F380048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 151 | 270 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_003487|Ga0500643_003487_1852_2649 |
| Length | 265 |
| Sequence | LATPSALVNVMIEAARKAGRGLVRDFGEVGELQVSKKGAADFVSAADIKAEQTLFEMLEKARPGYSFLGEERGLIEGSDKSHRWIVDPIDGTTNFIHAIPHFAISIGLEREGAIAASVVYNPVTNELYWAERGKGAYLNNETRLRVSARRNLDEAVLATGIPFLGHGQHAKFLKELHQISQRVAGVRRFGAASLDLAYVAAGRFDGFWERDLKVWDIAAGLLLVTEAGGKISEIDGADVMDTGNILATNTELHGLVQARLQAASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 46 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 85 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 91 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 108 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 109 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 110 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 111 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 112 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 124 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 127 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 128 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 129 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 130 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 131 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 132 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 133 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 140 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 141 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 142 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 143 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 144 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 145 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 146 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 147 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 148 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 149 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 150 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 151 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.54 |
| Metatranscriptomes | 0 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.39 |
| Nodule | 0 |
| Rhizoplane | 5.47 |
| Rhizosphere | 77.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100000013 | 3300005331 | Bacteria | 250768 |
| 2 | Ga0070670_100048653 | 3300005331 | Bacteria | 3648 |
| 3 | Ga0070670_100242077 | 3300005331 | Bacteria | 1571 |
| 4 | Ga0070666_10020388 | 3300005335 | Bacteria | 4285 |
| 5 | Ga0070680_100010163 | 3300005336 | Bacteria | 7258 |
| 6 | Ga0070680_100064198 | 3300005336 | Bacteria | 3009 |
| 7 | Ga0070691_10051489 | 3300005341 | Bacteria | 1966 |
| 8 | Ga0070668_100002342 | 3300005347 | Bacteria | 13925 |
| 9 | Ga0070668_100015901 | 3300005347 | Bacteria | 5629 |
| 10 | Ga0070668_100016480 | 3300005347 | Bacteria | 5526 |
| 11 | Ga0070668_100023831 | 3300005347 | Bacteria | 4633 |
| 12 | Ga0070671_100005043 | 3300005355 | Bacteria | 10529 |
| 13 | Ga0070667_100014270 | 3300005367 | Bacteria | 6562 |
| 14 | Ga0070667_100015181 | 3300005367 | Bacteria | 6362 |
| 15 | Ga0070667_100023814 | 3300005367 | Bacteria | 5083 |
| 16 | Ga0070667_100029289 | 3300005367 | Bacteria | 4587 |
| 17 | Ga0070663_100020412 | 3300005455 | Bacteria | 4388 |
| 18 | Ga0070681_10044236 | 3300005458 | Bacteria | 4456 |
| 19 | Ga0070681_10046040 | 3300005458 | Bacteria | 4362 |
| 20 | Ga0070681_10117196 | 3300005458 | Bacteria | 2599 |
| 21 | Ga0070679_100042284 | 3300005530 | Bacteria | 4537 |
| 22 | Ga0070665_100001028 | 3300005548 | Bacteria | 34986 |
| 23 | Ga0070665_100020888 | 3300005548 | Bacteria | 6580 |
| 24 | Ga0070665_100035576 | 3300005548 | Bacteria | 5008 |
| 25 | Ga0070665_100101261 | 3300005548 | Bacteria | 2885 |
| 26 | Ga0068855_100036376 | 3300005563 | Bacteria | 5860 |
| 27 | Ga0068855_100096735 | 3300005563 | Bacteria | 3401 |
| 28 | Ga0068855_100274569 | 3300005563 | Bacteria | 1873 |
| 29 | Ga0070664_100094188 | 3300005564 | Bacteria | 2597 |
| 30 | Ga0068854_100116546 | 3300005578 | Bacteria | 2022 |
| 31 | Ga0068856_100254331 | 3300005614 | Bacteria | 1772 |
