
277 250 219 313

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0087496|Ga0496116_0087496_831_1820
Length 329
Sequence MEGCSLFHHITVLKAEATEGLRIKPDGIYVDCTLGGGGHSSVILSKLSPKGRLIAFDQDDWALNNAKQLLASYTEQLYLIKSNFENLEEKLSELDWVPKRNGIPQVDGILFDLGVSSPQFDEGERGFSYNADAVLDMRMDQGAELTAKHIINEWSESEIARILFQYGEEKFSRRIAKVIVKRREESPINTTGELVELIKEGIPAAARRTGGHPAKRSFQALRIAVNDELGVLEKALHASVRCLAPEGRVSVITFHSLEDRICKQIFASYVEKCTCPPDFPLCVCGASGELKLINRKPLIPSDEEIALNPRARSAKLRVAEKLHLVAEDS

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
4 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
5 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
6 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
7 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
8 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
9 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
10 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
11 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
12 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
13 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
14 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
15 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
16 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
17 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
18 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
19 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
20 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
21 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
22 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
23 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
24 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
25 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
26 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
27 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
28 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
29 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
30 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
31 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
32 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
33 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
34 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
35 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
36 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
37 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
38 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
39 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
40 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
41 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
42 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
43 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
44 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
45 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
46 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
47 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
48 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
49 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
50 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
51 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
52 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
53 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
54 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
248 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
249 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
250 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.06
Metatranscriptomes 0
Isolates 20.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.72
Rhizosphere 80.14
Stem 0
Stem Tuber 0
Unclassified 15.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10013555 3300003187 Bacteria 3664
2 Ga0055541_1000095 3300003841 Bacteria 74451
3 Ga0065715_10018434 3300005293 Bacteria 2408
4 Ga0065707_10000785 3300005295 Bacteria 19949
