F381815

General Info

Members Datasets Scaffolds Average Seq Length
277 177 554 166

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10888565|Ga0207707_108885651
Length 196
Sequence MTTNELEIRNGPDKADLLRAVANPDKHLHVMFETPAAAEAPKQSGRVFLVVIDNSPELRVAMRYACRRANRTGGRVALLHVTDDEDFRQFIGVSEVMRQESRQEAEALVQKMAAEIQKLSGAMPVLYLREGNRRDELLNLIGEEPTISILILGASTNPKGPGPLVSALTGKFVSRMRIPVTIVPGNLSDEDVESIA

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
168 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
169 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
170 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
171 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
172 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
173 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
174 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
175 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
176 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
177 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.94
Nodule 0.36
Rhizoplane 3.61
Rhizosphere 84.48
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10888565 3300025912 Bacteria 737
2 JGI25406J46586_10002085 3300003203 Bacteria 9446
3 JGI25153J46596_10000347 3300003215 Bacteria 32342
4 Ga0055536_1020141 3300003781 Bacteria 2071
5 Ga0055531_10025164 3300003794 Bacteria 2172
6 Ga0070680_100082122 3300005336 Bacteria 2659
7 Ga0068868_101033915 3300005338 Bacteria 753
8 Ga0070660_101245001 3300005339 Unclassified 631
9 Ga0070668_100398779 3300005347 Unclassified 1174
10 Ga0070713_100033970 3300005436 Bacteria 4092
11 Ga0070705_100018811 3300005440 Bacteria 3627
12 Ga0070705_100476560 3300005440 Bacteria 942
13 Ga0070708_100320006 3300005445 Bacteria 1461
14 Ga0070663_100729711 3300005455 Unclassified 844
15 Ga0070681_10038306 3300005458 Bacteria 4807
16 Ga0070681_10232671 3300005458 Bacteria 1757
17 Ga0070681_10360589 3300005458 Bacteria 1364
18 Ga0068867_100195844 3300005459 Bacteria 1615
19 Ga0070707_101329632 3300005468 Bacteria 685
20 Ga0070679_100022688 3300005530 Bacteria 6137
21 Ga0070679_100384604 3300005530 Bacteria 1350
22 Ga0068853_101499594 3300005539 Unclassified 653
23 Ga0070695_100001614 3300005545 Bacteria 12627
24 Ga0070695_100056025 3300005545 Bacteria 2543
25 Ga0070696_100008510 3300005546 Bacteria 6870
26 Ga0070696_100100936 3300005546 Bacteria 2068
27 Ga0070696_100365231 3300005546 Bacteria 1121
28 Ga0070704_100039199 3300005549 Bacteria 3251
29 Ga0070704_100148818 3300005549 Bacteria 1838
30 Ga0068855_100372615 3300005563 Bacteria 1569
31 Ga0068855_101234689 3300005563 Bacteria 776
32 Ga0070664_100178803 3300005564 Bacteria 1885
33 Ga0068852_100954003 3300005616 Bacteria 876
34 Ga0068859_100218247 3300005617 Bacteria 1994
35 Ga0081455_10281600 3300005937 Bacteria 1201
36 Ga0081538_10000547 3300005981 Bacteria 41476
37 Ga0081539_10001269 3300005985 Bacteria 44534
38 Ga0070716_100534330 3300006173 Bacteria 871
39 Ga0070712_100868617 3300006175 Bacteria 776
40 Ga0075428_100159707 3300006844 Bacteria 2447
41 Ga0075430_100162407 3300006846 Bacteria 1859
42 Ga0075430_100582458 3300006846 Bacteria 923