| 32 | Ga0068852_100516988 | 3300005616 | Bacteria | 1191 |
| 33 | Ga0068859_100000747 | 3300005617 | Bacteria | 32789 |
| 34 | Ga0068859_100008320 | 3300005617 | Bacteria | 10513 |
| 35 | Ga0068864_100000453 | 3300005618 | Bacteria | 35448 |
| 36 | Ga0068864_100256077 | 3300005618 | Bacteria | 1627 |
| 37 | Ga0068861_100011288 | 3300005719 | Bacteria | 6203 |
| 38 | Ga0068863_100000423 | 3300005841 | Bacteria | 42817 |
| 39 | Ga0068863_100006424 | 3300005841 | Bacteria | 11527 |
| 40 | Ga0068863_100032292 | 3300005841 | Bacteria | 4990 |
| 41 | Ga0068863_100059212 | 3300005841 | Bacteria | 3624 |
| 42 | Ga0068863_100392523 | 3300005841 | Bacteria | 1356 |
| 43 | Ga0068858_100001493 | 3300005842 | Bacteria | 24115 |
| 44 | Ga0068858_100007627 | 3300005842 | Bacteria | 10451 |
| 45 | Ga0068858_100149162 | 3300005842 | Bacteria | 2198 |
| 46 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 47 | Ga0068860_100000327 | 3300005843 | Bacteria | 64590 |
| 48 | Ga0068860_100059968 | 3300005843 | Bacteria | 3617 |
| 49 | Ga0068860_100805486 | 3300005843 | Bacteria | 953 |
| 50 | Ga0068862_100014392 | 3300005844 | Bacteria | 6563 |
| 51 | Ga0068862_100035416 | 3300005844 | Bacteria | 4227 |
| 52 | Ga0068862_100045557 | 3300005844 | Bacteria | 3742 |
| 53 | Ga0068862_100060384 | 3300005844 | Bacteria | 3256 |
| 54 | Ga0068862_100085686 | 3300005844 | Bacteria | 2738 |
| 55 | Ga0075368_10002336 | 3300006042 | Bacteria | 6163 |
| 56 | Ga0075364_10001270 | 3300006051 | Bacteria | 13575 |
| 57 | Ga0075366_10106328 | 3300006195 | Bacteria | 1687 |
| 58 | Ga0075370_10020033 | 3300006353 | Bacteria | 3649 |
| 59 | Ga0097620_100000747 | 3300006931 | Bacteria | 32789 |
| 60 | Ga0097620_100008320 | 3300006931 | Bacteria | 10513 |
| 61 | Ga0105240_10005226 | 3300009093 | Bacteria | 19415 |
| 62 | Ga0105240_10005496 | 3300009093 | Bacteria | 18888 |
| 63 | Ga0105240_10067434 | 3300009093 | Bacteria | 4435 |
| 64 | Ga0105240_10557052 | 3300009093 | Bacteria | 1267 |
| 65 | Ga0105240_10625839 | 3300009093 | Bacteria | 1182 |
| 66 | Ga0105241_10150525 | 3300009174 | Bacteria | 1903 |
| 67 | Ga0105248_10000661 | 3300009177 | Bacteria | 39161 |
| 68 | Ga0105248_10016266 | 3300009177 | Bacteria | 8188 |
| 69 | Ga0105248_10094095 | 3300009177 | Bacteria | 3374 |
| 70 | Ga0105248_10111484 | 3300009177 | Bacteria | 3085 |
| 71 | Ga0105248_10133302 | 3300009177 | Bacteria | 2803 |
| 72 | Ga0105237_10508107 | 3300009545 | Bacteria | 1212 |
| 73 | Ga0105249_10023878 | 3300009553 | Bacteria | 5492 |
| 74 | Ga0105032_105331 | 3300009979 | Bacteria | 1082 |
| 75 | Ga0157373_10423630 | 3300013100 | Bacteria | 956 |
| 76 | Ga0163162_10050920 | 3300013306 | Bacteria | 4154 |
| 77 | Ga0163162_10528468 | 3300013306 | Bacteria | 1309 |
| 78 | Ga0163162_10795056 | 3300013306 | Bacteria | 1063 |
| 79 | Ga0157372_10149661 | 3300013307 | Bacteria | 2693 |
| 80 | Ga0157375_10121632 | 3300013308 | Bacteria | 2720 |
| 81 | Ga0163163_10045977 | 3300014325 | Bacteria | 4286 |
| 82 | Ga0157379_10002854 | 3300014968 | Bacteria | 14564 |
| 83 | Ga0157379_10068022 | 3300014968 | Bacteria | 3184 |
| 84 | Ga0213876_10000186 | 3300021384 | Bacteria | 64451 |
| 85 | Ga0207680_10194228 | 3300025903 | Bacteria | 1380 |
| 86 | Ga0207680_10226375 | 3300025903 | Bacteria | 1284 |
| 87 | Ga0207645_10270738 | 3300025907 | Bacteria | 1126 |
| 88 | Ga0207705_10002746 | 3300025909 | Bacteria | 13489 |
| 89 | Ga0207707_10021959 | 3300025912 | Bacteria | 5578 |
| 90 | Ga0207707_10049670 | 3300025912 | Bacteria | 3654 |
| 91 | Ga0207707_10090557 | 3300025912 | Bacteria | 2673 |
| 92 | Ga0207695_10002453 | 3300025913 | Bacteria | 27412 |
| 93 | Ga0207695_10003006 | 3300025913 | Bacteria | 24241 |
| 94 | Ga0207695_10003703 | 3300025913 | Bacteria | 21297 |
| 95 | Ga0207695_10012854 | 3300025913 | Bacteria | 10022 |
| 96 | Ga0207695_10075882 | 3300025913 | Bacteria | 3419 |
| 97 | Ga0207695_10138205 | 3300025913 | Bacteria | 2388 |
| 98 | Ga0207695_10164382 | 3300025913 | Bacteria | 2148 |
| 99 | Ga0207671_10325193 | 3300025914 | Bacteria | 1217 |
| 100 | Ga0207660_10001373 | 3300025917 | Bacteria | 16319 |
| 101 | Ga0207660_10090734 | 3300025917 | Bacteria | 2265 |
| 102 | Ga0207660_10195982 | 3300025917 | Bacteria | 1575 |