5 Ga0070676_10001513 3300005328 Bacteria 11761
6 Ga0070683_100041507 3300005329 Bacteria 4233
7 Ga0070690_100004237 3300005330 Bacteria 7939
8 Ga0070670_100179071 3300005331 Bacteria 1840
9 Ga0068869_100002363 3300005334 Bacteria 11363
10 Ga0070666_10011423 3300005335 Bacteria 5572
11 Ga0070680_100007748 3300005336 Bacteria 8186
12 Ga0068868_100059951 3300005338 Bacteria 3011
13 Ga0070660_100003884 3300005339 Bacteria 10327
14 Ga0070691_10002235 3300005341 Bacteria 8560
15 Ga0070687_100004130 3300005343 Bacteria 5741
16 Ga0070661_100001616 3300005344 Bacteria 15591
17 Ga0070661_100100072 3300005344 Bacteria 2155
18 Ga0070692_10004193 3300005345 Bacteria 5978
19 Ga0070668_100021045 3300005347 Bacteria 4929
20 Ga0070669_100001304 3300005353 Bacteria 17993
21 Ga0070675_100016304 3300005354 Bacteria 5894
22 Ga0070674_100000416 3300005356 Bacteria 21452
23 Ga0070673_100035520 3300005364 Bacteria 3780
24 Ga0070688_100104495 3300005365 Bacteria 1873
25 Ga0070659_100033765 3300005366 Bacteria 3976
26 Ga0070667_100007693 3300005367 Bacteria 8934
27 Ga0070711_100060879 3300005439 Bacteria 2626
28 Ga0070694_100002612 3300005444 Bacteria 10649
29 Ga0070663_100125535 3300005455 Bacteria 1944
30 Ga0070681_10018585 3300005458 Bacteria 6950
31 Ga0068867_100001801 3300005459 Bacteria 14908
32 Ga0070685_10205368 3300005466 Bacteria 1283
33 Ga0070707_100068049 3300005468 Bacteria 3426
34 Ga0070698_100309445 3300005471 Bacteria 1510
35 Ga0070679_100049895 3300005530 Bacteria 4168
36 Ga0070684_100280685 3300005535 Bacteria 1526
37 Ga0070672_100001793 3300005543 Bacteria 13435
38 Ga0070672_100081992 3300005543 Bacteria 2587
39 Ga0070686_100038596 3300005544 Bacteria 2969
40 Ga0070695_100006717 3300005545 Bacteria 6807
41 Ga0070665_100190658 3300005548 Bacteria 2051
42 Ga0070664_100001149 3300005564 Bacteria 20973
43 Ga0070664_100003306 3300005564 Bacteria 13026
44 Ga0068854_100041819 3300005578 Bacteria 3240
45 Ga0070702_100001235 3300005615 Bacteria 10353
46 Ga0068852_100199185 3300005616 Bacteria 1894
47 Ga0068864_100040282 3300005618 Bacteria 3997
48 Ga0068861_100425887 3300005719 Bacteria 1184
49 Ga0068870_10003287 3300005840 Bacteria 6829
50 Ga0068860_100217058 3300005843 Bacteria 1856
51 Ga0068862_100027245 3300005844 Bacteria 4809
52 Ga0081455_10003131 3300005937 Bacteria 19255
53 Ga0097621_100045489 3300006237 Bacteria 3546
54 Ga0068871_100004792 3300006358 Bacteria 9458
55 Ga0075431_100010928 3300006847 Bacteria 9133
56 Ga0075433_10019570 3300006852 Bacteria 5643
57 Ga0075429_100031010 3300006880 Bacteria 4646
58 Ga0068865_100000516 3300006881 Bacteria 21585
59 Ga0075436_100064434 3300006914 Bacteria 2533
60 Ga0105244_10007587 3300009036 Bacteria 6877
61 Ga0105240_10035294 3300009093 Bacteria 6445
62 Ga0111539_10232021 3300009094 Bacteria 2149
63 Ga0105245_10003582 3300009098 Bacteria 13863
64 Ga0114129_10106210 3300009147 Bacteria 3879
65 Ga0105243_10003345 3300009148 Bacteria 13008
66 Ga0105241_10265606 3300009174 Bacteria 1460
67 Ga0105242_10002043 3300009176 Bacteria 15905
68 Ga0105237_10344402 3300009545 Bacteria 1495
69 Ga0105238_10100504 3300009551 Bacteria 2875
70 Ga0105249_10011977 3300009553 Bacteria 7628
71 Ga0105239_10028695 3300010375 Bacteria 6119
72 Ga0105239_10065931 3300010375 Unclassified 3978
73 Ga0105246_10003699 3300011119 Bacteria 9255
74 Ga0157371_10001288 3300013102 Bacteria 26430
75 Ga0157371_10086692 3300013102 Bacteria 2217
76 Ga0157371_10321131 3300013102 Bacteria 1124
77 Ga0157374_10014693 3300013296 Bacteria 6855
78 Ga0157374_10109972 3300013296 Bacteria 2650
79 Ga0157378_10002668 3300013297 Bacteria 15883
80 Ga0157378_10225284 3300013297 Bacteria 1784
81 Ga0163162_10070751 3300013306 Bacteria 3540
82 Ga0157372_10746891 3300013307 Bacteria 1138
83 Ga0157376_10001946 3300014969 Bacteria 13802
84 Ga0209784_100135 3300025224 Bacteria 70506
85 Ga0209566_100058 3300025225 Bacteria 201317
86 Ga0209437_100743 3300025233 Bacteria 16153
87 Ga0209676_1039008 3300025292 Bacteria 1354
