F380403

General Info

Members Datasets Scaffolds Average Seq Length
275 186 256 137

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_12595329|Ga0114129_125953291
Length 162
Sequence LRGQADHPTDQESRSNVTDPLLTVSAMDITIHQSFLPQNDPEAAIAFYRDVLGFEVRNDVGYEGMRWITVGPVDQPDTALVLHPPEADPGITEDERRMIAEMMAKGTYAGVNLGTKNIDAVFEELQAKGAEVVQEPTDQPYGIRDAAIRDPAGNLIRIQELR

Samples

Sample ID Description Type Environment
1 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
4 2643221714 Streptomyces sp. Root264 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
7 2808606372 Agromyces sp. 23-23 Isolate Unclassified
8 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
9 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
10 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
11 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
12 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
13 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
14 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
15 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
16 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
17 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
18 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 0.36
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 5.82
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1011683 3300003354 Bacteria 3092
2 JGI25407J50210_10109336 3300003373 Bacteria 682
3 Ga0006562J51391_1053254 3300003578 Bacteria 1598
4 Ga0070666_10394824 3300005335 Bacteria 994
5 Ga0070661_100048916 3300005344 Bacteria 3096
6 Ga0070692_10495272 3300005345 Bacteria 791
7 Ga0070668_100331708 3300005347 Bacteria 1283
8 Ga0070675_100609298 3300005354 Bacteria 991
9 Ga0070673_100094852 3300005364 Bacteria 2446
10 Ga0070701_10847866 3300005438 Bacteria 627
11 Ga0070698_100449052 3300005471 Bacteria 1225
12 Ga0070672_100478038 3300005543 Bacteria 1076
13 Ga0070665_100417128 3300005548 Bacteria 1351
14 Ga0070664_100011354 3300005564 Bacteria 7226
15 Ga0070702_100266649 3300005615 Bacteria 1169
16 Ga0068864_100179873 3300005618 Bacteria 1933
17 Ga0068866_10379652 3300005718 Bacteria 906
18 Ga0068861_100009237 3300005719 Bacteria 6802
19 Ga0068861_100046286 3300005719 Bacteria 3279
20 Ga0068870_10027810 3300005840 Bacteria 2833
21 Ga0081538_10020999 3300005981 Bacteria 4786
22 Ga0081539_10034418 3300005985 Bacteria 3064
23 Ga0081539_10037443 3300005985 Bacteria 2891
24 Ga0075365_10470665 3300006038 Bacteria 888
25 Ga0075364_10068407 3300006051 Bacteria 2335
26 Ga0075432_10224404 3300006058 Bacteria 753
27 Ga0097621_100111203 3300006237 Bacteria 2315
28 Ga0075370_10584838 3300006353 Bacteria 676
29 Ga0075428_100013247 3300006844 Bacteria 9175
30 Ga0075428_101178269 3300006844 Bacteria 808
31 Ga0075428_101243800 3300006844 Bacteria 784
32 Ga0075431_100014746 3300006847 Bacteria 7913
33 Ga0075431_100892582 3300006847 Bacteria 859
34 Ga0075429_100011695 3300006880 Bacteria 7611
35 Ga0105244_10164771 3300009036 Bacteria 1057
36 Ga0111539_10565742 3300009094 Bacteria 1324
37 Ga0111539_10863728 3300009094 Bacteria 1053
38 Ga0111539_10902985 3300009094 Bacteria 1027
39 Ga0105247_10002218 3300009101 Bacteria 13375
40 Ga0114129_10035341 3300009147 Bacteria 7059
41 Ga0114129_12595329 3300009147 Bacteria 605
42 Ga0105243_10022856 3300009148 Bacteria 4753
43 Ga0105243_10316551 3300009148 Bacteria 1420
44 Ga0105243_11690961 3300009148 Bacteria 662
45 Ga0105248_10094799 3300009177 Bacteria 3360
46 Ga0105238_10725694 3300009551 Bacteria 1007
47 Ga0157374_11592823 3300013296 Bacteria 677
48 Ga0157380_10005024 3300014326 Bacteria 9223
49 Ga0157380_10723608 3300014326 Bacteria 1003
50 Ga0157380_10805811 3300014326 Bacteria 957
51 Ga0157380_12026034 3300014326 Bacteria 638
52 Ga0157380_12053090 3300014326 Bacteria 634
53 Ga0157376_10392338 3300014969 Bacteria 1340
54 Ga0183368_1002 3300015687 Bacteria 1865598
55 Ga0163161_10267255 3300017792 Bacteria 1337