| 103 | Ga0207662_10266096 | 3300025918 | Bacteria | 1130 |
| 104 | Ga0207657_10259320 | 3300025919 | Bacteria | 1384 |
| 105 | Ga0207649_10337096 | 3300025920 | Bacteria | 1112 |
| 106 | Ga0207652_10081148 | 3300025921 | Bacteria | 2837 |
| 107 | Ga0207681_10071549 | 3300025923 | Bacteria | 2419 |
| 108 | Ga0207694_10067829 | 3300025924 | Bacteria | 2785 |
| 109 | Ga0207694_10115305 | 3300025924 | Bacteria | 2140 |
| 110 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 111 | Ga0207644_10006651 | 3300025931 | Bacteria | 7534 |
| 112 | Ga0207644_10009249 | 3300025931 | Bacteria | 6464 |
| 113 | Ga0207644_10038448 | 3300025931 | Bacteria | 3371 |
| 114 | Ga0207690_10000650 | 3300025932 | Bacteria | 22303 |
| 115 | Ga0207704_10034871 | 3300025938 | Bacteria | 2876 |
| 116 | Ga0207691_10638459 | 3300025940 | Bacteria | 900 |
| 117 | Ga0207711_10000316 | 3300025941 | Bacteria | 51683 |
| 118 | Ga0207711_10007833 | 3300025941 | Bacteria | 8930 |
| 119 | Ga0207711_10073529 | 3300025941 | Bacteria | 2971 |
| 120 | Ga0207711_10082929 | 3300025941 | Bacteria | 2803 |
| 121 | Ga0207689_10112605 | 3300025942 | Bacteria | 2237 |
| 122 | Ga0207679_10042259 | 3300025945 | Bacteria | 3275 |
| 123 | Ga0207667_10030723 | 3300025949 | Bacteria | 5806 |
| 124 | Ga0207667_10088186 | 3300025949 | Bacteria | 3209 |
| 125 | Ga0207667_10294459 | 3300025949 | Bacteria | 1658 |
| 126 | Ga0207712_10000835 | 3300025961 | Bacteria | 22611 |
| 127 | Ga0207712_10111704 | 3300025961 | Bacteria | 2051 |
| 128 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 129 | Ga0207668_10000093 | 3300025972 | Bacteria | 64280 |
| 130 | Ga0207668_10024183 | 3300025972 | Bacteria | 3916 |
| 131 | Ga0207640_10135562 | 3300025981 | Bacteria | 1787 |
| 132 | Ga0207658_10000266 | 3300025986 | Bacteria | 55102 |
| 133 | Ga0207658_10020077 | 3300025986 | Bacteria | 4625 |
| 134 | Ga0207658_10023993 | 3300025986 | Bacteria | 4262 |
| 135 | Ga0207658_10049229 | 3300025986 | Bacteria | 3095 |
| 136 | Ga0207703_10000853 | 3300026035 | Bacteria | 29885 |
| 137 | Ga0207703_10005094 | 3300026035 | Bacteria | 10628 |
| 138 | Ga0207703_10175025 | 3300026035 | Bacteria | 1890 |
| 139 | Ga0207639_10018290 | 3300026041 | Bacteria | 4979 |
| 140 | Ga0207702_10133412 | 3300026078 | Bacteria | 2237 |
| 141 | Ga0207641_10000830 | 3300026088 | Bacteria | 32877 |
| 142 | Ga0207641_10009231 | 3300026088 | Bacteria | 8134 |
| 143 | Ga0207641_10009957 | 3300026088 | Bacteria | 7825 |
| 144 | Ga0207641_10040077 | 3300026088 | Bacteria | 3919 |
| 145 | Ga0207641_10436532 | 3300026088 | Bacteria | 1263 |
| 146 | Ga0207676_10000073 | 3300026095 | Bacteria | 101510 |
| 147 | Ga0207676_10006395 | 3300026095 | Bacteria | 8322 |
| 148 | Ga0207676_10011655 | 3300026095 | Bacteria | 6288 |
| 149 | Ga0207674_10331281 | 3300026116 | Bacteria | 1472 |
| 150 | Ga0207675_100059381 | 3300026118 | Bacteria | 3569 |
| 151 | Ga0207675_100208957 | 3300026118 | Bacteria | 1877 |
| 152 | Ga0207698_10515966 | 3300026142 | Bacteria | 1165 |
| 153 | Ga0209813_10005309 | 3300027866 | Bacteria | 3119 |
| 154 | Ga0268266_10000189 | 3300028379 | Bacteria | 109217 |
| 155 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 156 | Ga0268266_10011395 | 3300028379 | Bacteria | 7731 |
| 157 | Ga0268265_10002313 | 3300028380 | Bacteria | 14498 |
| 158 | Ga0268265_10002789 | 3300028380 | Bacteria | 12875 |
| 159 | Ga0268265_10032194 | 3300028380 | Bacteria | 3796 |
| 160 | Ga0268265_10038125 | 3300028380 | Bacteria | 3533 |
| 161 | Ga0268265_10069037 | 3300028380 | Bacteria | 2743 |
| 162 | Ga0268265_10270232 | 3300028380 | Bacteria | 1516 |
| 163 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 164 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 165 | Ga0268264_10012786 | 3300028381 | Bacteria | 6908 |
| 166 | Ga0268264_10014614 | 3300028381 | Bacteria | 6451 |
| 167 | Ga0265334_10002554 | 3300028573 | Bacteria | 8494 |
| 168 | Ga0307517_10005913 | 3300028786 | Bacteria | 18260 |
| 169 | Ga0307517_10072212 | 3300028786 | Bacteria | 3080 |
| 170 | Ga0265338_10050223 | 3300028800 | Bacteria | 3772 |
| 171 | Ga0265338_10090754 | 3300028800 | Bacteria | 2528 |