88 Ga0209025_1034081 3300025294 Bacteria 2335
89 Ga0207680_10179966 3300025903 Bacteria 1429
90 Ga0207645_10000808 3300025907 Bacteria 26186
91 Ga0207707_10023762 3300025912 Bacteria 5360
92 Ga0207662_10032577 3300025918 Bacteria 3035
93 Ga0207657_10002541 3300025919 Bacteria 19730
94 Ga0207649_10005602 3300025920 Bacteria 6791
95 Ga0207652_10015003 3300025921 Bacteria 6285
96 Ga0207646_10067501 3300025922 Bacteria 3193
97 Ga0207659_10016002 3300025926 Bacteria 4874
98 Ga0207687_10004974 3300025927 Bacteria 8812
99 Ga0207690_10218410 3300025932 Bacteria 1457
100 Ga0207706_10001096 3300025933 Bacteria 27537
101 Ga0207686_10004095 3300025934 Bacteria 7821
102 Ga0207670_10005545 3300025936 Bacteria 6936
103 Ga0207704_10002944 3300025938 Bacteria 7689
104 Ga0207691_10001064 3300025940 Bacteria 27290
105 Ga0207691_10066912 3300025940 Bacteria 3250
106 Ga0207689_10001346 3300025942 Bacteria 23649
107 Ga0207679_10006533 3300025945 Bacteria 7370
108 Ga0207679_10051860 3300025945 Bacteria 3006
109 Ga0207651_10010707 3300025960 Bacteria 5095
110 Ga0207651_10025504 3300025960 Bacteria 3675
111 Ga0207668_10013072 3300025972 Bacteria 5101
112 Ga0207640_10213395 3300025981 Bacteria 1472
113 Ga0207658_10312190 3300025986 Bacteria 1358
114 Ga0207677_10033893 3300026023 Bacteria 3300
115 Ga0207678_10201896 3300026067 Bacteria 1700
116 Ga0207708_10000051 3300026075 Bacteria 108519
117 Ga0207648_10000101 3300026089 Bacteria 82654
118 Ga0207676_10342818 3300026095 Bacteria 1379
119 Ga0207675_100342771 3300026118 Bacteria 1463
120 Ga0207683_10000229 3300026121 Bacteria 49529
121 Ga0207698_10207895 3300026142 Bacteria 1758
122 Ga0209973_1004369 3300027252 Bacteria 1449
123 Ga0209969_1000130 3300027360 Bacteria 9692
124 Ga0209967_1000043 3300027364 Bacteria 16255
125 Ga0209981_1000074 3300027378 Bacteria 10839
126 Ga0209996_1000042 3300027395 Bacteria 18590
127 Ga0209984_1000052 3300027424 Bacteria 12095
128 Ga0210000_1000039 3300027462 Bacteria 19582
129 Ga0209995_1000154 3300027471 Bacteria 11047
130 Ga0209968_1000027 3300027526 Bacteria 28287
131 Ga0209999_1000034 3300027543 Bacteria 14819
132 Ga0210002_1000137 3300027617 Bacteria 11250
133 Ga0209983_1000188 3300027665 Bacteria 12020
134 Ga0209971_1000154 3300027682 Bacteria 20300
135 Ga0209966_1000016 3300027695 Bacteria 73256
136 Ga0209998_10000021 3300027717 Bacteria 70520
137 Ga0209974_10000003 3300027876 Bacteria 65938
138 Ga0207428_10003604 3300027907 Bacteria 14954
139 Ga0268266_10147207 3300028379 Bacteria 2119
140 Ga0268265_10016490 3300028380 Bacteria 5077
141 Ga0268264_10120310 3300028381 Bacteria 2313
142 Ga0316579_10094884 3300031691 Bacteria 1426
143 Ga0316579_10108331 3300031691 Bacteria 1333
144 Ga0316576_10005299 3300031727 Bacteria 7854
145 Ga0316576_10030940 3300031727 Bacteria 3794
146 Ga0316578_10023830 3300031728 Bacteria 3429
147 Ga0316574_0023317 3300035398 Bacteria 3695
148 Ga0316582_0085138 3300036647 Bacteria 2071
149 Ga0316584_0041884 3300036712 Bacteria 3414
150 Ga0316584_0050445 3300036712 Bacteria 3111
151 Ga0395901_0582965 3300038443 Bacteria 1130
152 Ga0439449_0005984 3300042007 Bacteria 4647
153 Ga0439462_0003455 3300042015 Bacteria 3791
154 Ga0450901_003388 3300042533 Bacteria 1667
155 Ga0451577_0000075 3300042876 Bacteria 229905
156 Ga0453683_0115579 3300044673 Bacteria 1688
157 Ga0466961_0024696 3300044693 Bacteria 3866
158 Ga0453684_0000033 3300044712 Bacteria 734012
159 Ga0466968_0004472 3300044735 Bacteria 5228
160 Ga0466959_0076252 3300045049 Bacteria 2421
161 Ga0451576_0003322 3300045051 Bacteria 22294
162 Ga0495659_0066390 3300046664 Unclassified 1344
163 Ga0495660_0023950 3300046810 Bacteria 3479
164 Ga0496106_0204276 3300048909 Bacteria 1573
165 Ga0496116_0054687 3300048919 Bacteria 2627
166 Ga0496116_0087496 3300048919 Bacteria 1906
167 Ga0496116_0096617 3300048919 Bacteria 1779
168 Ga0496116_0099140 3300048919 Bacteria 1746
169 Ga0496117_0000040 3300048920 Bacteria 318616
