F380048

General Info

Members Datasets Scaffolds Average Seq Length
274 151 270 263

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_003487|Ga0500643_003487_1852_2649
Length 265
Sequence LATPSALVNVMIEAARKAGRGLVRDFGEVGELQVSKKGAADFVSAADIKAEQTLFEMLEKARPGYSFLGEERGLIEGSDKSHRWIVDPIDGTTNFIHAIPHFAISIGLEREGAIAASVVYNPVTNELYWAERGKGAYLNNETRLRVSARRNLDEAVLATGIPFLGHGQHAKFLKELHQISQRVAGVRRFGAASLDLAYVAAGRFDGFWERDLKVWDIAAGLLLVTEAGGKISEIDGADVMDTGNILATNTELHGLVQARLQAASA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0
Rhizoplane 5.47
Rhizosphere 77.37
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100000013 3300005331 Bacteria 250768
2 Ga0070670_100048653 3300005331 Bacteria 3648
3 Ga0070670_100242077 3300005331 Bacteria 1571
4 Ga0070666_10020388 3300005335 Bacteria 4285
5 Ga0070680_100010163 3300005336 Bacteria 7258
6 Ga0070680_100064198 3300005336 Bacteria 3009
7 Ga0070691_10051489 3300005341 Bacteria 1966
8 Ga0070668_100002342 3300005347 Bacteria 13925
9 Ga0070668_100015901 3300005347 Bacteria 5629
10 Ga0070668_100016480 3300005347 Bacteria 5526
11 Ga0070668_100023831 3300005347 Bacteria 4633
12 Ga0070671_100005043 3300005355 Bacteria 10529
13 Ga0070667_100014270 3300005367 Bacteria 6562
14 Ga0070667_100015181 3300005367 Bacteria 6362
15 Ga0070667_100023814 3300005367 Bacteria 5083
16 Ga0070667_100029289 3300005367 Bacteria 4587
17 Ga0070663_100020412 3300005455 Bacteria 4388
18 Ga0070681_10044236 3300005458 Bacteria 4456
19 Ga0070681_10046040 3300005458 Bacteria 4362
20 Ga0070681_10117196 3300005458 Bacteria 2599
21 Ga0070679_100042284 3300005530 Bacteria 4537
22 Ga0070665_100001028 3300005548 Bacteria 34986
23 Ga0070665_100020888 3300005548 Bacteria 6580
24 Ga0070665_100035576 3300005548 Bacteria 5008
25 Ga0070665_100101261 3300005548 Bacteria 2885
26 Ga0068855_100036376 3300005563 Bacteria 5860
27 Ga0068855_100096735 3300005563 Bacteria 3401
28 Ga0068855_100274569 3300005563 Bacteria 1873
29 Ga0070664_100094188 3300005564 Bacteria 2597
30 Ga0068854_100116546 3300005578 Bacteria 2022
31 Ga0068856_100254331 3300005614 Bacteria 1772
32 Ga0068852_100516988 3300005616 Bacteria 1191
33 Ga0068859_100000747 3300005617 Bacteria 32789
34 Ga0068859_100008320 3300005617 Bacteria 10513
35 Ga0068864_100000453 3300005618 Bacteria 35448
36 Ga0068864_100256077 3300005618 Bacteria 1627
37 Ga0068861_100011288 3300005719 Bacteria 6203
38 Ga0068863_100000423 3300005841 Bacteria 42817
39 Ga0068863_100006424 3300005841 Bacteria 11527
40 Ga0068863_100032292 3300005841 Bacteria 4990
41 Ga0068863_100059212 3300005841 Bacteria 3624
42 Ga0068863_100392523 3300005841 Bacteria 1356
43 Ga0068858_100001493 3300005842 Bacteria 24115
44 Ga0068858_100007627 3300005842 Bacteria 10451
45 Ga0068858_100149162 3300005842 Bacteria 2198
46 Ga0068860_100000167 3300005843 Bacteria 108234
47 Ga0068860_100000327 3300005843 Bacteria 64590
48 Ga0068860_100059968 3300005843 Bacteria 3617
49 Ga0068860_100805486 3300005843 Bacteria 953
50 Ga0068862_100014392 3300005844 Bacteria 6563
51 Ga0068862_100035416 3300005844 Bacteria 4227
52 Ga0068862_100045557 3300005844 Bacteria 3742
53 Ga0068862_100060384 3300005844 Bacteria 3256
54 Ga0068862_100085686 3300005844 Bacteria 2738
55 Ga0075368_10002336 3300006042 Bacteria 6163
56 Ga0075364_10001270 3300006051 Bacteria 13575
57 Ga0075366_10106328 3300006195 Bacteria 1687
58 Ga0075370_10020033 3300006353 Bacteria 3649
59 Ga0097620_100000747 3300006931 Bacteria 32789
60 Ga0097620_100008320 3300006931 Bacteria 10513
61 Ga0105240_10005226 3300009093 Bacteria 19415
62 Ga0105240_10005496 3300009093 Bacteria 18888
63 Ga0105240_10067434 3300009093 Bacteria 4435
64 Ga0105240_10557052 3300009093 Bacteria 1267
65 Ga0105240_10625839 3300009093 Bacteria 1182
66 Ga0105241_10150525 3300009174 Bacteria 1903
67 Ga0105248_10000661 3300009177 Bacteria 39161
68 Ga0105248_10016266 3300009177 Bacteria 8188
69 Ga0105248_10094095 3300009177 Bacteria 3374
70 Ga0105248_10111484 3300009177 Bacteria 3085