| 172 | Ga0265340_10043199 | 3300031247 | Bacteria | 2210 |
| 173 | Ga0265327_10000198 | 3300031251 | Bacteria | 126077 |
| 174 | Ga0265327_10096096 | 3300031251 | Bacteria | 1437 |
| 175 | Ga0307513_10000127 | 3300031456 | Bacteria | 107100 |
| 176 | Ga0307513_10005691 | 3300031456 | Bacteria | 16403 |
| 177 | Ga0307513_10006289 | 3300031456 | Bacteria | 15552 |
| 178 | Ga0307513_10015298 | 3300031456 | Bacteria | 9306 |
| 179 | Ga0307516_10000035 | 3300031730 | Bacteria | 152658 |
| 180 | Ga0307413_10464691 | 3300031824 | Bacteria | 1008 |
| 181 | Ga0307414_10335302 | 3300032004 | Bacteria | 1292 |
| 182 | Ga0307510_10007326 | 3300033180 | Bacteria | 13142 |
| 183 | Ga0307510_10041503 | 3300033180 | Bacteria | 5029 |
| 184 | Ga0373935_0062422 | 3300035692 | Bacteria | 2387 |
| 185 | Ga0373927_0049446 | 3300035695 | Bacteria | 2718 |
| 186 | Ga0373937_0281112 | 3300036401 | Bacteria | 1572 |
| 187 | Ga0373925_0000003 | 3300037068 | Bacteria | 362401 |
| 188 | Ga0395899_0000854 | 3300037312 | Bacteria | 29169 |
| 189 | Ga0395899_0109533 | 3300037312 | Bacteria | 1987 |
| 190 | Ga0395900_0000072 | 3300037418 | Bacteria | 187428 |
| 191 | Ga0395900_0007156 | 3300037418 | Bacteria | 11565 |
| 192 | Ga0395898_0013377 | 3300037466 | Bacteria | 8452 |
| 193 | Ga0395898_0043219 | 3300037466 | Bacteria | 4441 |
| 194 | Ga0395905_0005411 | 3300037471 | Bacteria | 13044 |
| 195 | Ga0395905_0007741 | 3300037471 | Bacteria | 10656 |
| 196 | Ga0395905_0024735 | 3300037471 | Bacteria | 5667 |
| 197 | Ga0395905_0043821 | 3300037471 | Bacteria | 4198 |
| 198 | Ga0395905_0162010 | 3300037471 | Bacteria | 2102 |
| 199 | Ga0395905_0179914 | 3300037471 | Bacteria | 1985 |
| 200 | Ga0395905_0220375 | 3300037471 | Bacteria | 1775 |
| 201 | Ga0436364_0234908 | 3300037853 | Bacteria | 3249 |
| 202 | Ga0436364_0254679 | 3300037853 | Bacteria | 1122 |
| 203 | Ga0395901_0000052 | 3300038443 | Bacteria | 165888 |
| 204 | Ga0436365_1749383 | 3300039437 | Bacteria | 956 |
| 205 | Ga0436365_1817404 | 3300039437 | Bacteria | 978 |
| 206 | Ga0436365_1884511 | 3300039437 | Bacteria | 98004 |
| 207 | Ga0436360_0443561 | 3300039438 | Bacteria | 1590 |
| 208 | Ga0436361_1110998 | 3300039447 | Bacteria | 21889 |
| 209 | Ga0436363_0112210 | 3300039450 | Bacteria | 1793 |
| 210 | Ga0439434_0057135 | 3300042435 | Bacteria | 1216 |
| 211 | Ga0466972_0247252 | 3300044658 | Bacteria | 834 |
| 212 | Ga0453684_0365670 | 3300044712 | Bacteria | 1623 |
| 213 | Ga0466960_0037334 | 3300044901 | Bacteria | 2279 |
| 214 | Ga0495583_0049190 | 3300046506 | Bacteria | 1932 |
| 215 | Ga0495620_0122293 | 3300046515 | Bacteria | 1025 |
| 216 | Ga0495642_0005810 | 3300046528 | Bacteria | 4731 |
| 217 | Ga0495598_0126140 | 3300046537 | Bacteria | 873 |
| 218 | Ga0495668_0026560 | 3300046616 | Bacteria | 3285 |
| 219 | Ga0495611_0011660 | 3300046648 | Bacteria | 3729 |
| 220 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 221 | Ga0495669_0001650 | 3300046684 | Bacteria | 9170 |
| 222 | Ga0495669_0006972 | 3300046684 | Bacteria | 4732 |
| 223 | Ga0495669_0023102 | 3300046684 | Bacteria | 2705 |
| 224 | Ga0495672_0019869 | 3300047320 | Bacteria | 4418 |
| 225 | Ga0495677_0019147 | 3300047445 | Bacteria | 2483 |
| 226 | Ga0496102_0009240 | 3300048905 | Bacteria | 8458 |
| 227 | Ga0496102_0289746 | 3300048905 | Bacteria | 1543 |
| 228 | Ga0496104_0374337 | 3300048907 | Bacteria | 1337 |
| 229 | Ga0496106_0371410 | 3300048909 | Bacteria | 1149 |
| 230 | Ga0496107_0049973 | 3300048910 | Bacteria | 3014 |
| 231 | Ga0496109_0025315 | 3300048912 | Bacteria | 5287 |
| 232 | Ga0496112_0239023 | 3300048915 | Bacteria | 1769 |
| 233 | Ga0496112_0609544 | 3300048915 | Bacteria | 1023 |
| 234 | Ga0496112_0842971 | 3300048915 | Bacteria | 840 |
| 235 | Ga0496113_0087836 | 3300048916 | Bacteria | 2391 |
| 236 | Ga0496115_0001097 | 3300048918 | Bacteria | 19591 |
| 237 | Ga0496115_0002362 | 3300048918 | Bacteria | 13536 |
| 238 | Ga0496115_0048471 | 3300048918 | Bacteria | 3398 |
| 239 | Ga0496115_0136302 | 3300048918 | Bacteria | 2024 |
| 240 | Ga0496115_0351451 | 3300048918 | Bacteria | 1202 |
| 241 | Ga0496116_0067404 | 3300048919 | Bacteria | 2286 |
| 242 | Ga0496118_0005744 | 3300048921 | Bacteria | 13955 |