170 Ga0496117_0018212 3300048920 Bacteria 5832
171 Ga0496117_0044193 3300048920 Bacteria 3229
172 Ga0496117_0198470 3300048920 Bacteria 1136
173 Ga0496119_0002002 3300048922 Bacteria 23093
174 Ga0496119_0065749 3300048922 Bacteria 2146
175 Ga0496119_0080046 3300048922 Bacteria 1885
176 Ga0496120_0000215 3300048923 Bacteria 99455
177 Ga0496120_0020927 3300048923 Bacteria 4143
178 Ga0496121_0223067 3300048924 Bacteria 1326
179 Ga0496122_0001699 3300048925 Bacteria 34129
180 Ga0496122_0003724 3300048925 Bacteria 19679
181 Ga0496122_0018522 3300048925 Bacteria 6427
182 Ga0496122_0058499 3300048925 Bacteria 2853
183 Ga0496123_0013934 3300048926 Bacteria 6699
184 Ga0496124_0001252 3300048927 Bacteria 38851
185 Ga0496125_0004166 3300048928 Bacteria 16856
186 Ga0496126_0002983 3300048929 Bacteria 21977
187 Ga0496126_0239742 3300048929 Bacteria 1515
188 Ga0501031_0089676 3300049568 Bacteria 2005
189 Ga0501033_0002037 3300049570 Bacteria 17571
190 Ga0501036_0181930 3300049572 Bacteria 1769
191 Ga0501039_0108052 3300049575 Unclassified 2174
192 Ga0501042_0052878 3300049578 Unclassified 2897
193 Ga0501048_0048429 3300049582 Bacteria 3031
194 Ga0501067_0267123 3300049583 Bacteria 952
195 Ga0501068_0032252 3300049584 Bacteria 3115
196 Ga0501069_0145201 3300049585 Bacteria 1362
197 Ga0501072_0013356 3300049588 Bacteria 6286
198 Ga0501073_0066830 3300049589 Unclassified 2506
199 Ga0501074_0055452 3300049590 Bacteria 2856
200 Ga0501075_0009877 3300049591 Bacteria 6687
201 Ga0501076_0047551 3300049592 Unclassified 3392
202 Ga0501077_0087729 3300049593 Unclassified 1971
203 Ga0501080_0038419 3300049742 Bacteria 4469
204 Ga0501035_0228532 3300049822 Bacteria 1586
205 Ga0501045_0114799 3300049824 Unclassified 1997
206 nmdc:mga05p37_67360_c1 3300050507 Bacteria 4405
207 nmdc:mga09592_16010_c1 3300050508 Bacteria 6129
208 nmdc:mga0qj67_8497_c1 3300050509 Bacteria 7621
209 nmdc:mga06r32_10889_c1 3300050510 Bacteria 8190
210 nmdc:mga08y16_22535_c1 3300050511 Bacteria 6650
211 nmdc:mga0n895_99282_c1 3300050512 Bacteria 2920
212 nmdc:mga0rr50_50620_c1 3300050513 Bacteria 3079
213 nmdc:mga0a205_76504_c1 3300050515 Bacteria 3235
214 Ga0500555_032839 3300053103 Bacteria 1465
215 Ga0500637_0006213 3300053178 Bacteria 5863
216 Ga0501084_0266100 3300054114 Bacteria 1447
217 Ga0590075_030711 3300059424 Bacteria 1360
218 Ga0501082_0133343 3300060353 Unclassified 2155
219 Ga0530510_0053334 3300061734 Unclassified 2922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0267123 Ga0501067_0267123_99_926 274
2 3300005468 Ga0070707_100068049 Ga0070707_1000680492 283
3 3300005471 Ga0070698_100309445 Ga0070698_1003094452 284
4 3300025922 Ga0207646_10067501 Ga0207646_100675013 284
5 3300048922 Ga0496119_0065749 Ga0496119_0065749_1254_2132 286
6 3300048925 Ga0496122_0058499 Ga0496122_0058499_1324_2202 286
7 3300049568 Ga0501031_0089676 Ga0501031_0089676_25_894 288
8 3300049572 Ga0501036_0181930 Ga0501036_0181930_499_1383 293
9 3300049575 Ga0501039_0108052 Ga0501039_0108052_388_1272 293
10 3300049578 Ga0501042_0052878 Ga0501042_0052878_1077_1961 293
11 3300049582 Ga0501048_0048429 Ga0501048_0048429_570_1454 293
12 3300049585 Ga0501069_0145201 Ga0501069_0145201_387_1271 293
13 3300049589 Ga0501073_0066830 Ga0501073_0066830_1523_2407 293
14 3300049590 Ga0501074_0055452 Ga0501074_0055452_1762_2646 293
15 3300049591 Ga0501075_0009877 Ga0501075_0009877_634_1518 293
16 3300049592 Ga0501076_0047551 Ga0501076_0047551_1977_2861 293
17 3300049593 Ga0501077_0087729 Ga0501077_0087729_920_1804 293
18 3300049742 Ga0501080_0038419 Ga0501080_0038419_2284_3168 293
19 3300049822 Ga0501035_0228532 Ga0501035_0228532_161_1045 293
20 3300049824 Ga0501045_0114799 Ga0501045_0114799_78_962 293
21 3300054114 Ga0501084_0266100 Ga0501084_0266100_291_1175 293
22 3300060353 Ga0501082_0133343 Ga0501082_0133343_831_1715 293
23 3300061734 Ga0530510_0053334 Ga0530510_0053334_434_1318 293
24 3300009093 Ga0105240_10035294 Ga0105240_100352943 295