71 Ga0105248_10133302 3300009177 Bacteria 2803
72 Ga0105237_10508107 3300009545 Bacteria 1212
73 Ga0105249_10023878 3300009553 Bacteria 5492
74 Ga0105032_105331 3300009979 Bacteria 1082
75 Ga0157373_10423630 3300013100 Bacteria 956
76 Ga0163162_10050920 3300013306 Bacteria 4154
77 Ga0163162_10528468 3300013306 Bacteria 1309
78 Ga0163162_10795056 3300013306 Bacteria 1063
79 Ga0157372_10149661 3300013307 Bacteria 2693
80 Ga0157375_10121632 3300013308 Bacteria 2720
81 Ga0163163_10045977 3300014325 Bacteria 4286
82 Ga0157379_10002854 3300014968 Bacteria 14564
83 Ga0157379_10068022 3300014968 Bacteria 3184
84 Ga0213876_10000186 3300021384 Bacteria 64451
85 Ga0207680_10194228 3300025903 Bacteria 1380
86 Ga0207680_10226375 3300025903 Bacteria 1284
87 Ga0207645_10270738 3300025907 Bacteria 1126
88 Ga0207705_10002746 3300025909 Bacteria 13489
89 Ga0207707_10021959 3300025912 Bacteria 5578
90 Ga0207707_10049670 3300025912 Bacteria 3654
91 Ga0207707_10090557 3300025912 Bacteria 2673
92 Ga0207695_10002453 3300025913 Bacteria 27412
93 Ga0207695_10003006 3300025913 Bacteria 24241
94 Ga0207695_10003703 3300025913 Bacteria 21297
95 Ga0207695_10012854 3300025913 Bacteria 10022
96 Ga0207695_10075882 3300025913 Bacteria 3419
97 Ga0207695_10138205 3300025913 Bacteria 2388
98 Ga0207695_10164382 3300025913 Bacteria 2148
99 Ga0207671_10325193 3300025914 Bacteria 1217
100 Ga0207660_10001373 3300025917 Bacteria 16319
101 Ga0207660_10090734 3300025917 Bacteria 2265
102 Ga0207660_10195982 3300025917 Bacteria 1575
103 Ga0207662_10266096 3300025918 Bacteria 1130
104 Ga0207657_10259320 3300025919 Bacteria 1384
105 Ga0207649_10337096 3300025920 Bacteria 1112
106 Ga0207652_10081148 3300025921 Bacteria 2837
107 Ga0207681_10071549 3300025923 Bacteria 2419
108 Ga0207694_10067829 3300025924 Bacteria 2785
109 Ga0207694_10115305 3300025924 Bacteria 2140
110 Ga0207650_10000074 3300025925 Bacteria 134837
111 Ga0207644_10006651 3300025931 Bacteria 7534
112 Ga0207644_10009249 3300025931 Bacteria 6464
113 Ga0207644_10038448 3300025931 Bacteria 3371
114 Ga0207690_10000650 3300025932 Bacteria 22303
115 Ga0207704_10034871 3300025938 Bacteria 2876
116 Ga0207691_10638459 3300025940 Bacteria 900
117 Ga0207711_10000316 3300025941 Bacteria 51683
118 Ga0207711_10007833 3300025941 Bacteria 8930
119 Ga0207711_10073529 3300025941 Bacteria 2971
120 Ga0207711_10082929 3300025941 Bacteria 2803
121 Ga0207689_10112605 3300025942 Bacteria 2237
122 Ga0207679_10042259 3300025945 Bacteria 3275
123 Ga0207667_10030723 3300025949 Bacteria 5806
124 Ga0207667_10088186 3300025949 Bacteria 3209
125 Ga0207667_10294459 3300025949 Bacteria 1658
126 Ga0207712_10000835 3300025961 Bacteria 22611
127 Ga0207712_10111704 3300025961 Bacteria 2051
128 Ga0207668_10000001 3300025972 Bacteria 266091
129 Ga0207668_10000093 3300025972 Bacteria 64280
130 Ga0207668_10024183 3300025972 Bacteria 3916
131 Ga0207640_10135562 3300025981 Bacteria 1787
132 Ga0207658_10000266 3300025986 Bacteria 55102
133 Ga0207658_10020077 3300025986 Bacteria 4625
134 Ga0207658_10023993 3300025986 Bacteria 4262
135 Ga0207658_10049229 3300025986 Bacteria 3095
136 Ga0207703_10000853 3300026035 Bacteria 29885
137 Ga0207703_10005094 3300026035 Bacteria 10628
138 Ga0207703_10175025 3300026035 Bacteria 1890
139 Ga0207639_10018290 3300026041 Bacteria 4979
140 Ga0207702_10133412 3300026078 Bacteria 2237
141 Ga0207641_10000830 3300026088 Bacteria 32877
142 Ga0207641_10009231 3300026088 Bacteria 8134
143 Ga0207641_10009957 3300026088 Bacteria 7825
144 Ga0207641_10040077 3300026088 Bacteria 3919
145 Ga0207641_10436532 3300026088 Bacteria 1263
146 Ga0207676_10000073 3300026095 Bacteria 101510
147 Ga0207676_10006395 3300026095 Bacteria 8322
148 Ga0207676_10011655 3300026095 Bacteria 6288
149 Ga0207674_10331281 3300026116 Bacteria 1472
150 Ga0207675_100059381 3300026118 Bacteria 3569
151 Ga0207675_100208957 3300026118 Bacteria 1877
152 Ga0207698_10515966 3300026142 Bacteria 1165