43 Ga0075433_10216618 3300006852 Bacteria 1701
44 Ga0097620_100218250 3300006931 Bacteria 1994
45 Ga0105240_10535101 3300009093 Bacteria 1298
46 Ga0111539_10000069 3300009094 Bacteria 103301
47 Ga0114129_10143634 3300009147 Bacteria 3270
48 Ga0105243_10863525 3300009148 Unclassified 897
49 Ga0105238_10067178 3300009551 Bacteria 3587
50 Ga0105035_112035 3300009988 Unclassified 771
51 Ga0105239_12354467 3300010375 Bacteria 620
52 Ga0157370_10029653 3300013104 Bacteria 5366
53 Ga0157378_10632309 3300013297 Bacteria 1084
54 Ga0157379_10063628 3300014968 Bacteria 3297
55 Ga0213872_10059886 3300021361 Unclassified 1723
56 Ga0213872_10134595 3300021361 Bacteria 1087
57 Ga0209148_1001709 3300025254 Bacteria 9682
58 Ga0209455_1000544 3300025272 Bacteria 26082
59 Ga0209675_1040263 3300025291 Bacteria 1029
60 Ga0209676_1001155 3300025292 Bacteria 28856
61 Ga0209676_1007715 3300025292 Bacteria 4974
62 Ga0209564_1045411 3300025295 Bacteria 1130
63 Ga0209758_1000095 3300025297 Bacteria 237870
64 Ga0209257_1001727 3300025304 Bacteria 24343
65 Ga0209257_1054698 3300025304 Bacteria 1109
66 Ga0207710_10237063 3300025900 Bacteria 909
67 Ga0207684_10178964 3300025910 Bacteria 1828
68 Ga0207684_10317593 3300025910 Bacteria 1343
69 Ga0207707_10212892 3300025912 Bacteria 1683
70 Ga0207707_10230110 3300025912 Bacteria 1613
71 Ga0207695_10515323 3300025913 Bacteria 1078
72 Ga0207671_10309176 3300025914 Bacteria 1249
73 Ga0207693_10158387 3300025915 Bacteria 1781
74 Ga0207660_10268875 3300025917 Bacteria 1350
75 Ga0207652_10115493 3300025921 Bacteria 2384
76 Ga0207652_10649262 3300025921 Bacteria 944
77 Ga0207646_10355735 3300025922 Bacteria 1323
78 Ga0207694_10014392 3300025924 Bacteria 5962
79 Ga0207700_10056015 3300025928 Bacteria 2966
80 Ga0207690_10784966 3300025932 Bacteria 787
81 Ga0207709_10745550 3300025935 Bacteria 787
82 Ga0207665_10544190 3300025939 Bacteria 901
83 Ga0207691_10287412 3300025940 Bacteria 1414
84 Ga0207679_10564282 3300025945 Bacteria 1023
85 Ga0207667_10270296 3300025949 Bacteria 1738
86 Ga0207668_10289029 3300025972 Bacteria 1348
87 Ga0207641_10449043 3300026088 Bacteria 1246
88 Ga0207648_10316632 3300026089 Bacteria 1401
89 Ga0207676_10209418 3300026095 Bacteria 1729
90 Ga0209974_10060389 3300027876 Unclassified 1283
91 Ga0207428_10000440 3300027907 Bacteria 50907
92 Ga0268266_11032063 3300028379 Bacteria 796
93 Ga0268265_10006401 3300028380 Bacteria 7981
94 Ga0307517_10088690 3300028786 Bacteria 2554
95 Ga0307515_10040709 3300028794 Bacteria 7338
96 Ga0265332_10051675 3300031238 Bacteria 1765
97 Ga0265328_10023164 3300031239 Bacteria 2358
98 Ga0265325_10156023 3300031241 Bacteria 1077
99 Ga0265340_10030408 3300031247 Bacteria 2706
100 Ga0265340_10078926 3300031247 Bacteria 1552
101 Ga0265339_10037587 3300031249 Bacteria 2705
102 Ga0265331_10000150 3300031250 Bacteria 90008
103 Ga0265331_10052318 3300031250 Bacteria 1952
104 Ga0307513_10148992 3300031456 Bacteria 2253
105 Ga0307513_10807081 3300031456 Bacteria 644
106 Ga0265313_10001449 3300031595 Bacteria 22152
107 Ga0265314_10066218 3300031711 Bacteria 2437