| 243 | Ga0496119_0043149 | 3300048922 | Bacteria | 2853 |
| 244 | Ga0496121_0000397 | 3300048924 | Bacteria | 87422 |
| 245 | Ga0501032_0028322 | 3300049569 | Bacteria | 3850 |
| 246 | Ga0501033_0022133 | 3300049570 | Bacteria | 4796 |
| 247 | Ga0501043_0138810 | 3300049579 | Bacteria | 1904 |
| 248 | Ga0501043_0312073 | 3300049579 | Bacteria | 1200 |
| 249 | Ga0501047_0010382 | 3300049581 | Bacteria | 8811 |
| 250 | Ga0501257_006080 | 3300049686 | Bacteria | 2674 |
| 251 | Ga0501044_0008645 | 3300049823 | Bacteria | 11152 |
| 252 | Ga0501044_0111601 | 3300049823 | Bacteria | 2742 |
| 253 | nmdc:mga00v17_1199_c1 | 3300050491 | Bacteria | 13575 |
| 254 | nmdc:mga0k408_96955_c1 | 3300050493 | Bacteria | 1736 |
| 255 | nmdc:mga06z11_1695_c1 | 3300050494 | Bacteria | 8272 |
| 256 | nmdc:mga07m45_21398_c1 | 3300050496 | Bacteria | 3522 |
| 257 | nmdc:mga0sz30_175877_c1 | 3300050516 | Bacteria | 949 |
| 258 | Ga0500643_003487 | 3300053087 | Bacteria | 7555 |
| 259 | Ga0500643_012721 | 3300053087 | Bacteria | 3004 |
| 260 | Ga0500641_0013996 | 3300053096 | Bacteria | 2954 |
| 261 | Ga0500641_0015908 | 3300053096 | Bacteria | 2797 |
| 262 | Ga0500556_0004024 | 3300053104 | Bacteria | 4231 |
| 263 | Ga0500562_002990 | 3300053108 | Bacteria | 4215 |
| 264 | Ga0500562_003254 | 3300053108 | Bacteria | 4061 |
| 265 | Ga0500562_009076 | 3300053108 | Bacteria | 2514 |
| 266 | Ga0500595_004052 | 3300053119 | Bacteria | 6665 |
| 267 | Ga0500616_0011733 | 3300053153 | Bacteria | 5159 |
| 268 | Ga0500622_0012713 | 3300053156 | Bacteria | 4553 |
| 269 | Ga0500645_000604 | 3300053730 | Bacteria | 23015 |
| 270 | Ga0500645_001214 | 3300053730 | Bacteria | 13625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053108 | Ga0500562_003254 | Ga0500562_003254_3343_4038 | 231 |
| 2 | iso_pu_bacteria | 2643221598 | 2643998795 | 250 |
| 3 | 3300005355 | Ga0070671_100005043 | Ga0070671_1000050434 | 254 |
| 4 | 3300005841 | Ga0068863_100006424 | Ga0068863_10000642413 | 254 |
| 5 | 3300009177 | Ga0105248_10000661 | Ga0105248_1000066126 | 254 |
| 6 | 3300009177 | Ga0105248_10094095 | Ga0105248_100940953 | 254 |
| 7 | 3300009979 | Ga0105032_105331 | Ga0105032_1053311 | 254 |
| 8 | 3300013100 | Ga0157373_10423630 | Ga0157373_104236301 | 254 |
| 9 | 3300013306 | Ga0163162_10795056 | Ga0163162_107950562 | 254 |
| 10 | 3300013308 | Ga0157375_10121632 | Ga0157375_101216322 | 254 |
| 11 | 3300014325 | Ga0163163_10045977 | Ga0163163_100459772 | 254 |
| 12 | 3300025931 | Ga0207644_10006651 | Ga0207644_100066514 | 254 |
| 13 | 3300025931 | Ga0207644_10009249 | Ga0207644_100092499 | 254 |
| 14 | 3300025942 | Ga0207689_10112605 | Ga0207689_101126051 | 254 |
| 15 | 3300026088 | Ga0207641_10009231 | Ga0207641_100092314 | 254 |
| 16 | 3300031456 | Ga0307513_10000127 | Ga0307513_1000012750 | 254 |
| 17 | 3300037312 | Ga0395899_0000854 | Ga0395899_0000854_24499_25266 | 254 |
| 18 | 3300037312 | Ga0395899_0109533 | Ga0395899_0109533_459_1241 | 254 |
| 19 | 3300037418 | Ga0395900_0000072 | Ga0395900_0000072_69781_70548 | 254 |
| 20 | 3300037466 | Ga0395898_0013377 | Ga0395898_0013377_6921_7688 | 254 |
| 21 | 3300037471 | Ga0395905_0005411 | Ga0395905_0005411_6127_6894 | 254 |
| 22 | 3300037471 | Ga0395905_0007741 | Ga0395905_0007741_4002_4769 | 254 |
| 23 | 3300037471 | Ga0395905_0043821 | Ga0395905_0043821_73_846 | 254 |
| 24 | 3300038443 | Ga0395901_0000052 | Ga0395901_0000052_56287_57054 | 254 |
| 25 | 3300039437 | Ga0436365_1749383 | Ga0436365_1749383_168_932 | 254 |
| 26 | 3300046506 | Ga0495583_0049190 | Ga0495583_0049190_171_938 | 254 |
| 27 | 3300046515 | Ga0495620_0122293 | Ga0495620_0122293_58_825 | 254 |
| 28 | 3300046528 | Ga0495642_0005810 | Ga0495642_0005810_3059_3826 | 254 |
| 29 | 3300046648 | Ga0495611_0011660 | Ga0495611_0011660_907_1674 | 254 |
| 30 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_49846_50610 | 254 |
| 31 | 3300046684 | Ga0495669_0001650 | Ga0495669_0001650_4931_5695 | 254 |
| 32 | 3300046684 | Ga0495669_0023102 | Ga0495669_0023102_466_1233 | 254 |
| 33 | 3300047445 | Ga0495677_0019147 | Ga0495677_0019147_1029_1793 | 254 |
| 34 | 3300048905 | Ga0496102_0009240 | Ga0496102_0009240_3937_4704 | 254 |