153 Ga0209813_10005309 3300027866 Bacteria 3119
154 Ga0268266_10000189 3300028379 Bacteria 109217
155 Ga0268266_10000289 3300028379 Bacteria 82515
156 Ga0268266_10011395 3300028379 Bacteria 7731
157 Ga0268265_10002313 3300028380 Bacteria 14498
158 Ga0268265_10002789 3300028380 Bacteria 12875
159 Ga0268265_10032194 3300028380 Bacteria 3796
160 Ga0268265_10038125 3300028380 Bacteria 3533
161 Ga0268265_10069037 3300028380 Bacteria 2743
162 Ga0268265_10270232 3300028380 Bacteria 1516
163 Ga0268264_10000002 3300028381 Bacteria 1153045
164 Ga0268264_10000068 3300028381 Bacteria 275708
165 Ga0268264_10012786 3300028381 Bacteria 6908
166 Ga0268264_10014614 3300028381 Bacteria 6451
167 Ga0265334_10002554 3300028573 Bacteria 8494
168 Ga0307517_10005913 3300028786 Bacteria 18260
169 Ga0307517_10072212 3300028786 Bacteria 3080
170 Ga0265338_10050223 3300028800 Bacteria 3772
171 Ga0265338_10090754 3300028800 Bacteria 2528
172 Ga0265340_10043199 3300031247 Bacteria 2210
173 Ga0265327_10000198 3300031251 Bacteria 126077
174 Ga0265327_10096096 3300031251 Bacteria 1437
175 Ga0307513_10000127 3300031456 Bacteria 107100
176 Ga0307513_10005691 3300031456 Bacteria 16403
177 Ga0307513_10006289 3300031456 Bacteria 15552
178 Ga0307513_10015298 3300031456 Bacteria 9306
179 Ga0307516_10000035 3300031730 Bacteria 152658
180 Ga0307413_10464691 3300031824 Bacteria 1008
181 Ga0307414_10335302 3300032004 Bacteria 1292
182 Ga0307510_10007326 3300033180 Bacteria 13142
183 Ga0307510_10041503 3300033180 Bacteria 5029
184 Ga0373935_0062422 3300035692 Bacteria 2387
185 Ga0373927_0049446 3300035695 Bacteria 2718
186 Ga0373937_0281112 3300036401 Bacteria 1572
187 Ga0373925_0000003 3300037068 Bacteria 362401
188 Ga0395899_0000854 3300037312 Bacteria 29169
189 Ga0395899_0109533 3300037312 Bacteria 1987
190 Ga0395900_0000072 3300037418 Bacteria 187428
191 Ga0395900_0007156 3300037418 Bacteria 11565
192 Ga0395898_0013377 3300037466 Bacteria 8452
193 Ga0395898_0043219 3300037466 Bacteria 4441
194 Ga0395905_0005411 3300037471 Bacteria 13044
195 Ga0395905_0007741 3300037471 Bacteria 10656
196 Ga0395905_0024735 3300037471 Bacteria 5667
197 Ga0395905_0043821 3300037471 Bacteria 4198
198 Ga0395905_0162010 3300037471 Bacteria 2102
199 Ga0395905_0179914 3300037471 Bacteria 1985
200 Ga0395905_0220375 3300037471 Bacteria 1775
201 Ga0436364_0234908 3300037853 Bacteria 3249
202 Ga0436364_0254679 3300037853 Bacteria 1122
203 Ga0395901_0000052 3300038443 Bacteria 165888
204 Ga0436365_1749383 3300039437 Bacteria 956
205 Ga0436365_1817404 3300039437 Bacteria 978
206 Ga0436365_1884511 3300039437 Bacteria 98004
207 Ga0436360_0443561 3300039438 Bacteria 1590
208 Ga0436361_1110998 3300039447 Bacteria 21889
209 Ga0436363_0112210 3300039450 Bacteria 1793
210 Ga0439434_0057135 3300042435 Bacteria 1216
211 Ga0466972_0247252 3300044658 Bacteria 834
212 Ga0453684_0365670 3300044712 Bacteria 1623
213 Ga0466960_0037334 3300044901 Bacteria 2279
214 Ga0495583_0049190 3300046506 Bacteria 1932
215 Ga0495620_0122293 3300046515 Bacteria 1025
216 Ga0495642_0005810 3300046528 Bacteria 4731
217 Ga0495598_0126140 3300046537 Bacteria 873
218 Ga0495668_0026560 3300046616 Bacteria 3285
219 Ga0495611_0011660 3300046648 Bacteria 3729
220 Ga0495669_0000002 3300046684 Bacteria 282777
221 Ga0495669_0001650 3300046684 Bacteria 9170
222 Ga0495669_0006972 3300046684 Bacteria 4732
223 Ga0495669_0023102 3300046684 Bacteria 2705
224 Ga0495672_0019869 3300047320 Bacteria 4418
225 Ga0495677_0019147 3300047445 Bacteria 2483
226 Ga0496102_0009240 3300048905 Bacteria 8458
227 Ga0496102_0289746 3300048905 Bacteria 1543
228 Ga0496104_0374337 3300048907 Bacteria 1337
229 Ga0496106_0371410 3300048909 Bacteria 1149
230 Ga0496107_0049973 3300048910 Bacteria 3014
231 Ga0496109_0025315 3300048912 Bacteria 5287
232 Ga0496112_0239023 3300048915 Bacteria 1769
233 Ga0496112_0609544 3300048915 Bacteria 1023
234 Ga0496112_0842971 3300048915 Bacteria 840
235 Ga0496113_0087836 3300048916 Bacteria 2391