108 Ga0265314_10161644 3300031711 Bacteria 1362
109 Ga0265342_10007848 3300031712 Bacteria 7749
110 Ga0316576_10208070 3300031727 Bacteria 1473
111 Ga0307410_10362740 3300031852 Bacteria 1161
112 Ga0307406_10098941 3300031901 Bacteria 1982
113 Ga0307406_10181759 3300031901 Bacteria 1532
114 Ga0307406_10832125 3300031901 Bacteria 781
115 Ga0307407_10092705 3300031903 Bacteria 1856
116 Ga0307416_100584882 3300032002 Bacteria 1194
117 Ga0307416_101182765 3300032002 Bacteria 870
118 Ga0307416_101870045 3300032002 Bacteria 704
119 Ga0307414_11143353 3300032004 Bacteria 720
120 Ga0307411_10696127 3300032005 Bacteria 885
121 Ga0307415_100305453 3300032126 Bacteria 1320
122 Ga0373938_0112982 3300034957 Bacteria 693
123 Ga0373931_0030915 3300035691 Bacteria 2759
124 Ga0373931_0083105 3300035691 Bacteria 1771
125 Ga0373931_0880638 3300035691 Bacteria 601
126 Ga0373933_0024990 3300035724 Bacteria 3423
127 Ga0373933_0727609 3300035724 Bacteria 653
128 Ga0373947_0055532 3300035725 Bacteria 2392
129 Ga0373937_0006117 3300036401 Bacteria 10362
130 Ga0373937_0420381 3300036401 Unclassified 1269
131 Ga0373925_0179945 3300037068 Bacteria 1673
132 Ga0373925_0182374 3300037068 Bacteria 1662
133 Ga0395905_0076727 3300037471 Bacteria 3132
134 Ga0395901_0161016 3300038443 Bacteria 2357
135 Ga0395901_0234406 3300038443 Bacteria 1916
136 Ga0395901_1614015 3300038443 Unclassified 602
137 Ga0436360_0271459 3300039438 Bacteria 779
138 Ga0436361_0404319 3300039447 Bacteria 706
139 Ga0436361_0514043 3300039447 Bacteria 7643
140 Ga0436361_0556086 3300039447 Bacteria 2480
141 Ga0436361_1107884 3300039447 Bacteria 3020
142 Ga0450923_150709 3300042125 Bacteria 563
143 Ga0451577_0468935 3300042876 Bacteria 1143
144 Ga0451577_1017301 3300042876 Bacteria 744
145 Ga0451576_0002896 3300045051 Bacteria 24478
146 Ga0451576_0283610 3300045051 Bacteria 1732
147 Ga0495638_0045702 3300046460 Bacteria 2754
148 Ga0495580_0054671 3300046472 Bacteria 2815
149 Ga0496100_0167052 3300048903 Bacteria 1582
150 Ga0496102_0137884 3300048905 Bacteria 2286
151 Ga0496104_1297532 3300048907 Unclassified 631
152 Ga0496106_0223129 3300048909 Bacteria 1503
153 Ga0496107_0127725 3300048910 Bacteria 1876
154 Ga0496108_0464445 3300048911 Bacteria 1106
155 Ga0496109_0610815 3300048912 Bacteria 1027
156 Ga0496110_0895254 3300048913 Unclassified 793
157 Ga0496110_1036570 3300048913 Bacteria 728
158 Ga0496112_0453459 3300048915 Bacteria 1220
159 Ga0496126_0556071 3300048929 Bacteria 910
160 Ga0501031_0285811 3300049568 Bacteria 1070
161 Ga0501032_0001653 3300049569 Bacteria 17694
162 Ga0501032_0176934 3300049569 Bacteria 1397
163 Ga0501033_0052624 3300049570 Bacteria 3017
164 Ga0501033_0069152 3300049570 Bacteria 2596
165 Ga0501033_0268619 3300049570 Bacteria 1206
166 Ga0501033_0543549 3300049570 Bacteria 801
167 Ga0501034_0092682 3300049571 Bacteria 3017
168 Ga0501034_0145439 3300049571 Bacteria 2348
169 Ga0501034_0296685 3300049571 Bacteria 1554
170 Ga0501034_0409702 3300049571 Unclassified 1278
171 Ga0501034_0517301 3300049571 Bacteria 1106
172 Ga0501034_0691372 3300049571 Bacteria 919
173 Ga0501036_0009856 3300049572 Bacteria 7865