| 35 | 3300048907 | Ga0496104_0374337 | Ga0496104_0374337_455_1219 | 254 |
| 36 | 3300048910 | Ga0496107_0049973 | Ga0496107_0049973_890_1657 | 254 |
| 37 | 3300048912 | Ga0496109_0025315 | Ga0496109_0025315_1530_2297 | 254 |
| 38 | 3300048915 | Ga0496112_0239023 | Ga0496112_0239023_62_829 | 254 |
| 39 | 3300048915 | Ga0496112_0842971 | Ga0496112_0842971_48_815 | 254 |
| 40 | 3300048916 | Ga0496113_0087836 | Ga0496113_0087836_1305_2072 | 254 |
| 41 | 3300048918 | Ga0496115_0001097 | Ga0496115_0001097_8492_9259 | 254 |
| 42 | 3300048918 | Ga0496115_0048471 | Ga0496115_0048471_53_820 | 254 |
| 43 | 3300048918 | Ga0496115_0136302 | Ga0496115_0136302_735_1517 | 254 |
| 44 | 3300050516 | nmdc:mga0sz30_175877_c1 | nmdc:mga0sz30_175877_c1_57_821 | 254 |
| 45 | 3300053096 | Ga0500641_0015908 | Ga0500641_0015908_1369_2133 | 254 |
| 46 | 3300053108 | Ga0500562_009076 | Ga0500562_009076_1363_2127 | 254 |
| 47 | 3300046616 | Ga0495668_0026560 | Ga0495668_0026560_2496_3269 | 257 |
| 48 | 3300049823 | Ga0501044_0111601 | Ga0501044_0111601_1007_1783 | 257 |
| 49 | iso_pu_bacteria | 2643221614 | 2644087175 | 260 |
| 50 | iso_pu_bacteria | 2643221661 | 2644342129 | 260 |
| 51 | iso_pu_bacteria | 2643221666 | 2644368415 | 260 |
| 52 | 3300026116 | Ga0207674_10331281 | Ga0207674_103312811 | 263 |
| 53 | 3300053087 | Ga0500643_003487 | Ga0500643_003487_1852_2649 | 263 |
| 54 | 3300053096 | Ga0500641_0013996 | Ga0500641_0013996_51_848 | 263 |
| 55 | 3300053104 | Ga0500556_0004024 | Ga0500556_0004024_1486_2283 | 263 |
| 56 | 3300053108 | Ga0500562_002990 | Ga0500562_002990_438_1235 | 263 |
| 57 | 3300053153 | Ga0500616_0011733 | Ga0500616_0011733_224_1021 | 263 |
| 58 | 3300053156 | Ga0500622_0012713 | Ga0500622_0012713_1518_2315 | 263 |
| 59 | 3300053730 | Ga0500645_000604 | Ga0500645_000604_1852_2649 | 263 |
| 60 | 3300053730 | Ga0500645_001214 | Ga0500645_001214_87_884 | 263 |
| 61 | 3300005331 | Ga0070670_100000013 | Ga0070670_100000013207 | 264 |
| 62 | 3300005331 | Ga0070670_100048653 | Ga0070670_1000486533 | 264 |
| 63 | 3300005331 | Ga0070670_100242077 | Ga0070670_1002420772 | 264 |
| 64 | 3300005335 | Ga0070666_10020388 | Ga0070666_100203882 | 264 |
| 65 | 3300005336 | Ga0070680_100010163 | Ga0070680_1000101634 | 264 |
| 66 | 3300005336 | Ga0070680_100064198 | Ga0070680_1000641981 | 264 |
| 67 | 3300005341 | Ga0070691_10051489 | Ga0070691_100514891 | 264 |
| 68 | 3300005347 | Ga0070668_100002342 | Ga0070668_10000234210 | 264 |
| 69 | 3300005347 | Ga0070668_100015901 | Ga0070668_1000159012 | 264 |
| 70 | 3300005347 | Ga0070668_100016480 | Ga0070668_1000164803 | 264 |
| 71 | 3300005347 | Ga0070668_100023831 | Ga0070668_1000238313 | 264 |
| 72 | 3300005367 | Ga0070667_100014270 | Ga0070667_1000142706 | 264 |
| 73 | 3300005367 | Ga0070667_100015181 | Ga0070667_1000151816 | 264 |
| 74 | 3300005367 | Ga0070667_100023814 | Ga0070667_1000238145 | 264 |
| 75 | 3300005367 | Ga0070667_100029289 | Ga0070667_1000292892 | 264 |
| 76 | 3300005455 | Ga0070663_100020412 | Ga0070663_1000204122 | 264 |
| 77 | 3300005458 | Ga0070681_10044236 | Ga0070681_100442361 | 264 |
| 78 | 3300005458 | Ga0070681_10046040 | Ga0070681_100460402 | 264 |
| 79 | 3300005458 | Ga0070681_10117196 | Ga0070681_101171962 | 264 |
| 80 | 3300005530 | Ga0070679_100042284 | Ga0070679_1000422845 | 264 |
| 81 | 3300005548 | Ga0070665_100001028 | Ga0070665_10000102825 | 264 |
| 82 | 3300005548 | Ga0070665_100020888 | Ga0070665_1000208883 | 264 |
| 83 | 3300005548 | Ga0070665_100035576 | Ga0070665_1000355763 | 264 |
| 84 | 3300005548 | Ga0070665_100101261 | Ga0070665_1001012614 | 264 |
| 85 | 3300005563 | Ga0068855_100036376 | Ga0068855_1000363763 | 264 |
| 86 | 3300005563 | Ga0068855_100096735 | Ga0068855_1000967351 | 264 |
| 87 | 3300005563 | Ga0068855_100274569 | Ga0068855_1002745692 | 264 |
| 88 | 3300005564 | Ga0070664_100094188 | Ga0070664_1000941881 | 264 |
| 89 | 3300005578 | Ga0068854_100116546 | Ga0068854_1001165462 | 264 |
| 90 | 3300005614 | Ga0068856_100254331 | Ga0068856_1002543312 | 264 |
| 91 | 3300005616 | Ga0068852_100516988 | Ga0068852_1005169882 | 264 |
| 92 | 3300005617 | Ga0068859_100000747 | Ga0068859_10000074716 | 264 |