236 Ga0496115_0001097 3300048918 Bacteria 19591
237 Ga0496115_0002362 3300048918 Bacteria 13536
238 Ga0496115_0048471 3300048918 Bacteria 3398
239 Ga0496115_0136302 3300048918 Bacteria 2024
240 Ga0496115_0351451 3300048918 Bacteria 1202
241 Ga0496116_0067404 3300048919 Bacteria 2286
242 Ga0496118_0005744 3300048921 Bacteria 13955
243 Ga0496119_0043149 3300048922 Bacteria 2853
244 Ga0496121_0000397 3300048924 Bacteria 87422
245 Ga0501032_0028322 3300049569 Bacteria 3850
246 Ga0501033_0022133 3300049570 Bacteria 4796
247 Ga0501043_0138810 3300049579 Bacteria 1904
248 Ga0501043_0312073 3300049579 Bacteria 1200
249 Ga0501047_0010382 3300049581 Bacteria 8811
250 Ga0501257_006080 3300049686 Bacteria 2674
251 Ga0501044_0008645 3300049823 Bacteria 11152
252 Ga0501044_0111601 3300049823 Bacteria 2742
253 nmdc:mga00v17_1199_c1 3300050491 Bacteria 13575
254 nmdc:mga0k408_96955_c1 3300050493 Bacteria 1736
255 nmdc:mga06z11_1695_c1 3300050494 Bacteria 8272
256 nmdc:mga07m45_21398_c1 3300050496 Bacteria 3522
257 nmdc:mga0sz30_175877_c1 3300050516 Bacteria 949
258 Ga0500643_003487 3300053087 Bacteria 7555
259 Ga0500643_012721 3300053087 Bacteria 3004
260 Ga0500641_0013996 3300053096 Bacteria 2954
261 Ga0500641_0015908 3300053096 Bacteria 2797
262 Ga0500556_0004024 3300053104 Bacteria 4231
263 Ga0500562_002990 3300053108 Bacteria 4215
264 Ga0500562_003254 3300053108 Bacteria 4061
265 Ga0500562_009076 3300053108 Bacteria 2514
266 Ga0500595_004052 3300053119 Bacteria 6665
267 Ga0500616_0011733 3300053153 Bacteria 5159
268 Ga0500622_0012713 3300053156 Bacteria 4553
269 Ga0500645_000604 3300053730 Bacteria 23015
270 Ga0500645_001214 3300053730 Bacteria 13625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053108 Ga0500562_003254 Ga0500562_003254_3343_4038 231
2 iso_pu_bacteria 2643221598 2643998795 250
3 3300005355 Ga0070671_100005043 Ga0070671_1000050434 254
4 3300005841 Ga0068863_100006424 Ga0068863_10000642413 254
5 3300009177 Ga0105248_10000661 Ga0105248_1000066126 254
6 3300009177 Ga0105248_10094095 Ga0105248_100940953 254
7 3300009979 Ga0105032_105331 Ga0105032_1053311 254
8 3300013100 Ga0157373_10423630 Ga0157373_104236301 254
9 3300013306 Ga0163162_10795056 Ga0163162_107950562 254
10 3300013308 Ga0157375_10121632 Ga0157375_101216322 254
11 3300014325 Ga0163163_10045977 Ga0163163_100459772 254
12 3300025931 Ga0207644_10006651 Ga0207644_100066514 254
13 3300025931 Ga0207644_10009249 Ga0207644_100092499 254
14 3300025942 Ga0207689_10112605 Ga0207689_101126051 254
15 3300026088 Ga0207641_10009231 Ga0207641_100092314 254
16 3300031456 Ga0307513_10000127 Ga0307513_1000012750 254
17 3300037312 Ga0395899_0000854 Ga0395899_0000854_24499_25266 254
18 3300037312 Ga0395899_0109533 Ga0395899_0109533_459_1241 254
19 3300037418 Ga0395900_0000072 Ga0395900_0000072_69781_70548 254
20 3300037466 Ga0395898_0013377 Ga0395898_0013377_6921_7688 254
21 3300037471 Ga0395905_0005411 Ga0395905_0005411_6127_6894 254
22 3300037471 Ga0395905_0007741 Ga0395905_0007741_4002_4769 254
23 3300037471 Ga0395905_0043821 Ga0395905_0043821_73_846 254
24 3300038443 Ga0395901_0000052 Ga0395901_0000052_56287_57054 254
25 3300039437 Ga0436365_1749383 Ga0436365_1749383_168_932 254
26 3300046506 Ga0495583_0049190 Ga0495583_0049190_171_938 254
27 3300046515 Ga0495620_0122293 Ga0495620_0122293_58_825 254
28 3300046528 Ga0495642_0005810 Ga0495642_0005810_3059_3826 254
29 3300046648 Ga0495611_0011660 Ga0495611_0011660_907_1674 254
30 3300046684 Ga0495669_0000002 Ga0495669_0000002_49846_50610 254
31 3300046684 Ga0495669_0001650 Ga0495669_0001650_4931_5695 254
32 3300046684 Ga0495669_0023102 Ga0495669_0023102_466_1233 254
33 3300047445 Ga0495677_0019147 Ga0495677_0019147_1029_1793 254
34 3300048905 Ga0496102_0009240 Ga0496102_0009240_3937_4704 254
35 3300048907 Ga0496104_0374337 Ga0496104_0374337_455_1219 254
36 3300048910 Ga0496107_0049973 Ga0496107_0049973_890_1657 254
37 3300048912 Ga0496109_0025315 Ga0496109_0025315_1530_2297 254