174 Ga0501036_0195060 3300049572 Bacteria 1704
175 Ga0501037_0048204 3300049573 Bacteria 3122
176 Ga0501038_0008726 3300049574 Bacteria 9303
177 Ga0501038_0025682 3300049574 Bacteria 5248
178 Ga0501038_0182090 3300049574 Bacteria 1695
179 Ga0501039_0013058 3300049575 Bacteria 6350
180 Ga0501043_0001671 3300049579 Bacteria 19283
181 Ga0501043_0034781 3300049579 Bacteria 3963
182 Ga0501043_0075000 3300049579 Bacteria 2657
183 Ga0501046_0004518 3300049580 Bacteria 12608
184 Ga0501046_0915381 3300049580 Bacteria 611
185 Ga0501047_0008023 3300049581 Bacteria 9960
186 Ga0501047_0010751 3300049581 Bacteria 8652
187 Ga0501047_0242230 3300049581 Bacteria 1654
188 Ga0501047_0325766 3300049581 Unclassified 1375
189 Ga0501048_0082047 3300049582 Bacteria 2274
190 Ga0501067_0033248 3300049583 Bacteria 2862
191 Ga0501067_0120568 3300049583 Bacteria 1459
192 Ga0501068_0008752 3300049584 Bacteria 5647
193 Ga0501068_0032693 3300049584 Bacteria 3093
194 Ga0501068_0392419 3300049584 Bacteria 894
195 Ga0501069_0000092 3300049585 Bacteria 43169
196 Ga0501069_0121113 3300049585 Bacteria 1494
197 Ga0501070_0004434 3300049586 Bacteria 12057
198 Ga0501070_0063661 3300049586 Bacteria 3055
199 Ga0501070_0138551 3300049586 Bacteria 2009
200 Ga0501070_0418602 3300049586 Bacteria 1082
201 Ga0501072_0069515 3300049588 Bacteria 2781
202 Ga0501072_0363362 3300049588 Bacteria 1149
203 Ga0501073_0008967 3300049589 Bacteria 7388
204 Ga0501073_0026939 3300049589 Bacteria 4115
205 Ga0501073_0071879 3300049589 Bacteria 2410
206 Ga0501073_0217333 3300049589 Bacteria 1320
207 Ga0501073_0536743 3300049589 Bacteria 808
208 Ga0501074_0453176 3300049590 Bacteria 910
209 Ga0501074_0559686 3300049590 Bacteria 809
210 Ga0501076_0053997 3300049592 Bacteria 3185
211 Ga0501076_0267541 3300049592 Bacteria 1400
212 Ga0501076_0386249 3300049592 Unclassified 1151
213 Ga0501079_0130594 3300049741 Bacteria 1955
214 Ga0501079_0630263 3300049741 Bacteria 844
215 Ga0501080_0005948 3300049742 Bacteria 10932
216 Ga0501080_0022941 3300049742 Bacteria 5786
217 Ga0501080_0033209 3300049742 Bacteria 4816
218 Ga0501080_0042684 3300049742 Bacteria 4222
219 Ga0501080_0137000 3300049742 Bacteria 2265
220 Ga0501080_0156638 3300049742 Bacteria 2104
221 Ga0501080_0478938 3300049742 Bacteria 1114
222 Ga0501083_0007317 3300049744 Bacteria 7827
223 Ga0501083_0011399 3300049744 Bacteria 6236
224 Ga0501083_0030784 3300049744 Bacteria 3683
225 Ga0501083_0046958 3300049744 Bacteria 2919
226 Ga0501083_0115964 3300049744 Bacteria 1758
227 Ga0501083_0487564 3300049744 Bacteria 802
228 Ga0501035_0001250 3300049822 Bacteria 26412
229 Ga0501035_0044201 3300049822 Bacteria 4012
230 Ga0501035_0118986 3300049822 Bacteria 2311
231 Ga0501035_0185622 3300049822 Bacteria 1790
232 Ga0501035_1061912 3300049822 Bacteria 634
233 Ga0501044_0003427 3300049823 Bacteria 17872
234 Ga0501044_0009273 3300049823 Bacteria 10745
235 Ga0501044_0010547 3300049823 Bacteria 10023
236 Ga0501044_0101136 3300049823 Bacteria 2900
237 Ga0501044_0289979 3300049823 Bacteria 1568
238 Ga0501044_0565554 3300049823 Bacteria 1033
239 nmdc:mga0k408_305099_c1 3300050493 Bacteria 950