| 93 | 3300005617 | Ga0068859_100008320 | Ga0068859_10000832011 | 264 |
| 94 | 3300005618 | Ga0068864_100000453 | Ga0068864_10000045324 | 264 |
| 95 | 3300005618 | Ga0068864_100256077 | Ga0068864_1002560772 | 264 |
| 96 | 3300005719 | Ga0068861_100011288 | Ga0068861_1000112888 | 264 |
| 97 | 3300005841 | Ga0068863_100000423 | Ga0068863_10000042315 | 264 |
| 98 | 3300005841 | Ga0068863_100032292 | Ga0068863_1000322926 | 264 |
| 99 | 3300005841 | Ga0068863_100059212 | Ga0068863_1000592125 | 264 |
| 100 | 3300005841 | Ga0068863_100392523 | Ga0068863_1003925232 | 264 |
| 101 | 3300005842 | Ga0068858_100001493 | Ga0068858_10000149316 | 264 |
| 102 | 3300005842 | Ga0068858_100007627 | Ga0068858_1000076278 | 264 |
| 103 | 3300005842 | Ga0068858_100149162 | Ga0068858_1001491622 | 264 |
| 104 | 3300005843 | Ga0068860_100000167 | Ga0068860_10000016718 | 264 |
| 105 | 3300005843 | Ga0068860_100000327 | Ga0068860_10000032710 | 264 |
| 106 | 3300005843 | Ga0068860_100059968 | Ga0068860_1000599683 | 264 |
| 107 | 3300005843 | Ga0068860_100805486 | Ga0068860_1008054861 | 264 |
| 108 | 3300005844 | Ga0068862_100014392 | Ga0068862_1000143923 | 264 |
| 109 | 3300005844 | Ga0068862_100035416 | Ga0068862_1000354164 | 264 |
| 110 | 3300005844 | Ga0068862_100045557 | Ga0068862_1000455571 | 264 |
| 111 | 3300005844 | Ga0068862_100060384 | Ga0068862_1000603842 | 264 |
| 112 | 3300005844 | Ga0068862_100085686 | Ga0068862_1000856863 | 264 |
| 113 | 3300006042 | Ga0075368_10002336 | Ga0075368_100023368 | 264 |
| 114 | 3300006051 | Ga0075364_10001270 | Ga0075364_100012706 | 264 |
| 115 | 3300006195 | Ga0075366_10106328 | Ga0075366_101063281 | 264 |
| 116 | 3300006353 | Ga0075370_10020033 | Ga0075370_100200332 | 264 |
| 117 | 3300006931 | Ga0097620_100000747 | Ga0097620_10000074725 | 264 |
| 118 | 3300006931 | Ga0097620_100008320 | Ga0097620_10000832011 | 264 |
| 119 | 3300009093 | Ga0105240_10005226 | Ga0105240_1000522616 | 264 |
| 120 | 3300009093 | Ga0105240_10005496 | Ga0105240_100054964 | 264 |
| 121 | 3300009093 | Ga0105240_10067434 | Ga0105240_100674343 | 264 |
| 122 | 3300009093 | Ga0105240_10557052 | Ga0105240_105570521 | 264 |
| 123 | 3300009093 | Ga0105240_10625839 | Ga0105240_106258392 | 264 |
| 124 | 3300009174 | Ga0105241_10150525 | Ga0105241_101505253 | 264 |
| 125 | 3300009177 | Ga0105248_10016266 | Ga0105248_100162668 | 264 |
| 126 | 3300009177 | Ga0105248_10111484 | Ga0105248_101114842 | 264 |
| 127 | 3300009177 | Ga0105248_10133302 | Ga0105248_101333023 | 264 |
| 128 | 3300009545 | Ga0105237_10508107 | Ga0105237_105081072 | 264 |
| 129 | 3300009553 | Ga0105249_10023878 | Ga0105249_100238782 | 264 |
| 130 | 3300013306 | Ga0163162_10050920 | Ga0163162_100509206 | 264 |
| 131 | 3300013306 | Ga0163162_10528468 | Ga0163162_105284682 | 264 |
| 132 | 3300013307 | Ga0157372_10149661 | Ga0157372_101496615 | 264 |
| 133 | 3300014968 | Ga0157379_10002854 | Ga0157379_100028546 | 264 |
| 134 | 3300014968 | Ga0157379_10068022 | Ga0157379_100680222 | 264 |
| 135 | 3300021384 | Ga0213876_10000186 | Ga0213876_1000018622 | 264 |
| 136 | 3300025903 | Ga0207680_10194228 | Ga0207680_101942281 | 264 |
| 137 | 3300025903 | Ga0207680_10226375 | Ga0207680_102263752 | 264 |
| 138 | 3300025907 | Ga0207645_10270738 | Ga0207645_102707382 | 264 |
| 139 | 3300025909 | Ga0207705_10002746 | Ga0207705_1000274615 | 264 |
| 140 | 3300025912 | Ga0207707_10021959 | Ga0207707_100219592 | 264 |
| 141 | 3300025912 | Ga0207707_10049670 | Ga0207707_100496704 | 264 |
| 142 | 3300025912 | Ga0207707_10090557 | Ga0207707_100905571 | 264 |
| 143 | 3300025913 | Ga0207695_10002453 | Ga0207695_1000245316 | 264 |
| 144 | 3300025913 | Ga0207695_10003006 | Ga0207695_100030065 | 264 |
| 145 | 3300025913 | Ga0207695_10003703 | Ga0207695_1000370314 | 264 |
| 146 | 3300025913 | Ga0207695_10012854 | Ga0207695_1001285411 | 264 |
| 147 | 3300025913 | Ga0207695_10075882 | Ga0207695_100758823 | 264 |
| 148 | 3300025913 | Ga0207695_10138205 | Ga0207695_101382052 | 264 |
| 149 | 3300025913 | Ga0207695_10164382 | Ga0207695_101643822 | 264 |
| 150 | 3300025914 | Ga0207671_10325193 | Ga0207671_103251932 | 264 |
| 151 | 3300025917 | Ga0207660_10001373 | Ga0207660_100013738 | 264 |