56 Ga0207426_1002187 3300025302 Bacteria 13196
57 Ga0207426_1006905 3300025302 Bacteria 4831
58 Ga0207710_10000447 3300025900 Bacteria 26819
59 Ga0207688_10147053 3300025901 Bacteria 1390
60 Ga0207643_10070466 3300025908 Bacteria 2011
61 Ga0207650_10032425 3300025925 Bacteria 3778
62 Ga0207659_10852057 3300025926 Bacteria 783
63 Ga0207644_10222966 3300025931 Bacteria 1495
64 Ga0207709_10076262 3300025935 Bacteria 2146
65 Ga0207709_10109314 3300025935 Bacteria 1845
66 Ga0207709_10123496 3300025935 Bacteria 1752
67 Ga0207711_10135397 3300025941 Bacteria 2212
68 Ga0207679_10016707 3300025945 Bacteria 4876
69 Ga0207668_10459316 3300025972 Bacteria 1088
70 Ga0207658_10128847 3300025986 Bacteria 2030
71 Ga0207678_10368654 3300026067 Bacteria 1240
72 Ga0207708_10354982 3300026075 Bacteria 1204
73 Ga0207702_10355695 3300026078 Bacteria 1402
74 Ga0207641_10611647 3300026088 Bacteria 1068
75 Ga0207648_11022988 3300026089 Bacteria 774
76 Ga0207676_10199150 3300026095 Bacteria 1768
77 Ga0207675_100013830 3300026118 Bacteria 7526
78 Ga0207675_100073056 3300026118 Bacteria 3209
79 Ga0207675_100954332 3300026118 Bacteria 875
80 Ga0207683_10161979 3300026121 Bacteria 2023
81 Ga0207428_10050953 3300027907 Bacteria 3310
82 Ga0207428_10432409 3300027907 Bacteria 961
83 Ga0207428_11192468 3300027907 Bacteria 530
84 Ga0268266_10339873 3300028379 Bacteria 1409
85 Ga0316182_1206670 3300030745 Bacteria 584
86 Ga0265340_10013075 3300031247 Bacteria 4370
87 Ga0307513_10000005 3300031456 Bacteria 553227
88 Ga0307513_10000049 3300031456 Bacteria 153747
89 Ga0307405_10264344 3300031731 Bacteria 1287
90 Ga0307405_10642301 3300031731 Bacteria 872
91 Ga0307413_10084728 3300031824 Bacteria 2044
92 Ga0307413_10255952 3300031824 Bacteria 1302
93 Ga0307410_10219964 3300031852 Bacteria 1460
94 Ga0307410_10882532 3300031852 Bacteria 765
95 Ga0307410_11214653 3300031852 Bacteria 657
96 Ga0307406_10793075 3300031901 Bacteria 799
97 Ga0307406_10796679 3300031901 Bacteria 797
98 Ga0307407_10156979 3300031903 Bacteria 1485
99 Ga0307412_11530183 3300031911 Bacteria 607
100 Ga0307409_100050091 3300031995 Bacteria 3188
101 Ga0307409_100417298 3300031995 Bacteria 1286
102 Ga0307416_100369515 3300032002 Bacteria 1460
103 Ga0307416_100588289 3300032002 Bacteria 1191
104 Ga0307416_101837443 3300032002 Bacteria 710
105 Ga0307414_11055065 3300032004 Bacteria 749
106 Ga0307414_11617654 3300032004 Bacteria 604
107 Ga0307411_10521783 3300032005 Bacteria 1008
108 Ga0307411_10701268 3300032005 Bacteria 882
109 Ga0307415_100098551 3300032126 Bacteria 2137
110 Ga0307415_100189878 3300032126 Bacteria 1620
111 Ga0307415_100201385 3300032126 Bacteria 1580
112 Ga0307415_100652483 3300032126 Bacteria 944
113 Ga0395899_0156712 3300037312 Bacteria 1611
114 Ga0395900_0007797 3300037418 Bacteria 11038
115 Ga0395898_0023258 3300037466 Bacteria 6263
116 Ga0395905_0000126 3300037471 Bacteria 126035
117 Ga0395905_0009117 3300037471 Bacteria 9719
118 Ga0439438_103912 3300041405 Bacteria 688
119 Ga0439439_0051656 3300041406 Bacteria 1078
120 Ga0451791_0301133 3300041451 Bacteria 612
121 Ga0451793_0253088 3300041452 Bacteria 623
122 Ga0451802_1307413 3300041460 Bacteria 943
123 Ga0451807_1795226 3300041486 Bacteria 565
124 Ga0451833_1112044 3300041491 Bacteria 551
125 Ga0451837_0420384 3300041494 Bacteria 897
126 Ga0451853_3164613 3300041512 Bacteria 589
127 Ga0439449_0030166 3300042007 Bacteria 2020
128 Ga0439457_033322 3300042014 Bacteria 1143
129 Ga0439458_0057560 3300042157 Bacteria 967
130 Ga0466969_0038630 3300044656 Bacteria 2401
131 Ga0466972_0025187 3300044658 Bacteria 2951
132 Ga0466965_0012302 3300044683 Bacteria 4023
133 Ga0466965_0525967 3300044683 Bacteria 666
134 Ga0466966_0611272 3300044684 Bacteria 656
135 Ga0466961_0070147 3300044693 Bacteria 2224
136 Ga0466963_0011623 3300044694 Bacteria 5360
137 Ga0466970_0012739 3300044765 Bacteria 4303
138 Ga0466970_0063496 3300044765 Bacteria 1980