240 nmdc:mga05p37_133840_c1 3300050507 Bacteria 3041
241 nmdc:mga05p37_727159_c1 3300050507 Unclassified 1098
242 nmdc:mga0qj67_470241_c1 3300050509 Unclassified 1012
243 nmdc:mga08y16_61_c1 3300050511 Bacteria 92275
244 nmdc:mga0n895_595021_c1 3300050512 Bacteria 1109
245 nmdc:mga0a205_274550_c1 3300050515 Bacteria 1562
246 Ga0495619_0230296 3300053085 Bacteria 1284
247 Ga0500578_0010029 3300053086 Bacteria 6143
248 Ga0500583_0374818 3300053092 Bacteria 686
249 Ga0500651_0101006 3300053093 Bacteria 1768
250 Ga0500628_020385 3300053129 Unclassified 1332
251 Ga0500658_0051431 3300053134 Bacteria 1684
252 Ga0500559_0336497 3300053136 Bacteria 707
253 Ga0500577_0005134 3300053142 Bacteria 3506
254 Ga0500622_0084663 3300053156 Unclassified 1583
255 Ga0500587_019188 3300053739 Bacteria 885
256 Ga0501084_0050004 3300054114 Bacteria 3500
257 Ga0501084_0075965 3300054114 Bacteria 2815
258 Ga0501084_0292332 3300054114 Bacteria 1376
259 Ga0501084_0461100 3300054114 Bacteria 1074
260 Ga0590071_011312 3300059421 Bacteria 2088
261 Ga0590075_006636 3300059424 Bacteria 2741
262 Ga0590075_023387 3300059424 Bacteria 1549
263 Ga0501082_0005828 3300060353 Bacteria 10697
264 Ga0501082_0023109 3300060353 Bacteria 5362
265 Ga0501082_0072286 3300060353 Bacteria 2971
266 Ga0501082_0202686 3300060353 Bacteria 1726
267 2512034841 2511231221 Bacteria 6846400
268 2523103454 2522572158 Bacteria 6514390
269 2842335689 2842333319 Bacteria 8899485
270 2883297276 2883291878 Bacteria 5894118
271 2883360085 2883354860 Bacteria 5865246
272 2883578806 2883577096 Bacteria 4709178
273 2894775758 2894772417 Bacteria 5305674
274 2897808684 2897803580 Bacteria 7000062
275 2929200408 2929199973 Bacteria 7260745
276 8054003715 8054002106 Bacteria 7987183
277 8055914724 8055909800 Bacteria 7278581
278 Ga0207707_10888565
279 JGI25406J46586_10002085
280 JGI25153J46596_10000347
281 Ga0055536_1020141
282 Ga0055531_10025164
283 Ga0070680_100082122
284 Ga0068868_101033915
285 Ga0070660_101245001
286 Ga0070668_100398779
287 Ga0070713_100033970
288 Ga0070705_100018811
289 Ga0070705_100476560
290 Ga0070708_100320006
291 Ga0070663_100729711
292 Ga0070681_10038306
293 Ga0070681_10232671
294 Ga0070681_10360589
295 Ga0068867_100195844
296 Ga0070707_101329632
297 Ga0070679_100022688
298 Ga0070679_100384604
299 Ga0068853_101499594
300 Ga0070695_100001614
301 Ga0070695_100056025
302 Ga0070696_100008510
303 Ga0070696_100100936
304 Ga0070696_100365231
305 Ga0070704_100039199
306 Ga0070704_100148818
307 Ga0068855_100372615
308 Ga0068855_101234689
309 Ga0070664_100178803
310 Ga0068852_100954003
311 Ga0068859_100218247
312 Ga0081455_10281600
313 Ga0081538_10000547
314 Ga0081539_10001269
315 Ga0070716_100534330
316 Ga0070712_100868617
317 Ga0075428_100159707
318 Ga0075430_100162407
319 Ga0075430_100582458
320 Ga0075433_10216618
321 Ga0097620_100218250
322 Ga0105240_10535101
323 Ga0111539_10000069
324 Ga0114129_10143634
325 Ga0105243_10863525
326 Ga0105238_10067178
327 Ga0105035_112035
328 Ga0105239_12354467
329 Ga0157370_10029653
330 Ga0157378_10632309
331 Ga0157379_10063628
332 Ga0213872_10059886
333 Ga0213872_10134595