25 3300009094 Ga0111539_10232021 Ga0111539_102320213 295
26 3300009098 Ga0105245_10003582 Ga0105245_100035827 295
27 3300009147 Ga0114129_10106210 Ga0114129_101062102 295
28 3300009148 Ga0105243_10003345 Ga0105243_100033454 295
29 3300009174 Ga0105241_10265606 Ga0105241_102656062 295
30 3300009176 Ga0105242_10002043 Ga0105242_100020438 295
31 3300009551 Ga0105238_10100504 Ga0105238_101005042 295
32 3300009553 Ga0105249_10011977 Ga0105249_100119776 295
33 3300010375 Ga0105239_10028695 Ga0105239_100286951 295
34 3300011119 Ga0105246_10003699 Ga0105246_100036994 295
35 3300013102 Ga0157371_10086692 Ga0157371_100866922 295
36 3300013297 Ga0157378_10002668 Ga0157378_100026688 295
37 3300013306 Ga0163162_10070751 Ga0163162_100707512 295
38 3300014969 Ga0157376_10001946 Ga0157376_100019467 295
39 3300044673 Ga0453683_0115579 Ga0453683_0115579_313_1203 295
40 3300045051 Ga0451576_0003322 Ga0451576_0003322_9897_10787 295
41 3300046664 Ga0495659_0066390 Ga0495659_0066390_330_1220 295
42 3300048909 Ga0496106_0204276 Ga0496106_0204276_347_1237 295
43 3300048919 Ga0496116_0096617 Ga0496116_0096617_462_1412 295
44 3300048920 Ga0496117_0198470 Ga0496117_0198470_88_1038 295
45 3300049588 Ga0501072_0013356 Ga0501072_0013356_542_1432 295
46 3300050507 nmdc:mga05p37_67360_c1 nmdc:mga05p37_67360_c1_801_1691 295
47 3300050508 nmdc:mga09592_16010_c1 nmdc:mga09592_16010_c1_112_1002 295
48 3300050509 nmdc:mga0qj67_8497_c1 nmdc:mga0qj67_8497_c1_1737_2627 295
49 3300050510 nmdc:mga06r32_10889_c1 nmdc:mga06r32_10889_c1_2856_3746 295
50 3300050511 nmdc:mga08y16_22535_c1 nmdc:mga08y16_22535_c1_5649_6539 295
51 3300050512 nmdc:mga0n895_99282_c1 nmdc:mga0n895_99282_c1_149_1039 295
52 3300050513 nmdc:mga0rr50_50620_c1 nmdc:mga0rr50_50620_c1_873_1763 295
53 3300050515 nmdc:mga0a205_76504_c1 nmdc:mga0a205_76504_c1_834_1724 295
54 3300009545 Ga0105237_10344402 Ga0105237_103444021 296
55 3300048920 Ga0496117_0000040 Ga0496117_0000040_124841_125737 296
56 3300042876 Ga0451577_0000075 Ga0451577_0000075_187558_188466 297
57 3300044712 Ga0453684_0000033 Ga0453684_0000033_89024_89932 297
58 3300005293 Ga0065715_10018434 Ga0065715_100184343 302
59 3300005295 Ga0065707_10000785 Ga0065707_1000078510 302
60 3300005328 Ga0070676_10001513 Ga0070676_100015134 302
61 3300005329 Ga0070683_100041507 Ga0070683_1000415073 302
62 3300005330 Ga0070690_100004237 Ga0070690_1000042376 302
63 3300005331 Ga0070670_100179071 Ga0070670_1001790712 302
64 3300005334 Ga0068869_100002363 Ga0068869_1000023633 302
65 3300005335 Ga0070666_10011423 Ga0070666_100114232 302
66 3300005336 Ga0070680_100007748 Ga0070680_1000077485 302
67 3300005338 Ga0068868_100059951 Ga0068868_1000599513 302
68 3300005339 Ga0070660_100003884 Ga0070660_1000038844 302
69 3300005341 Ga0070691_10002235 Ga0070691_100022355 302
70 3300005343 Ga0070687_100004130 Ga0070687_1000041304 302
71 3300005344 Ga0070661_100001616 Ga0070661_10000161610 302
72 3300005344 Ga0070661_100100072 Ga0070661_1001000722 302
73 3300005345 Ga0070692_10004193 Ga0070692_100041935 302
74 3300005347 Ga0070668_100021045 Ga0070668_1000210454 302
75 3300005353 Ga0070669_100001304 Ga0070669_10000130416 302
76 3300005354 Ga0070675_100016304 Ga0070675_1000163045 302
77 3300005356 Ga0070674_100000416 Ga0070674_10000041615 302
78 3300005364 Ga0070673_100035520 Ga0070673_1000355202 302
79 3300005365 Ga0070688_100104495 Ga0070688_1001044952 302
80 3300005366 Ga0070659_100033765 Ga0070659_1000337654 302
81 3300005367 Ga0070667_100007693 Ga0070667_1000076932 302
82 3300005439 Ga0070711_100060879 Ga0070711_1000608792 302
83 3300005444 Ga0070694_100002612 Ga0070694_1000026126 302
84 3300005455 Ga0070663_100125535 Ga0070663_1001255352 302
85 3300005458 Ga0070681_10018585 Ga0070681_100185853 302
86 3300005459 Ga0068867_100001801 Ga0068867_1000018016 302
87 3300005466 Ga0070685_10205368 Ga0070685_102053681 302
88 3300005530 Ga0070679_100049895 Ga0070679_1000498952 302
89 3300005535 Ga0070684_100280685 Ga0070684_1002806853 302