139 Ga0466970_0411914 3300044765 Bacteria 772
140 Ga0466960_0168129 3300044901 Bacteria 1182
141 Ga0466959_0012364 3300045049 Bacteria 6166
142 Ga0466958_0000828 3300045836 Bacteria 13685
143 Ga0466967_0021594 3300045976 Bacteria 5234
144 Ga0495642_0070646 3300046528 Bacteria 1460
145 Ga0495668_0265917 3300046616 Bacteria 939
146 Ga0495588_0125856 3300046674 Bacteria 1351
147 Ga0495677_0042291 3300047445 Bacteria 1669
148 Ga0495685_080236 3300047447 Bacteria 1087
149 Ga0495681_0340730 3300047470 Bacteria 572
150 Ga0496103_0377856 3300048906 Bacteria 910
151 Ga0496104_0356631 3300048907 Bacteria 1375
152 Ga0496105_0179862 3300048908 Bacteria 1732
153 Ga0496106_0053855 3300048909 Bacteria 3039
154 Ga0496107_0077531 3300048910 Bacteria 2421
155 Ga0496107_0542703 3300048910 Bacteria 861
156 Ga0496108_0192718 3300048911 Bacteria 1767
157 Ga0496109_0685470 3300048912 Bacteria 962
158 Ga0496112_1523234 3300048915 Bacteria 582
159 Ga0496113_0109300 3300048916 Bacteria 2150
160 Ga0496113_1387079 3300048916 Bacteria 545
161 Ga0496114_1723349 3300048917 Bacteria 515
162 Ga0496119_0010658 3300048922 Bacteria 7704
163 Ga0496121_0018498 3300048924 Bacteria 7022
164 Ga0501031_0031472 3300049568 Bacteria 3461
165 Ga0501031_0105038 3300049568 Bacteria 1843
166 Ga0501033_0000902 3300049570 Bacteria 27130
167 Ga0501033_0021508 3300049570 Bacteria 4866
168 Ga0501033_0200142 3300049570 Bacteria 1427
169 Ga0501036_0062792 3300049572 Bacteria 3146
170 Ga0501036_1088361 3300049572 Bacteria 653
171 Ga0501036_1218578 3300049572 Bacteria 613
172 Ga0501037_0302953 3300049573 Bacteria 1109
173 Ga0501037_0444090 3300049573 Bacteria 885
174 Ga0501038_0057163 3300049574 Bacteria 3349
175 Ga0501038_0254993 3300049574 Bacteria 1388
176 Ga0501039_0016015 3300049575 Bacteria 5742
177 Ga0501039_0044234 3300049575 Bacteria 3439
178 Ga0501039_1389365 3300049575 Bacteria 541
179 Ga0501040_0006036 3300049576 Bacteria 7842
180 Ga0501040_0194399 3300049576 Bacteria 1440
181 Ga0501042_0058330 3300049578 Bacteria 2755
182 Ga0501042_0070319 3300049578 Bacteria 2503
183 Ga0501043_0022067 3300049579 Bacteria 4995
184 Ga0501043_0502474 3300049579 Bacteria 906
185 Ga0501046_0043841 3300049580 Bacteria 3560
186 Ga0501046_0106770 3300049580 Bacteria 2142
187 Ga0501047_0115284 3300049581 Bacteria 2569
188 Ga0501048_0039357 3300049582 Bacteria 3392
189 Ga0501048_0048081 3300049582 Bacteria 3043
190 Ga0501048_0447459 3300049582 Bacteria 925
191 Ga0501048_0832610 3300049582 Bacteria 663
192 Ga0501067_0024691 3300049583 Bacteria 3333
193 Ga0501067_0105285 3300049583 Bacteria 1567
194 Ga0501068_0019467 3300049584 Bacteria 3943
195 Ga0501069_0042684 3300049585 Bacteria 2509
196 Ga0501069_0119479 3300049585 Bacteria 1505
197 Ga0501069_0535795 3300049585 Bacteria 700
198 Ga0501070_0074414 3300049586 Bacteria 2811
199 Ga0501070_0490340 3300049586 Bacteria 988
200 Ga0501071_0066995 3300049587 Bacteria 2611
201 Ga0501071_0112900 3300049587 Bacteria 2009
202 Ga0501071_0479657 3300049587 Bacteria 953
203 Ga0501071_0485331 3300049587 Bacteria 947
204 Ga0501072_0439413 3300049588 Bacteria 1033
205 Ga0501072_0440278 3300049588 Bacteria 1032
206 Ga0501072_0606614 3300049588 Bacteria 863
207 Ga0501073_0030831 3300049589 Bacteria 3828
208 Ga0501074_0013884 3300049590 Bacteria 5855
209 Ga0501074_0201778 3300049590 Bacteria 1417
210 Ga0501074_0877219 3300049590 Bacteria 632
211 Ga0501075_0032603 3300049591 Bacteria 3871
212 Ga0501076_0045053 3300049592 Bacteria 3481
213 Ga0501077_0095445 3300049593 Bacteria 1885
214 Ga0501079_0112823 3300049741 Bacteria 2113
215 Ga0501079_0134123 3300049741 Bacteria 1927
216 Ga0501081_0054943 3300049743 Bacteria 2752
217 Ga0501083_0015848 3300049744 Bacteria 5276
218 Ga0501083_0357243 3300049744 Bacteria 950
219 Ga0501083_1040317 3300049744 Bacteria 533
220 Ga0501271_022616 3300049768 Bacteria 737
221 Ga0501035_0064175 3300049822 Bacteria 3264
222 Ga0501035_0421106 3300049822 Bacteria 1109