334 Ga0209148_1001709
335 Ga0209455_1000544
336 Ga0209675_1040263
337 Ga0209676_1001155
338 Ga0209676_1007715
339 Ga0209564_1045411
340 Ga0209758_1000095
341 Ga0209257_1001727
342 Ga0209257_1054698
343 Ga0207710_10237063
344 Ga0207684_10178964
345 Ga0207684_10317593
346 Ga0207707_10212892
347 Ga0207707_10230110
348 Ga0207695_10515323
349 Ga0207671_10309176
350 Ga0207693_10158387
351 Ga0207660_10268875
352 Ga0207652_10115493
353 Ga0207652_10649262
354 Ga0207646_10355735
355 Ga0207694_10014392
356 Ga0207700_10056015
357 Ga0207690_10784966
358 Ga0207709_10745550
359 Ga0207665_10544190
360 Ga0207691_10287412
361 Ga0207679_10564282
362 Ga0207667_10270296
363 Ga0207668_10289029
364 Ga0207641_10449043
365 Ga0207648_10316632
366 Ga0207676_10209418
367 Ga0209974_10060389
368 Ga0207428_10000440
369 Ga0268266_11032063
370 Ga0268265_10006401
371 Ga0307517_10088690
372 Ga0307515_10040709
373 Ga0265332_10051675
374 Ga0265328_10023164
375 Ga0265325_10156023
376 Ga0265340_10030408
377 Ga0265340_10078926
378 Ga0265339_10037587
379 Ga0265331_10000150
380 Ga0265331_10052318
381 Ga0307513_10148992
382 Ga0307513_10807081
383 Ga0265313_10001449
384 Ga0265314_10066218
385 Ga0265314_10161644
386 Ga0265342_10007848
387 Ga0316576_10208070
388 Ga0307410_10362740
389 Ga0307406_10098941
390 Ga0307406_10181759
391 Ga0307406_10832125
392 Ga0307407_10092705
393 Ga0307416_100584882
394 Ga0307416_101182765
395 Ga0307416_101870045
396 Ga0307414_11143353
397 Ga0307411_10696127
398 Ga0307415_100305453
399 Ga0373938_0112982
400 Ga0373931_0030915
401 Ga0373931_0083105
402 Ga0373931_0880638
403 Ga0373933_0024990
404 Ga0373933_0727609
405 Ga0373947_0055532
406 Ga0373937_0006117
407 Ga0373937_0420381
408 Ga0373925_0179945
409 Ga0373925_0182374
410 Ga0395905_0076727
411 Ga0395901_0161016
412 Ga0395901_0234406
413 Ga0395901_1614015
414 Ga0436360_0271459
415 Ga0436361_0404319
416 Ga0436361_0514043
417 Ga0436361_0556086
418 Ga0436361_1107884
419 Ga0450923_150709
420 Ga0451577_0468935
421 Ga0451577_1017301
422 Ga0451576_0002896
423 Ga0451576_0283610
424 Ga0495638_0045702
425 Ga0495580_0054671
426 Ga0496100_0167052
427 Ga0496102_0137884
428 Ga0496104_1297532
429 Ga0496106_0223129
430 Ga0496107_0127725
431 Ga0496108_0464445
432 Ga0496109_0610815
433 Ga0496110_0895254
434 Ga0496110_1036570
435 Ga0496112_0453459
436 Ga0496126_0556071
437 Ga0501031_0285811
438 Ga0501032_0001653
439 Ga0501032_0176934
440 Ga0501033_0052624
441 Ga0501033_0069152
442 Ga0501033_0268619
443 Ga0501033_0543549
444 Ga0501034_0092682
445 Ga0501034_0145439
446 Ga0501034_0296685
447 Ga0501034_0409702
448 Ga0501034_0517301
449 Ga0501034_0691372
450 Ga0501036_0009856
451 Ga0501036_0195060
452 Ga0501037_0048204
453 Ga0501038_0008726
454 Ga0501038_0025682
455 Ga0501038_0182090
456 Ga0501039_0013058
457 Ga0501043_0001671
458 Ga0501043_0034781
459 Ga0501043_0075000
460 Ga0501046_0004518
461 Ga0501046_0915381
462 Ga0501047_0008023
463 Ga0501047_0010751
464 Ga0501047_0242230
465 Ga0501047_0325766
466 Ga0501048_0082047
467 Ga0501067_0033248
468 Ga0501067_0120568
469 Ga0501068_0008752
470 Ga0501068_0032693
471 Ga0501068_0392419