90 3300005543 Ga0070672_100001793 Ga0070672_1000017936 302
91 3300005543 Ga0070672_100081992 Ga0070672_1000819922 302
92 3300005544 Ga0070686_100038596 Ga0070686_1000385962 302
93 3300005545 Ga0070695_100006717 Ga0070695_1000067174 302
94 3300005548 Ga0070665_100190658 Ga0070665_1001906582 302
95 3300005564 Ga0070664_100001149 Ga0070664_10000114920 302
96 3300005564 Ga0070664_100003306 Ga0070664_1000033069 302
97 3300005578 Ga0068854_100041819 Ga0068854_1000418192 302
98 3300005615 Ga0070702_100001235 Ga0070702_1000012353 302
99 3300005616 Ga0068852_100199185 Ga0068852_1001991852 302
100 3300005618 Ga0068864_100040282 Ga0068864_1000402822 302
101 3300005719 Ga0068861_100425887 Ga0068861_1004258872 302
102 3300005840 Ga0068870_10003287 Ga0068870_100032873 302
103 3300005843 Ga0068860_100217058 Ga0068860_1002170582 302
104 3300005844 Ga0068862_100027245 Ga0068862_1000272453 302
105 3300006237 Ga0097621_100045489 Ga0097621_1000454893 302
106 3300006358 Ga0068871_100004792 Ga0068871_1000047923 302
107 3300006847 Ga0075431_100010928 Ga0075431_1000109282 302
108 3300006852 Ga0075433_10019570 Ga0075433_100195702 302
109 3300006880 Ga0075429_100031010 Ga0075429_1000310101 302
110 3300006881 Ga0068865_100000516 Ga0068865_1000005165 302
111 3300006914 Ga0075436_100064434 Ga0075436_1000644342 302
112 3300013296 Ga0157374_10014693 Ga0157374_100146934 302
113 3300013297 Ga0157378_10225284 Ga0157378_102252841 302
114 3300013307 Ga0157372_10746891 Ga0157372_107468912 302
115 3300025903 Ga0207680_10179966 Ga0207680_101799662 302
116 3300025907 Ga0207645_10000808 Ga0207645_1000080817 302
117 3300025912 Ga0207707_10023762 Ga0207707_100237625 302
118 3300025918 Ga0207662_10032577 Ga0207662_100325772 302
119 3300025919 Ga0207657_10002541 Ga0207657_1000254111 302
120 3300025920 Ga0207649_10005602 Ga0207649_100056024 302
121 3300025921 Ga0207652_10015003 Ga0207652_100150032 302
122 3300025926 Ga0207659_10016002 Ga0207659_100160022 302
123 3300025927 Ga0207687_10004974 Ga0207687_1000497410 302
124 3300025932 Ga0207690_10218410 Ga0207690_102184102 302
125 3300025933 Ga0207706_10001096 Ga0207706_1000109610 302
126 3300025934 Ga0207686_10004095 Ga0207686_100040955 302
127 3300025936 Ga0207670_10005545 Ga0207670_100055454 302
128 3300025938 Ga0207704_10002944 Ga0207704_100029445 302
129 3300025940 Ga0207691_10001064 Ga0207691_1000106420 302
130 3300025940 Ga0207691_10066912 Ga0207691_100669123 302
131 3300025942 Ga0207689_10001346 Ga0207689_1000134610 302
132 3300025945 Ga0207679_10006533 Ga0207679_100065333 302
133 3300025945 Ga0207679_10051860 Ga0207679_100518603 302
134 3300025960 Ga0207651_10010707 Ga0207651_100107072 302
135 3300025960 Ga0207651_10025504 Ga0207651_100255042 302
136 3300025972 Ga0207668_10013072 Ga0207668_100130724 302
137 3300025981 Ga0207640_10213395 Ga0207640_102133952 302
138 3300025986 Ga0207658_10312190 Ga0207658_103121902 302
139 3300026023 Ga0207677_10033893 Ga0207677_100338933 302
140 3300026067 Ga0207678_10201896 Ga0207678_102018963 302
141 3300026075 Ga0207708_10000051 Ga0207708_1000005194 302
142 3300026089 Ga0207648_10000101 Ga0207648_1000010170 302
143 3300026095 Ga0207676_10342818 Ga0207676_103428182 302
144 3300026118 Ga0207675_100342771 Ga0207675_1003427712 302
145 3300026121 Ga0207683_10000229 Ga0207683_1000022934 302
146 3300026142 Ga0207698_10207895 Ga0207698_102078953 302
147 3300027252 Ga0209973_1004369 Ga0209973_10043691 302
148 3300027360 Ga0209969_1000130 Ga0209969_10001306 302
149 3300027364 Ga0209967_1000043 Ga0209967_10000438 302
150 3300027378 Ga0209981_1000074 Ga0209981_10000743 302
151 3300027395 Ga0209996_1000042 Ga0209996_10000426 302
152 3300027424 Ga0209984_1000052 Ga0209984_10000524 302
153 3300027462 Ga0210000_1000039 Ga0210000_100003910 302
154 3300027471 Ga0209995_1000154 Ga0209995_10001548 302
155 3300027526 Ga0209968_1000027 Ga0209968_100002720 302
156 3300027543 Ga0209999_1000034 Ga0209999_100003411 302
157 3300027617 Ga0210002_1000137 Ga0210002_10001376 302