223 Ga0501044_0136360 3300049823 Bacteria 2445
224 Ga0501044_0338434 3300049823 Bacteria 1426
225 Ga0501045_0180133 3300049824 Bacteria 1574
226 Ga0501045_0218566 3300049824 Bacteria 1419
227 Ga0501045_0574937 3300049824 Bacteria 835
228 Ga0501045_0575635 3300049824 Bacteria 835
229 nmdc:mga0yw44_289335_c1 3300050492 Bacteria 1096
230 nmdc:mga0yw44_37504_c1 3300050492 Bacteria 2862
231 nmdc:mga0yw44_516906_c1 3300050492 Bacteria 810
232 nmdc:mga07m45_899426_c1 3300050496 Bacteria 506
233 nmdc:mga05p37_1400000_c1 3300050507 Bacteria 704
234 nmdc:mga05p37_6142_c1 3300050507 Bacteria 14134
235 nmdc:mga09592_105724_c1 3300050508 Bacteria 2414
236 nmdc:mga0qj67_33336_c1 3300050509 Bacteria 4019
237 nmdc:mga06r32_3846_c1 3300050510 Bacteria 13434
238 nmdc:mga06r32_849981_c1 3300050510 Bacteria 871
239 nmdc:mga08y16_145841_c1 3300050511 Bacteria 2461
240 nmdc:mga08y16_1470190_c1 3300050511 Bacteria 643
241 nmdc:mga08y16_1907076_c1 3300050511 Bacteria 545
242 nmdc:mga08y16_527453_c1 3300050511 Bacteria 1197
243 Ga0495655_0051144 3300053083 Bacteria 1094
244 Ga0500644_0064540 3300053088 Bacteria 1301
245 Ga0500577_0035470 3300053142 Bacteria 1779
246 Ga0500616_0026933 3300053153 Bacteria 3177
247 Ga0501084_0659268 3300054114 Bacteria 883
248 Ga0501084_0910175 3300054114 Bacteria 740
249 Ga0501084_1051221 3300054114 Bacteria 684
250 Ga0501082_0045298 3300060353 Bacteria 3793
251 Ga0501082_0219995 3300060353 Bacteria 1652
252 Ga0501082_0306593 3300060353 Bacteria 1383
253 Ga0501082_0718992 3300060353 Bacteria 874
254 Ga0466962_0108861 3300061719 Bacteria 1333
255 Ga0530510_0099516 3300061734 Bacteria 2126
256 Ga0530510_0247487 3300061734 Bacteria 1328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0179862 Ga0496105_0179862_924_1319 128
2 iso_pu_bacteria 2515154129 2515719388 132
3 iso_pu_bacteria 2515154202 2516083727 132
4 iso_pu_bacteria 2687453130 2687583565 132
5 iso_pu_bacteria 2738543011 2739235221 132
6 iso_pu_bacteria 2808606372 2808902180 132
7 iso_pu_bacteria 2837268691 2837273866 132
8 iso_pu_bacteria 2866612099 2866614993 132
9 iso_pu_bacteria 2889300758 2889301780 132
10 iso_pu_bacteria 2894414249 2894415172 132
11 iso_pu_bacteria 2915768154 2915768329 132
12 iso_pu_bacteria 2932431166 2932433940 132
13 iso_pu_bacteria 2939743619 2939747220 132
14 iso_pu_bacteria 2990256926 2990257663 132
15 iso_pu_bacteria 8056037122 8056038112 132
16 iso_pu_bacteria 2915358134 2915363846 133
17 iso_pu_bacteria 2947224130 2947232407 133
18 3300030745 Ga0316182_1206670 Ga0316182_12066701 134
19 3300041405 Ga0439438_103912 Ga0439438_103912_233_637 134
20 3300041406 Ga0439439_0051656 Ga0439439_0051656_630_1034 134
21 3300042007 Ga0439449_0030166 Ga0439449_0030166_37_441 134
22 3300042014 Ga0439457_033322 Ga0439457_033322_694_1098 134
23 iso_pu_bacteria 2912723979 2912730269 134
24 3300006844 Ga0075428_101178269 Ga0075428_1011782692 135
25 3300013296 Ga0157374_11592823 Ga0157374_115928232 135
26 3300026078 Ga0207702_10355695 Ga0207702_103556952 135
27 3300026089 Ga0207648_11022988 Ga0207648_110229882 135
28 3300026118 Ga0207675_100954332 Ga0207675_1009543321 135
29 3300044684 Ga0466966_0611272 Ga0466966_0611272_44_451 135
30 3300044693 Ga0466961_0070147 Ga0466961_0070147_555_962 135
31 3300044694 Ga0466963_0011623 Ga0466963_0011623_3010_3417 135
32 3300044765 Ga0466970_0063496 Ga0466970_0063496_97_504 135
33 3300045049 Ga0466959_0012364 Ga0466959_0012364_4750_5157 135
34 3300045836 Ga0466958_0000828 Ga0466958_0000828_2960_3367 135
35 3300049568 Ga0501031_0031472 Ga0501031_0031472_2185_2592 135
36 3300049570 Ga0501033_0021508 Ga0501033_0021508_2936_3343 135
37 3300049573 Ga0501037_0444090 Ga0501037_0444090_28_435 135
38 3300049574 Ga0501038_0057163 Ga0501038_0057163_1914_2321 135
39 3300049575 Ga0501039_0016015 Ga0501039_0016015_2411_2818 135
40 3300049578 Ga0501042_0070319 Ga0501042_0070319_158_565 135
41 3300049579 Ga0501043_0022067 Ga0501043_0022067_2865_3272 135