38 3300048915 Ga0496112_0239023 Ga0496112_0239023_62_829 254
39 3300048915 Ga0496112_0842971 Ga0496112_0842971_48_815 254
40 3300048916 Ga0496113_0087836 Ga0496113_0087836_1305_2072 254
41 3300048918 Ga0496115_0001097 Ga0496115_0001097_8492_9259 254
42 3300048918 Ga0496115_0048471 Ga0496115_0048471_53_820 254
43 3300048918 Ga0496115_0136302 Ga0496115_0136302_735_1517 254
44 3300050516 nmdc:mga0sz30_175877_c1 nmdc:mga0sz30_175877_c1_57_821 254
45 3300053096 Ga0500641_0015908 Ga0500641_0015908_1369_2133 254
46 3300053108 Ga0500562_009076 Ga0500562_009076_1363_2127 254
47 3300046616 Ga0495668_0026560 Ga0495668_0026560_2496_3269 257
48 3300049823 Ga0501044_0111601 Ga0501044_0111601_1007_1783 257
49 iso_pu_bacteria 2643221614 2644087175 260
50 iso_pu_bacteria 2643221661 2644342129 260
51 iso_pu_bacteria 2643221666 2644368415 260
52 3300026116 Ga0207674_10331281 Ga0207674_103312811 263
53 3300053087 Ga0500643_003487 Ga0500643_003487_1852_2649 263
54 3300053096 Ga0500641_0013996 Ga0500641_0013996_51_848 263
55 3300053104 Ga0500556_0004024 Ga0500556_0004024_1486_2283 263
56 3300053108 Ga0500562_002990 Ga0500562_002990_438_1235 263
57 3300053153 Ga0500616_0011733 Ga0500616_0011733_224_1021 263
58 3300053156 Ga0500622_0012713 Ga0500622_0012713_1518_2315 263
59 3300053730 Ga0500645_000604 Ga0500645_000604_1852_2649 263
60 3300053730 Ga0500645_001214 Ga0500645_001214_87_884 263
61 3300005331 Ga0070670_100000013 Ga0070670_100000013207 264
62 3300005331 Ga0070670_100048653 Ga0070670_1000486533 264
63 3300005331 Ga0070670_100242077 Ga0070670_1002420772 264
64 3300005335 Ga0070666_10020388 Ga0070666_100203882 264
65 3300005336 Ga0070680_100010163 Ga0070680_1000101634 264
66 3300005336 Ga0070680_100064198 Ga0070680_1000641981 264
67 3300005341 Ga0070691_10051489 Ga0070691_100514891 264
68 3300005347 Ga0070668_100002342 Ga0070668_10000234210 264
69 3300005347 Ga0070668_100015901 Ga0070668_1000159012 264
70 3300005347 Ga0070668_100016480 Ga0070668_1000164803 264
71 3300005347 Ga0070668_100023831 Ga0070668_1000238313 264
72 3300005367 Ga0070667_100014270 Ga0070667_1000142706 264
73 3300005367 Ga0070667_100015181 Ga0070667_1000151816 264
74 3300005367 Ga0070667_100023814 Ga0070667_1000238145 264
75 3300005367 Ga0070667_100029289 Ga0070667_1000292892 264
76 3300005455 Ga0070663_100020412 Ga0070663_1000204122 264
77 3300005458 Ga0070681_10044236 Ga0070681_100442361 264
78 3300005458 Ga0070681_10046040 Ga0070681_100460402 264
79 3300005458 Ga0070681_10117196 Ga0070681_101171962 264
80 3300005530 Ga0070679_100042284 Ga0070679_1000422845 264
81 3300005548 Ga0070665_100001028 Ga0070665_10000102825 264
82 3300005548 Ga0070665_100020888 Ga0070665_1000208883 264
83 3300005548 Ga0070665_100035576 Ga0070665_1000355763 264
84 3300005548 Ga0070665_100101261 Ga0070665_1001012614 264
85 3300005563 Ga0068855_100036376 Ga0068855_1000363763 264
86 3300005563 Ga0068855_100096735 Ga0068855_1000967351 264
87 3300005563 Ga0068855_100274569 Ga0068855_1002745692 264
88 3300005564 Ga0070664_100094188 Ga0070664_1000941881 264
89 3300005578 Ga0068854_100116546 Ga0068854_1001165462 264
90 3300005614 Ga0068856_100254331 Ga0068856_1002543312 264
91 3300005616 Ga0068852_100516988 Ga0068852_1005169882 264
92 3300005617 Ga0068859_100000747 Ga0068859_10000074716 264
93 3300005617 Ga0068859_100008320 Ga0068859_10000832011 264
94 3300005618 Ga0068864_100000453 Ga0068864_10000045324 264
95 3300005618 Ga0068864_100256077 Ga0068864_1002560772 264
96 3300005719 Ga0068861_100011288 Ga0068861_1000112888 264
97 3300005841 Ga0068863_100000423 Ga0068863_10000042315 264
98 3300005841 Ga0068863_100032292 Ga0068863_1000322926 264
99 3300005841 Ga0068863_100059212 Ga0068863_1000592125 264
100 3300005841 Ga0068863_100392523 Ga0068863_1003925232 264
101 3300005842 Ga0068858_100001493 Ga0068858_10000149316 264
102 3300005842 Ga0068858_100007627 Ga0068858_1000076278 264
103 3300005842 Ga0068858_100149162 Ga0068858_1001491622 264