158 3300027665 Ga0209983_1000188 Ga0209983_10001886 302
159 3300027682 Ga0209971_1000154 Ga0209971_100015418 302
160 3300027695 Ga0209966_1000016 Ga0209966_100001661 302
161 3300027717 Ga0209998_10000021 Ga0209998_1000002123 302
162 3300027876 Ga0209974_10000003 Ga0209974_100000034 302
163 3300027907 Ga0207428_10003604 Ga0207428_100036046 302
164 3300028379 Ga0268266_10147207 Ga0268266_101472073 302
165 3300028380 Ga0268265_10016490 Ga0268265_100164904 302
166 3300028381 Ga0268264_10120310 Ga0268264_101203102 302
167 3300049584 Ga0501068_0032252 Ga0501068_0032252_1545_2504 302
168 3300059424 Ga0590075_030711 Ga0590075_030711_242_1201 302
169 iso_pu_bacteria 2600255229 2601445436 302
170 3300049570 Ga0501033_0002037 Ga0501033_0002037_5188_6102 303
171 3300042533 Ga0450901_003388 Ga0450901_003388_265_1182 304
172 iso_pu_bacteria 2865002811 2865003459 304
173 iso_pu_bacteria 2888578766 2888580935 304
174 iso_pu_bacteria 2889049205 2889050383 304
175 iso_pu_bacteria 8057977335 8057979117 304
176 3300048922 Ga0496119_0080046 Ga0496119_0080046_716_1669 305
177 3300053178 Ga0500637_0006213 Ga0500637_0006213_3213_4160 305
178 iso_pu_bacteria 2524023129 2524186579 306
179 iso_pu_bacteria 2548877040 2550906257 306
180 iso_pu_bacteria 2563366752 2563926975 306
181 iso_pu_bacteria 2571042143 2571532824 306
182 iso_pu_bacteria 2571042588 2573039734 306
183 iso_pu_bacteria 2576861424 2578338013 306
184 iso_pu_bacteria 2579778775 2580935429 306
185 iso_pu_bacteria 2600255286 2601639119 306
186 iso_pu_bacteria 2619619294 2621276389 306
187 iso_pu_bacteria 2643221543 2643738011 306
188 iso_pu_bacteria 2643221676 2644423101 306
189 iso_pu_bacteria 2728368933 2728534230 306
190 iso_pu_bacteria 2728369359 2730135631 306
191 iso_pu_bacteria 2751185905 2753810967 306
192 iso_pu_bacteria 2802428803 2802437301 306
193 iso_pu_bacteria 2821111986 2821114693 306
194 iso_pu_bacteria 2864733723 2864735367 306
195 iso_pu_bacteria 2881636855 2881640938 306
196 iso_pu_bacteria 2885526491 2885527949 306
197 iso_pu_bacteria 2889042446 2889046851 306
198 iso_pu_bacteria 2889276214 2889280900 306
199 iso_pu_bacteria 2904162308 2904163175 306
200 iso_pu_bacteria 2904490793 2904493757 306
201 iso_pu_bacteria 2904595352 2904598321 306
202 iso_pu_bacteria 2907202186 2907205789 306
203 iso_pu_bacteria 2919160200 2919162837 306
204 iso_pu_bacteria 2931384279 2931390299 306
205 iso_pu_bacteria 2938649242 2938650204 306
206 iso_pu_bacteria 2939679117 2939679682 306
207 iso_pu_bacteria 2939702853 2939704646 306
208 iso_pu_bacteria 2945991243 2945997476 306
209 iso_pu_bacteria 2946053406 2946053688 306
210 iso_pu_bacteria 2968558590 2968564063 306
211 iso_pu_bacteria 2971403814 2971407258 306
212 iso_pu_bacteria 2971511577 2971512613 306
213 iso_pu_bacteria 2980176882 2980177676 306
214 iso_pu_bacteria 2988225383 2988228609 306
215 iso_pu_bacteria 2996632988 2996635991 306
216 iso_pu_bacteria 2996706504 2996709708 306
217 iso_pu_bacteria 648028048 648171055 306
218 iso_pu_bacteria 8054465665 8054470218 306
219 iso_pu_bacteria 8057733483 8057737611 307
220 3300038443 Ga0395901_0582965 Ga0395901_0582965_10_966 308
221 3300042007 Ga0439449_0005984 Ga0439449_0005984_2535_3467 308
222 3300042015 Ga0439462_0003455 Ga0439462_0003455_1196_2128 308
223 iso_pu_bacteria 2925326138 2925326888 308
224 iso_pu_bacteria 2980125574 2980125812 308
225 3300003841 Ga0055541_1000095 Ga0055541_100009567 309
226 3300013296 Ga0157374_10109972 Ga0157374_101099722 309
227 3300025225 Ga0209566_100058 Ga0209566_100058114 309
228 3300025292 Ga0209676_1039008 Ga0209676_10390081 309
229 3300025294 Ga0209025_1034081 Ga0209025_10340811 309
230 3300053103 Ga0500555_032839 Ga0500555_032839_444_1403 309
231 iso_pu_bacteria 2512564039 2512734965 309
232 3300009036 Ga0105244_10007587 Ga0105244_100075875 310
233 3300025224 Ga0209784_100135 Ga0209784_10013544 310
234 3300025233 Ga0209437_100743 Ga0209437_1007433 310
235 3300031691 Ga0316579_10094884 Ga0316579_100948842 310