42 3300049580 Ga0501046_0106770 Ga0501046_0106770_202_609 135
43 3300049582 Ga0501048_0039357 Ga0501048_0039357_135_542 135
44 3300049583 Ga0501067_0024691 Ga0501067_0024691_2136_2543 135
45 3300049583 Ga0501067_0105285 Ga0501067_0105285_249_656 135
46 3300049584 Ga0501068_0019467 Ga0501068_0019467_1937_2344 135
47 3300049585 Ga0501069_0042684 Ga0501069_0042684_1235_1642 135
48 3300049586 Ga0501070_0074414 Ga0501070_0074414_610_1017 135
49 3300049587 Ga0501071_0112900 Ga0501071_0112900_981_1388 135
50 3300049588 Ga0501072_0606614 Ga0501072_0606614_84_491 135
51 3300049589 Ga0501073_0030831 Ga0501073_0030831_1894_2301 135
52 3300049590 Ga0501074_0013884 Ga0501074_0013884_1563_1970 135
53 3300049741 Ga0501079_0112823 Ga0501079_0112823_191_598 135
54 3300049744 Ga0501083_0015848 Ga0501083_0015848_1761_2168 135
55 3300049822 Ga0501035_0064175 Ga0501035_0064175_28_435 135
56 3300049823 Ga0501044_0136360 Ga0501044_0136360_1914_2321 135
57 3300049824 Ga0501045_0575635 Ga0501045_0575635_364_771 135
58 3300060353 Ga0501082_0045298 Ga0501082_0045298_1708_2115 135
59 3300061719 Ga0466962_0108861 Ga0466962_0108861_624_1031 135
60 iso_pu_bacteria 2523231044 2523387161 135
61 3300003373 JGI25407J50210_10109336 JGI25407J50210_101093361 136
62 3300005335 Ga0070666_10394824 Ga0070666_103948243 136
63 3300005344 Ga0070661_100048916 Ga0070661_1000489163 136
64 3300005345 Ga0070692_10495272 Ga0070692_104952721 136
65 3300005347 Ga0070668_100331708 Ga0070668_1003317082 136
66 3300005354 Ga0070675_100609298 Ga0070675_1006092982 136
67 3300005364 Ga0070673_100094852 Ga0070673_1000948524 136
68 3300005438 Ga0070701_10847866 Ga0070701_108478661 136
69 3300005471 Ga0070698_100449052 Ga0070698_1004490522 136
70 3300005543 Ga0070672_100478038 Ga0070672_1004780383 136
71 3300005548 Ga0070665_100417128 Ga0070665_1004171282 136
72 3300005564 Ga0070664_100011354 Ga0070664_1000113546 136
73 3300005615 Ga0070702_100266649 Ga0070702_1002666493 136
74 3300005618 Ga0068864_100179873 Ga0068864_1001798733 136
75 3300005718 Ga0068866_10379652 Ga0068866_103796521 136
76 3300005719 Ga0068861_100009237 Ga0068861_1000092373 136
77 3300005719 Ga0068861_100046286 Ga0068861_1000462864 136
78 3300005840 Ga0068870_10027810 Ga0068870_100278102 136
79 3300005981 Ga0081538_10020999 Ga0081538_100209995 136
80 3300005985 Ga0081539_10034418 Ga0081539_100344183 136
81 3300005985 Ga0081539_10037443 Ga0081539_100374432 136
82 3300006038 Ga0075365_10470665 Ga0075365_104706652 136
83 3300006051 Ga0075364_10068407 Ga0075364_100684072 136
84 3300006058 Ga0075432_10224404 Ga0075432_102244041 136
85 3300006237 Ga0097621_100111203 Ga0097621_1001112032 136
86 3300006353 Ga0075370_10584838 Ga0075370_105848381 136
87 3300006844 Ga0075428_100013247 Ga0075428_1000132473 136
88 3300006844 Ga0075428_101243800 Ga0075428_1012438001 136
89 3300006847 Ga0075431_100014746 Ga0075431_1000147468 136
90 3300006847 Ga0075431_100892582 Ga0075431_1008925821 136
91 3300006880 Ga0075429_100011695 Ga0075429_1000116958 136
92 3300009094 Ga0111539_10565742 Ga0111539_105657422 136
93 3300009094 Ga0111539_10863728 Ga0111539_108637282 136
94 3300009094 Ga0111539_10902985 Ga0111539_109029852 136
95 3300009101 Ga0105247_10002218 Ga0105247_100022188 136
96 3300009147 Ga0114129_10035341 Ga0114129_1003534111 136
97 3300009147 Ga0114129_12595329 Ga0114129_125953291 136
98 3300009148 Ga0105243_10022856 Ga0105243_100228562 136
99 3300009148 Ga0105243_11690961 Ga0105243_116909611 136
100 3300009177 Ga0105248_10094799 Ga0105248_100947992 136
101 3300009551 Ga0105238_10725694 Ga0105238_107256942 136
102 3300014326 Ga0157380_10005024 Ga0157380_100050245 136
103 3300014326 Ga0157380_10723608 Ga0157380_107236082 136
104 3300014326 Ga0157380_12026034 Ga0157380_120260341 136
105 3300014326 Ga0157380_12053090 Ga0157380_120530901 136
106 3300014969 Ga0157376_10392338 Ga0157376_103923381 136
107 3300015687 Ga0183368_1002 Ga0183368_10021619 136