104 3300005843 Ga0068860_100000167 Ga0068860_10000016718 264
105 3300005843 Ga0068860_100000327 Ga0068860_10000032710 264
106 3300005843 Ga0068860_100059968 Ga0068860_1000599683 264
107 3300005843 Ga0068860_100805486 Ga0068860_1008054861 264
108 3300005844 Ga0068862_100014392 Ga0068862_1000143923 264
109 3300005844 Ga0068862_100035416 Ga0068862_1000354164 264
110 3300005844 Ga0068862_100045557 Ga0068862_1000455571 264
111 3300005844 Ga0068862_100060384 Ga0068862_1000603842 264
112 3300005844 Ga0068862_100085686 Ga0068862_1000856863 264
113 3300006042 Ga0075368_10002336 Ga0075368_100023368 264
114 3300006051 Ga0075364_10001270 Ga0075364_100012706 264
115 3300006195 Ga0075366_10106328 Ga0075366_101063281 264
116 3300006353 Ga0075370_10020033 Ga0075370_100200332 264
117 3300006931 Ga0097620_100000747 Ga0097620_10000074725 264
118 3300006931 Ga0097620_100008320 Ga0097620_10000832011 264
119 3300009093 Ga0105240_10005226 Ga0105240_1000522616 264
120 3300009093 Ga0105240_10005496 Ga0105240_100054964 264
121 3300009093 Ga0105240_10067434 Ga0105240_100674343 264
122 3300009093 Ga0105240_10557052 Ga0105240_105570521 264
123 3300009093 Ga0105240_10625839 Ga0105240_106258392 264
124 3300009174 Ga0105241_10150525 Ga0105241_101505253 264
125 3300009177 Ga0105248_10016266 Ga0105248_100162668 264
126 3300009177 Ga0105248_10111484 Ga0105248_101114842 264
127 3300009177 Ga0105248_10133302 Ga0105248_101333023 264
128 3300009545 Ga0105237_10508107 Ga0105237_105081072 264
129 3300009553 Ga0105249_10023878 Ga0105249_100238782 264
130 3300013306 Ga0163162_10050920 Ga0163162_100509206 264
131 3300013306 Ga0163162_10528468 Ga0163162_105284682 264
132 3300013307 Ga0157372_10149661 Ga0157372_101496615 264
133 3300014968 Ga0157379_10002854 Ga0157379_100028546 264
134 3300014968 Ga0157379_10068022 Ga0157379_100680222 264
135 3300021384 Ga0213876_10000186 Ga0213876_1000018622 264
136 3300025903 Ga0207680_10194228 Ga0207680_101942281 264
137 3300025903 Ga0207680_10226375 Ga0207680_102263752 264
138 3300025907 Ga0207645_10270738 Ga0207645_102707382 264
139 3300025909 Ga0207705_10002746 Ga0207705_1000274615 264
140 3300025912 Ga0207707_10021959 Ga0207707_100219592 264
141 3300025912 Ga0207707_10049670 Ga0207707_100496704 264
142 3300025912 Ga0207707_10090557 Ga0207707_100905571 264
143 3300025913 Ga0207695_10002453 Ga0207695_1000245316 264
144 3300025913 Ga0207695_10003006 Ga0207695_100030065 264
145 3300025913 Ga0207695_10003703 Ga0207695_1000370314 264
146 3300025913 Ga0207695_10012854 Ga0207695_1001285411 264
147 3300025913 Ga0207695_10075882 Ga0207695_100758823 264
148 3300025913 Ga0207695_10138205 Ga0207695_101382052 264
149 3300025913 Ga0207695_10164382 Ga0207695_101643822 264
150 3300025914 Ga0207671_10325193 Ga0207671_103251932 264
151 3300025917 Ga0207660_10001373 Ga0207660_100013738 264
152 3300025917 Ga0207660_10090734 Ga0207660_100907342 264
153 3300025917 Ga0207660_10195982 Ga0207660_101959823 264
154 3300025918 Ga0207662_10266096 Ga0207662_102660962 264
155 3300025919 Ga0207657_10259320 Ga0207657_102593201 264
156 3300025920 Ga0207649_10337096 Ga0207649_103370961 264
157 3300025921 Ga0207652_10081148 Ga0207652_100811483 264
158 3300025923 Ga0207681_10071549 Ga0207681_100715492 264
159 3300025924 Ga0207694_10067829 Ga0207694_100678293 264
160 3300025924 Ga0207694_10115305 Ga0207694_101153052 264
161 3300025925 Ga0207650_10000074 Ga0207650_1000007420 264
162 3300025931 Ga0207644_10038448 Ga0207644_100384482 264
163 3300025932 Ga0207690_10000650 Ga0207690_1000065011 264
164 3300025938 Ga0207704_10034871 Ga0207704_100348712 264
165 3300025940 Ga0207691_10638459 Ga0207691_106384591 264
166 3300025941 Ga0207711_10000316 Ga0207711_1000031642 264
167 3300025941 Ga0207711_10007833 Ga0207711_100078338 264
168 3300025941 Ga0207711_10073529 Ga0207711_100735292 264
169 3300025941 Ga0207711_10082929 Ga0207711_100829293 264
170 3300025945 Ga0207679_10042259 Ga0207679_100422592 264
171 3300025949 Ga0207667_10030723 Ga0207667_100307235 264