472 Ga0501069_0000092
473 Ga0501069_0121113
474 Ga0501070_0004434
475 Ga0501070_0063661
476 Ga0501070_0138551
477 Ga0501070_0418602
478 Ga0501072_0069515
479 Ga0501072_0363362
480 Ga0501073_0008967
481 Ga0501073_0026939
482 Ga0501073_0071879
483 Ga0501073_0217333
484 Ga0501073_0536743
485 Ga0501074_0453176
486 Ga0501074_0559686
487 Ga0501076_0053997
488 Ga0501076_0267541
489 Ga0501076_0386249
490 Ga0501079_0130594
491 Ga0501079_0630263
492 Ga0501080_0005948
493 Ga0501080_0022941
494 Ga0501080_0033209
495 Ga0501080_0042684
496 Ga0501080_0137000
497 Ga0501080_0156638
498 Ga0501080_0478938
499 Ga0501083_0007317
500 Ga0501083_0011399
501 Ga0501083_0030784
502 Ga0501083_0046958
503 Ga0501083_0115964
504 Ga0501083_0487564
505 Ga0501035_0001250
506 Ga0501035_0044201
507 Ga0501035_0118986
508 Ga0501035_0185622
509 Ga0501035_1061912
510 Ga0501044_0003427
511 Ga0501044_0009273
512 Ga0501044_0010547
513 Ga0501044_0101136
514 Ga0501044_0289979
515 Ga0501044_0565554
516 nmdc:mga0k408_305099_c1
517 nmdc:mga05p37_133840_c1
518 nmdc:mga05p37_727159_c1
519 nmdc:mga0qj67_470241_c1
520 nmdc:mga08y16_61_c1
521 nmdc:mga0n895_595021_c1
522 nmdc:mga0a205_274550_c1
523 Ga0495619_0230296
524 Ga0500578_0010029
525 Ga0500583_0374818
526 Ga0500651_0101006
527 Ga0500628_020385
528 Ga0500658_0051431
529 Ga0500559_0336497
530 Ga0500577_0005134
531 Ga0500622_0084663
532 Ga0500587_019188
533 Ga0501084_0050004
534 Ga0501084_0075965
535 Ga0501084_0292332
536 Ga0501084_0461100
537 Ga0590071_011312
538 Ga0590075_006636
539 Ga0590075_023387
540 Ga0501082_0005828
541 Ga0501082_0023109
542 Ga0501082_0072286
543 Ga0501082_0202686
544 2512034841
545 2523103454
546 2842335689
547 2883297276
548 2883360085
549 2883578806
550 2894775758
551 2897808684
552 2929200408
553 8054003715
554 8055914724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

45

184

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8371 19 108
3s3t-assembly1.cif.gz_A universal stress protein uspa from lactobacillus plantarum 0.8218 16 107
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8196 19 104
1mjh-assembly1.cif.gz_B structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.7989 15 110
3idf-assembly1.cif.gz_B the crystal structure of a usp-like protein from wolinella succinogenes to 2.0a 0.779 18 109
ID Description Score Start End Superfamily
af_Q2FXL6_6_143_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8427 18 107 3.40.50.620
af_Q8GWU3_17_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8391 21 110 3.40.50.620
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8371 19 108 3.40.50.620
af_I1KJW8_14_152_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.836 18 102 3.40.50.620
af_A0A0R0L4D0_16_195_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8341 21 102 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A845S8I5-F1-model_v4 deleted 0.9431 17 104
AF-A0A848TDM1-F1-model_v4 Universal stress protein 0.9354 18 108
AF-A0A3D2E8P7-F1-model_v4 deleted 0.9221 18 104
AF-A0A383CDW8-F1-model_v4 UspA domain-containing protein 0.9203 17 103
AF-A0A529TWX3-F1-model_v4 Universal stress protein 0.914 13 109

Map