108 3300017792 Ga0163161_10267255 Ga0163161_102672552 136
109 3300025900 Ga0207710_10000447 Ga0207710_1000044723 136
110 3300025901 Ga0207688_10147053 Ga0207688_101470531 136
111 3300025908 Ga0207643_10070466 Ga0207643_100704664 136
112 3300025925 Ga0207650_10032425 Ga0207650_100324252 136
113 3300025926 Ga0207659_10852057 Ga0207659_108520572 136
114 3300025931 Ga0207644_10222966 Ga0207644_102229662 136
115 3300025935 Ga0207709_10076262 Ga0207709_100762623 136
116 3300025935 Ga0207709_10109314 Ga0207709_101093142 136
117 3300025941 Ga0207711_10135397 Ga0207711_101353972 136
118 3300025945 Ga0207679_10016707 Ga0207679_100167077 136
119 3300025972 Ga0207668_10459316 Ga0207668_104593162 136
120 3300025986 Ga0207658_10128847 Ga0207658_101288472 136
121 3300026067 Ga0207678_10368654 Ga0207678_103686543 136
122 3300026075 Ga0207708_10354982 Ga0207708_103549823 136
123 3300026088 Ga0207641_10611647 Ga0207641_106116472 136
124 3300026095 Ga0207676_10199150 Ga0207676_101991504 136
125 3300026118 Ga0207675_100013830 Ga0207675_1000138303 136
126 3300026118 Ga0207675_100073056 Ga0207675_1000730562 136
127 3300026121 Ga0207683_10161979 Ga0207683_101619792 136
128 3300027907 Ga0207428_10050953 Ga0207428_100509532 136
129 3300027907 Ga0207428_10432409 Ga0207428_104324092 136
130 3300027907 Ga0207428_11192468 Ga0207428_111924681 136
131 3300028379 Ga0268266_10339873 Ga0268266_103398732 136
132 3300031247 Ga0265340_10013075 Ga0265340_100130753 136
133 3300031456 Ga0307513_10000005 Ga0307513_10000005226 136
134 3300031456 Ga0307513_10000049 Ga0307513_1000004949 136
135 3300031731 Ga0307405_10264344 Ga0307405_102643442 136
136 3300031824 Ga0307413_10084728 Ga0307413_100847281 136
137 3300031824 Ga0307413_10255952 Ga0307413_102559522 136
138 3300031852 Ga0307410_10219964 Ga0307410_102199643 136
139 3300031852 Ga0307410_10882532 Ga0307410_108825322 136
140 3300031852 Ga0307410_11214653 Ga0307410_112146531 136
141 3300031901 Ga0307406_10796679 Ga0307406_107966791 136
142 3300031903 Ga0307407_10156979 Ga0307407_101569792 136
143 3300031911 Ga0307412_11530183 Ga0307412_115301831 136
144 3300031995 Ga0307409_100050091 Ga0307409_1000500911 136
145 3300031995 Ga0307409_100417298 Ga0307409_1004172982 136
146 3300032002 Ga0307416_100369515 Ga0307416_1003695152 136
147 3300032002 Ga0307416_100588289 Ga0307416_1005882892 136
148 3300032002 Ga0307416_101837443 Ga0307416_1018374431 136
149 3300032004 Ga0307414_11055065 Ga0307414_110550652 136
150 3300032004 Ga0307414_11617654 Ga0307414_116176542 136
151 3300032005 Ga0307411_10521783 Ga0307411_105217832 136
152 3300032005 Ga0307411_10701268 Ga0307411_107012681 136
153 3300032126 Ga0307415_100098551 Ga0307415_1000985514 136
154 3300032126 Ga0307415_100189878 Ga0307415_1001898782 136
155 3300032126 Ga0307415_100201385 Ga0307415_1002013852 136
156 3300032126 Ga0307415_100652483 Ga0307415_1006524832 136
157 3300037471 Ga0395905_0000126 Ga0395905_0000126_66694_67104 136
158 3300041451 Ga0451791_0301133 Ga0451791_0301133_151_561 136
159 3300041452 Ga0451793_0253088 Ga0451793_0253088_50_460 136
160 3300041460 Ga0451802_1307413 Ga0451802_1307413_145_555 136
161 3300041486 Ga0451807_1795226 Ga0451807_1795226_118_528 136
162 3300041491 Ga0451833_1112044 Ga0451833_1112044_28_438 136
163 3300041494 Ga0451837_0420384 Ga0451837_0420384_382_792 136
164 3300042157 Ga0439458_0057560 Ga0439458_0057560_149_559 136
165 3300044656 Ga0466969_0038630 Ga0466969_0038630_569_979 136
166 3300044658 Ga0466972_0025187 Ga0466972_0025187_492_911 136
167 3300044683 Ga0466965_0012302 Ga0466965_0012302_1465_1875 136
168 3300044683 Ga0466965_0525967 Ga0466965_0525967_135_545 136
169 3300044765 Ga0466970_0012739 Ga0466970_0012739_3461_3880 136
170 3300044765 Ga0466970_0411914 Ga0466970_0411914_55_465 136
171 3300044901 Ga0466960_0168129 Ga0466960_0168129_342_752 136
172 3300045976 Ga0466967_0021594 Ga0466967_0021594_3124_3534 136