172 3300025949 Ga0207667_10088186 Ga0207667_100881865 264
173 3300025949 Ga0207667_10294459 Ga0207667_102944592 264
174 3300025961 Ga0207712_10000835 Ga0207712_100008356 264
175 3300025961 Ga0207712_10111704 Ga0207712_101117042 264
176 3300025972 Ga0207668_10000001 Ga0207668_1000000193 264
177 3300025972 Ga0207668_10000093 Ga0207668_1000009318 264
178 3300025972 Ga0207668_10024183 Ga0207668_100241835 264
179 3300025981 Ga0207640_10135562 Ga0207640_101355622 264
180 3300025986 Ga0207658_10000266 Ga0207658_100002666 264
181 3300025986 Ga0207658_10020077 Ga0207658_100200776 264
182 3300025986 Ga0207658_10023993 Ga0207658_100239932 264
183 3300025986 Ga0207658_10049229 Ga0207658_100492293 264
184 3300026035 Ga0207703_10000853 Ga0207703_100008534 264
185 3300026035 Ga0207703_10005094 Ga0207703_100050945 264
186 3300026035 Ga0207703_10175025 Ga0207703_101750252 264
187 3300026041 Ga0207639_10018290 Ga0207639_100182902 264
188 3300026078 Ga0207702_10133412 Ga0207702_101334122 264
189 3300026088 Ga0207641_10000830 Ga0207641_100008305 264
190 3300026088 Ga0207641_10009957 Ga0207641_100099571 264
191 3300026088 Ga0207641_10040077 Ga0207641_100400774 264
192 3300026088 Ga0207641_10436532 Ga0207641_104365322 264
193 3300026095 Ga0207676_10000073 Ga0207676_1000007392 264
194 3300026095 Ga0207676_10006395 Ga0207676_100063956 264
195 3300026095 Ga0207676_10011655 Ga0207676_100116559 264
196 3300026118 Ga0207675_100059381 Ga0207675_1000593813 264
197 3300026118 Ga0207675_100208957 Ga0207675_1002089572 264
198 3300026142 Ga0207698_10515966 Ga0207698_105159661 264
199 3300027866 Ga0209813_10005309 Ga0209813_100053092 264
200 3300028379 Ga0268266_10000189 Ga0268266_1000018925 264
201 3300028379 Ga0268266_10000289 Ga0268266_1000028992 264
202 3300028379 Ga0268266_10011395 Ga0268266_100113957 264
203 3300028380 Ga0268265_10002313 Ga0268265_100023135 264
204 3300028380 Ga0268265_10002789 Ga0268265_100027893 264
205 3300028380 Ga0268265_10032194 Ga0268265_100321942 264
206 3300028380 Ga0268265_10038125 Ga0268265_100381251 264
207 3300028380 Ga0268265_10069037 Ga0268265_100690373 264
208 3300028380 Ga0268265_10270232 Ga0268265_102702322 264
209 3300028381 Ga0268264_10000002 Ga0268264_1000000270 264
210 3300028381 Ga0268264_10000068 Ga0268264_10000068108 264
211 3300028381 Ga0268264_10012786 Ga0268264_100127863 264
212 3300028381 Ga0268264_10014614 Ga0268264_100146142 264
213 3300028573 Ga0265334_10002554 Ga0265334_100025542 264
214 3300028786 Ga0307517_10005913 Ga0307517_1000591318 264
215 3300028786 Ga0307517_10072212 Ga0307517_100722125 264
216 3300028800 Ga0265338_10050223 Ga0265338_100502232 264
217 3300028800 Ga0265338_10090754 Ga0265338_100907542 264
218 3300031247 Ga0265340_10043199 Ga0265340_100431992 264
219 3300031251 Ga0265327_10000198 Ga0265327_10000198103 264
220 3300031251 Ga0265327_10096096 Ga0265327_100960962 264
221 3300031456 Ga0307513_10005691 Ga0307513_1000569116 264
222 3300031456 Ga0307513_10006289 Ga0307513_1000628914 264
223 3300031456 Ga0307513_10015298 Ga0307513_100152986 264
224 3300031730 Ga0307516_10000035 Ga0307516_10000035119 264
225 3300031824 Ga0307413_10464691 Ga0307413_104646911 264
226 3300032004 Ga0307414_10335302 Ga0307414_103353022 264
227 3300033180 Ga0307510_10007326 Ga0307510_1000732610 264
228 3300033180 Ga0307510_10041503 Ga0307510_100415035 264
229 3300035692 Ga0373935_0062422 Ga0373935_0062422_11_805 264
230 3300035695 Ga0373927_0049446 Ga0373927_0049446_447_1244 264
231 3300036401 Ga0373937_0281112 Ga0373937_0281112_390_1184 264
232 3300037068 Ga0373925_0000003 Ga0373925_0000003_535_1332 264
233 3300037418 Ga0395900_0007156 Ga0395900_0007156_7218_8015 264
234 3300037466 Ga0395898_0043219 Ga0395898_0043219_3282_4079 264
235 3300037471 Ga0395905_0024735 Ga0395905_0024735_1100_1897 264
236 3300037471 Ga0395905_0162010 Ga0395905_0162010_331_1125 264
237 3300037471 Ga0395905_0179914 Ga0395905_0179914_214_1011 264
238 3300037471 Ga0395905_0220375 Ga0395905_0220375_887_1684 264