236 3300031691 Ga0316579_10108331 Ga0316579_101083311 310
237 3300031727 Ga0316576_10030940 Ga0316576_100309402 310
238 3300035398 Ga0316574_0023317 Ga0316574_0023317_579_1547 310
239 3300036712 Ga0316584_0041884 Ga0316584_0041884_855_1823 310
240 3300046810 Ga0495660_0023950 Ga0495660_0023950_1087_2040 310
241 3300048919 Ga0496116_0054687 Ga0496116_0054687_1338_2288 310
242 3300048919 Ga0496116_0099140 Ga0496116_0099140_485_1438 310
243 3300048920 Ga0496117_0044193 Ga0496117_0044193_1614_2564 310
244 3300048923 Ga0496120_0020927 Ga0496120_0020927_1940_2890 310
245 3300048924 Ga0496121_0223067 Ga0496121_0223067_343_1293 310
246 3300048925 Ga0496122_0003724 Ga0496122_0003724_425_1375 310
247 3300048926 Ga0496123_0013934 Ga0496123_0013934_1567_2517 310
248 3300048927 Ga0496124_0001252 Ga0496124_0001252_24492_25448 310
249 3300048928 Ga0496125_0004166 Ga0496125_0004166_3149_4099 310
250 iso_pu_bacteria 2939615513 2939616723 310
251 3300005937 Ga0081455_10003131 Ga0081455_100031317 311
252 3300031727 Ga0316576_10005299 Ga0316576_100052994 311
253 3300031728 Ga0316578_10023830 Ga0316578_100238302 311
254 3300036647 Ga0316582_0085138 Ga0316582_0085138_569_1543 311
255 3300036712 Ga0316584_0050445 Ga0316584_0050445_499_1473 311
256 3300048925 Ga0496122_0018522 Ga0496122_0018522_1921_2877 311
257 iso_pu_bacteria 2554235469 2556063250 311
258 iso_pu_bacteria 2711768088 2712199506 311
259 iso_pu_bacteria 2984527788 2984530349 311
260 iso_pu_bacteria 2984532647 2984536457 311
261 iso_pu_bacteria 2788500588 2791212205 312
262 iso_pu_bacteria 2881633906 2881635661 312
263 iso_pu_bacteria 2904606771 2904608289 312
264 3300010375 Ga0105239_10065931 Ga0105239_100659315 314
265 3300048925 Ga0496122_0001699 Ga0496122_0001699_26763_27725 314
266 3300044693 Ga0466961_0024696 Ga0466961_0024696_2398_3369 315
267 3300044735 Ga0466968_0004472 Ga0466968_0004472_1710_2681 315
268 3300045049 Ga0466959_0076252 Ga0466959_0076252_914_1885 315
269 3300003187 JGI25151J46595_10013555 JGI25151J46595_100135553 316
270 3300013102 Ga0157371_10001288 Ga0157371_1000128819 316
271 3300013102 Ga0157371_10321131 Ga0157371_103211312 316
272 3300048919 Ga0496116_0087496 Ga0496116_0087496_831_1820 316
273 3300048920 Ga0496117_0018212 Ga0496117_0018212_1560_2549 316
274 3300048922 Ga0496119_0002002 Ga0496119_0002002_961_1950 316
275 3300048923 Ga0496120_0000215 Ga0496120_0000215_74381_75370 316
276 3300048929 Ga0496126_0002983 Ga0496126_0002983_20463_21452 316
277 3300048929 Ga0496126_0239742 Ga0496126_0239742_472_1461 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

6

322

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9602 4 311
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9543 4 308
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9535 4 311
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9532 4 310
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.951 4 308
ID Description Score Start End Superfamily
af_P60393_12_309_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9751 12 308 3.40.50.1000
af_P60393_12_309_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9687 12 308 3.40.50.1000
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9686 112 214 1.10.150.170
1m6yB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9582 112 215 1.10.150.170
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9489 4 311 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3C0HXJ8-F1-model_v4 deleted 0.9893 4 227
AF-A0A7X9GBZ0-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9888 4 247 GO:0005737
GO:0070475
GO:0071424
AF-A0A7C6TYK5-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9836 4 221 GO:0005737
GO:0070475
GO:0071424
AF-A0A840KK65-F1-model_v4 deleted 0.9831 37 310
AF-A0A355YN55-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9823 2 245 GO:0005737
GO:0070475
GO:0071424

Feature Viewer

pLDDT pTM Quality
90.89 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map