173 3300046528 Ga0495642_0070646 Ga0495642_0070646_558_968 136
174 3300046616 Ga0495668_0265917 Ga0495668_0265917_517_927 136
175 3300046674 Ga0495588_0125856 Ga0495588_0125856_341_760 136
176 3300047445 Ga0495677_0042291 Ga0495677_0042291_971_1381 136
177 3300047447 Ga0495685_080236 Ga0495685_080236_132_542 136
178 3300047470 Ga0495681_0340730 Ga0495681_0340730_76_486 136
179 3300048906 Ga0496103_0377856 Ga0496103_0377856_476_886 136
180 3300048907 Ga0496104_0356631 Ga0496104_0356631_45_464 136
181 3300048909 Ga0496106_0053855 Ga0496106_0053855_1199_1618 136
182 3300048910 Ga0496107_0077531 Ga0496107_0077531_1820_2230 136
183 3300048910 Ga0496107_0542703 Ga0496107_0542703_106_525 136
184 3300048911 Ga0496108_0192718 Ga0496108_0192718_250_660 136
185 3300048912 Ga0496109_0685470 Ga0496109_0685470_36_446 136
186 3300048915 Ga0496112_1523234 Ga0496112_1523234_35_445 136
187 3300048916 Ga0496113_0109300 Ga0496113_0109300_674_1084 136
188 3300048916 Ga0496113_1387079 Ga0496113_1387079_35_445 136
189 3300048917 Ga0496114_1723349 Ga0496114_1723349_17_427 136
190 3300048922 Ga0496119_0010658 Ga0496119_0010658_4826_5245 136
191 3300048924 Ga0496121_0018498 Ga0496121_0018498_1224_1643 136
192 3300049568 Ga0501031_0105038 Ga0501031_0105038_546_965 136
193 3300049570 Ga0501033_0000902 Ga0501033_0000902_19533_19943 136
194 3300049570 Ga0501033_0200142 Ga0501033_0200142_130_549 136
195 3300049572 Ga0501036_0062792 Ga0501036_0062792_992_1411 136
196 3300049572 Ga0501036_1088361 Ga0501036_1088361_134_544 136
197 3300049572 Ga0501036_1218578 Ga0501036_1218578_130_540 136
198 3300049573 Ga0501037_0302953 Ga0501037_0302953_336_755 136
199 3300049574 Ga0501038_0254993 Ga0501038_0254993_867_1286 136
200 3300049575 Ga0501039_0044234 Ga0501039_0044234_2962_3381 136
201 3300049576 Ga0501040_0006036 Ga0501040_0006036_789_1208 136
202 3300049576 Ga0501040_0194399 Ga0501040_0194399_975_1385 136
203 3300049578 Ga0501042_0058330 Ga0501042_0058330_249_668 136
204 3300049579 Ga0501043_0502474 Ga0501043_0502474_213_632 136
205 3300049580 Ga0501046_0043841 Ga0501046_0043841_1012_1431 136
206 3300049581 Ga0501047_0115284 Ga0501047_0115284_1495_1938 136
207 3300049582 Ga0501048_0048081 Ga0501048_0048081_2183_2602 136
208 3300049582 Ga0501048_0447459 Ga0501048_0447459_343_753 136
209 3300049582 Ga0501048_0832610 Ga0501048_0832610_214_624 136
210 3300049585 Ga0501069_0119479 Ga0501069_0119479_385_804 136
211 3300049585 Ga0501069_0535795 Ga0501069_0535795_269_679 136
212 3300049586 Ga0501070_0490340 Ga0501070_0490340_165_584 136
213 3300049587 Ga0501071_0066995 Ga0501071_0066995_844_1263 136
214 3300049587 Ga0501071_0479657 Ga0501071_0479657_522_932 136
215 3300049587 Ga0501071_0485331 Ga0501071_0485331_304_714 136
216 3300049588 Ga0501072_0439413 Ga0501072_0439413_193_603 136
217 3300049588 Ga0501072_0440278 Ga0501072_0440278_442_861 136
218 3300049590 Ga0501074_0201778 Ga0501074_0201778_937_1356 136
219 3300049590 Ga0501074_0877219 Ga0501074_0877219_54_464 136
220 3300049591 Ga0501075_0032603 Ga0501075_0032603_1189_1608 136
221 3300049592 Ga0501076_0045053 Ga0501076_0045053_1360_1779 136
222 3300049593 Ga0501077_0095445 Ga0501077_0095445_529_948 136
223 3300049741 Ga0501079_0134123 Ga0501079_0134123_1338_1757 136
224 3300049743 Ga0501081_0054943 Ga0501081_0054943_672_1091 136
225 3300049744 Ga0501083_1040317 Ga0501083_1040317_53_472 136
226 3300049768 Ga0501271_022616 Ga0501271_022616_306_716 136
227 3300049823 Ga0501044_0338434 Ga0501044_0338434_244_654 136
228 3300049824 Ga0501045_0180133 Ga0501045_0180133_666_1085 136
229 3300049824 Ga0501045_0218566 Ga0501045_0218566_654_1064 136
230 3300049824 Ga0501045_0574937 Ga0501045_0574937_155_565 136
231 3300050492 nmdc:mga0yw44_289335_c1 nmdc:mga0yw44_289335_c1_75_485 136
232 3300050492 nmdc:mga0yw44_37504_c1 nmdc:mga0yw44_37504_c1_1928_2347 136
233 3300050492 nmdc:mga0yw44_516906_c1 nmdc:mga0yw44_516906_c1_280_690 136
234 3300050496 nmdc:mga07m45_899426_c1 nmdc:mga07m45_899426_c1_17_427 136