239 3300037853 Ga0436364_0234908 Ga0436364_0234908_1921_2715 264
240 3300037853 Ga0436364_0254679 Ga0436364_0254679_78_872 264
241 3300039437 Ga0436365_1817404 Ga0436365_1817404_115_909 264
242 3300039437 Ga0436365_1884511 Ga0436365_1884511_14862_15656 264
243 3300039438 Ga0436360_0443561 Ga0436360_0443561_291_1085 264
244 3300039447 Ga0436361_1110998 Ga0436361_1110998_14820_15617 264
245 3300039450 Ga0436363_0112210 Ga0436363_0112210_464_1258 264
246 3300042435 Ga0439434_0057135 Ga0439434_0057135_373_1167 264
247 3300044658 Ga0466972_0247252 Ga0466972_0247252_22_816 264
248 3300044712 Ga0453684_0365670 Ga0453684_0365670_325_1128 264
249 3300044901 Ga0466960_0037334 Ga0466960_0037334_1408_2202 264
250 3300046537 Ga0495598_0126140 Ga0495598_0126140_33_827 264
251 3300046684 Ga0495669_0006972 Ga0495669_0006972_2702_3499 264
252 3300047320 Ga0495672_0019869 Ga0495672_0019869_43_840 264
253 3300048905 Ga0496102_0289746 Ga0496102_0289746_463_1257 264
254 3300048909 Ga0496106_0371410 Ga0496106_0371410_291_1085 264
255 3300048915 Ga0496112_0609544 Ga0496112_0609544_92_901 264
256 3300048918 Ga0496115_0002362 Ga0496115_0002362_6927_7724 264
257 3300048918 Ga0496115_0351451 Ga0496115_0351451_203_997 264
258 3300048919 Ga0496116_0067404 Ga0496116_0067404_204_998 264
259 3300048921 Ga0496118_0005744 Ga0496118_0005744_10586_11380 264
260 3300048922 Ga0496119_0043149 Ga0496119_0043149_1054_1848 264
261 3300048924 Ga0496121_0000397 Ga0496121_0000397_3506_4300 264
262 3300049569 Ga0501032_0028322 Ga0501032_0028322_2750_3547 264
263 3300049570 Ga0501033_0022133 Ga0501033_0022133_597_1457 264
264 3300049579 Ga0501043_0138810 Ga0501043_0138810_355_1149 264
265 3300049579 Ga0501043_0312073 Ga0501043_0312073_209_1003 264
266 3300049581 Ga0501047_0010382 Ga0501047_0010382_3818_4660 264
267 3300049686 Ga0501257_006080 Ga0501257_006080_1799_2593 264
268 3300049823 Ga0501044_0008645 Ga0501044_0008645_2234_3094 264
269 3300050491 nmdc:mga00v17_1199_c1 nmdc:mga00v17_1199_c1_5173_5967 264
270 3300050493 nmdc:mga0k408_96955_c1 nmdc:mga0k408_96955_c1_77_871 264
271 3300050494 nmdc:mga06z11_1695_c1 nmdc:mga06z11_1695_c1_1695_2489 264
272 3300050496 nmdc:mga07m45_21398_c1 nmdc:mga07m45_21398_c1_612_1406 264
273 3300053087 Ga0500643_012721 Ga0500643_012721_2084_2878 264
274 3300053119 Ga0500595_004052 Ga0500595_004052_5398_6192 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

4

265

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9831 3 261
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9802 5 261
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9748 3 261
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9721 5 261
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.946 46 263
ID Description Score Start End Superfamily
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9902 144 261 3.40.190.80
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9724 144 261 3.40.190.80
6ib8A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9643 144 263 3.40.190.80
af_Q54U72_147_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9523 145 260 3.40.190.80
af_I1KNJ4_148_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9457 144 264 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A7C1PI53-F1-model_v4 Inositol monophosphatase 0.9857 133 260 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A3N5HRF3-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9808 9 263 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A258UJN8-F1-model_v4 Inositol monophosphatase 0.9798 177 264 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A534HNV8-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9785 55 231 GO:0006020
GO:0007165
GO:0008934
GO:0031564
GO:0046854
GO:0046872
AF-A0A528V7A3-F1-model_v4 Inositol monophosphatase 0.975 107 204 GO:0006020
GO:0007165
GO:0008934

Feature Viewer

pLDDT pTM Quality
89.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map