235 3300050507 nmdc:mga05p37_1400000_c1 nmdc:mga05p37_1400000_c1_100_510 136
236 3300050507 nmdc:mga05p37_6142_c1 nmdc:mga05p37_6142_c1_11278_11688 136
237 3300050508 nmdc:mga09592_105724_c1 nmdc:mga09592_105724_c1_397_807 136
238 3300050509 nmdc:mga0qj67_33336_c1 nmdc:mga0qj67_33336_c1_1488_1898 136
239 3300050510 nmdc:mga06r32_3846_c1 nmdc:mga06r32_3846_c1_11320_11730 136
240 3300050510 nmdc:mga06r32_849981_c1 nmdc:mga06r32_849981_c1_285_695 136
241 3300050511 nmdc:mga08y16_145841_c1 nmdc:mga08y16_145841_c1_715_1125 136
242 3300050511 nmdc:mga08y16_1470190_c1 nmdc:mga08y16_1470190_c1_175_585 136
243 3300050511 nmdc:mga08y16_527453_c1 nmdc:mga08y16_527453_c1_571_981 136
244 3300053083 Ga0495655_0051144 Ga0495655_0051144_499_909 136
245 3300053088 Ga0500644_0064540 Ga0500644_0064540_433_843 136
246 3300053142 Ga0500577_0035470 Ga0500577_0035470_659_1069 136
247 3300053153 Ga0500616_0026933 Ga0500616_0026933_1756_2166 136
248 3300054114 Ga0501084_0659268 Ga0501084_0659268_403_813 136
249 3300054114 Ga0501084_0910175 Ga0501084_0910175_90_500 136
250 3300060353 Ga0501082_0219995 Ga0501082_0219995_1092_1511 136
251 3300060353 Ga0501082_0306593 Ga0501082_0306593_703_1113 136
252 3300060353 Ga0501082_0718992 Ga0501082_0718992_176_586 136
253 3300061734 Ga0530510_0099516 Ga0530510_0099516_1368_1787 136
254 3300061734 Ga0530510_0247487 Ga0530510_0247487_545_964 136
255 3300003578 Ga0006562J51391_1053254 Ga0006562J51391_10532542 137
256 3300049822 Ga0501035_0421106 Ga0501035_0421106_377_802 137
257 3300031731 Ga0307405_10642301 Ga0307405_106423012 138
258 3300037312 Ga0395899_0156712 Ga0395899_0156712_46_462 138
259 3300037418 Ga0395900_0007797 Ga0395900_0007797_8654_9070 138
260 3300037466 Ga0395898_0023258 Ga0395898_0023258_4563_4979 138
261 3300037471 Ga0395905_0009117 Ga0395905_0009117_1460_1876 138
262 3300041512 Ga0451853_3164613 Ga0451853_3164613_113_529 138
263 3300054114 Ga0501084_1051221 Ga0501084_1051221_252_668 138
264 3300025302 Ga0207426_1006905 Ga0207426_10069054 139
265 3300049575 Ga0501039_1389365 Ga0501039_1389365_68_487 139
266 3300014326 Ga0157380_10805811 Ga0157380_108058112 140
267 3300031901 Ga0307406_10793075 Ga0307406_107930752 140
268 3300049744 Ga0501083_0357243 Ga0501083_0357243_331_753 140
269 iso_pu_bacteria 2643221714 2644632754 140
270 3300050511 nmdc:mga08y16_1907076_c1 nmdc:mga08y16_1907076_c1_71_496 141
271 3300003354 JGI25160J50197_1011683 JGI25160J50197_10116833 144
272 3300009036 Ga0105244_10164771 Ga0105244_101647711 144
273 3300009148 Ga0105243_10316551 Ga0105243_103165512 144
274 3300025302 Ga0207426_1002187 Ga0207426_10021872 144
275 3300025935 Ga0207709_10123496 Ga0207709_101234962 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

158

0.81

PF18029

Glyoxalase_6

Glyoxalase-like domain

33

159

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8995 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.897 2 134
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8931 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8926 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8864 1 135
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9367 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9347 83 134 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8795 84 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8675 83 132 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8647 84 134 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3EIF2-F1-model_v4 VOC family protein 0.9858 85 136
AF-A0A839FK49-F1-model_v4 AraC-like DNA-binding protein 0.9823 1 135 GO:0003700
GO:0043565
AF-A0A5P9PCY0-F1-model_v4 Glyoxalase-like domain protein 0.9808 1 136
AF-A0A6I6F2T9-F1-model_v4 VOC family protein 0.9804 1 136
AF-A0A5M7CC86-F1-model_v4 VOC family protein 0.9792 1 136

Feature Viewer

pLDDT pTM Quality
91.49 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map