| 152 | 3300025917 | Ga0207660_10090734 | Ga0207660_100907342 | 264 |
| 153 | 3300025917 | Ga0207660_10195982 | Ga0207660_101959823 | 264 |
| 154 | 3300025918 | Ga0207662_10266096 | Ga0207662_102660962 | 264 |
| 155 | 3300025919 | Ga0207657_10259320 | Ga0207657_102593201 | 264 |
| 156 | 3300025920 | Ga0207649_10337096 | Ga0207649_103370961 | 264 |
| 157 | 3300025921 | Ga0207652_10081148 | Ga0207652_100811483 | 264 |
| 158 | 3300025923 | Ga0207681_10071549 | Ga0207681_100715492 | 264 |
| 159 | 3300025924 | Ga0207694_10067829 | Ga0207694_100678293 | 264 |
| 160 | 3300025924 | Ga0207694_10115305 | Ga0207694_101153052 | 264 |
| 161 | 3300025925 | Ga0207650_10000074 | Ga0207650_1000007420 | 264 |
| 162 | 3300025931 | Ga0207644_10038448 | Ga0207644_100384482 | 264 |
| 163 | 3300025932 | Ga0207690_10000650 | Ga0207690_1000065011 | 264 |
| 164 | 3300025938 | Ga0207704_10034871 | Ga0207704_100348712 | 264 |
| 165 | 3300025940 | Ga0207691_10638459 | Ga0207691_106384591 | 264 |
| 166 | 3300025941 | Ga0207711_10000316 | Ga0207711_1000031642 | 264 |
| 167 | 3300025941 | Ga0207711_10007833 | Ga0207711_100078338 | 264 |
| 168 | 3300025941 | Ga0207711_10073529 | Ga0207711_100735292 | 264 |
| 169 | 3300025941 | Ga0207711_10082929 | Ga0207711_100829293 | 264 |
| 170 | 3300025945 | Ga0207679_10042259 | Ga0207679_100422592 | 264 |
| 171 | 3300025949 | Ga0207667_10030723 | Ga0207667_100307235 | 264 |
| 172 | 3300025949 | Ga0207667_10088186 | Ga0207667_100881865 | 264 |
| 173 | 3300025949 | Ga0207667_10294459 | Ga0207667_102944592 | 264 |
| 174 | 3300025961 | Ga0207712_10000835 | Ga0207712_100008356 | 264 |
| 175 | 3300025961 | Ga0207712_10111704 | Ga0207712_101117042 | 264 |
| 176 | 3300025972 | Ga0207668_10000001 | Ga0207668_1000000193 | 264 |
| 177 | 3300025972 | Ga0207668_10000093 | Ga0207668_1000009318 | 264 |
| 178 | 3300025972 | Ga0207668_10024183 | Ga0207668_100241835 | 264 |
| 179 | 3300025981 | Ga0207640_10135562 | Ga0207640_101355622 | 264 |
| 180 | 3300025986 | Ga0207658_10000266 | Ga0207658_100002666 | 264 |
| 181 | 3300025986 | Ga0207658_10020077 | Ga0207658_100200776 | 264 |
| 182 | 3300025986 | Ga0207658_10023993 | Ga0207658_100239932 | 264 |
| 183 | 3300025986 | Ga0207658_10049229 | Ga0207658_100492293 | 264 |
| 184 | 3300026035 | Ga0207703_10000853 | Ga0207703_100008534 | 264 |
| 185 | 3300026035 | Ga0207703_10005094 | Ga0207703_100050945 | 264 |
| 186 | 3300026035 | Ga0207703_10175025 | Ga0207703_101750252 | 264 |
| 187 | 3300026041 | Ga0207639_10018290 | Ga0207639_100182902 | 264 |
| 188 | 3300026078 | Ga0207702_10133412 | Ga0207702_101334122 | 264 |
| 189 | 3300026088 | Ga0207641_10000830 | Ga0207641_100008305 | 264 |
| 190 | 3300026088 | Ga0207641_10009957 | Ga0207641_100099571 | 264 |
| 191 | 3300026088 | Ga0207641_10040077 | Ga0207641_100400774 | 264 |
| 192 | 3300026088 | Ga0207641_10436532 | Ga0207641_104365322 | 264 |
| 193 | 3300026095 | Ga0207676_10000073 | Ga0207676_1000007392 | 264 |
| 194 | 3300026095 | Ga0207676_10006395 | Ga0207676_100063956 | 264 |
| 195 | 3300026095 | Ga0207676_10011655 | Ga0207676_100116559 | 264 |
| 196 | 3300026118 | Ga0207675_100059381 | Ga0207675_1000593813 | 264 |
| 197 | 3300026118 | Ga0207675_100208957 | Ga0207675_1002089572 | 264 |
| 198 | 3300026142 | Ga0207698_10515966 | Ga0207698_105159661 | 264 |
| 199 | 3300027866 | Ga0209813_10005309 | Ga0209813_100053092 | 264 |
| 200 | 3300028379 | Ga0268266_10000189 | Ga0268266_1000018925 | 264 |
| 201 | 3300028379 | Ga0268266_10000289 | Ga0268266_1000028992 | 264 |
| 202 | 3300028379 | Ga0268266_10011395 | Ga0268266_100113957 | 264 |
| 203 | 3300028380 | Ga0268265_10002313 | Ga0268265_100023135 | 264 |
| 204 | 3300028380 | Ga0268265_10002789 | Ga0268265_100027893 | 264 |
| 205 | 3300028380 | Ga0268265_10032194 | Ga0268265_100321942 | 264 |
| 206 | 3300028380 | Ga0268265_10038125 | Ga0268265_100381251 | 264 |
| 207 | 3300028380 | Ga0268265_10069037 | Ga0268265_100690373 | 264 |
| 208 | 3300028380 | Ga0268265_10270232 | Ga0268265_102702322 | 264 |
| 209 | 3300028381 | Ga0268264_10000002 | Ga0268264_1000000270 | 264 |
| 210 | 3300028381 | Ga0268264_10000068 | Ga0268264_10000068108 | 264 |
| 211 | 3300028381 | Ga0268264_10012786 | Ga0268264_100127863 | 264 |
| 212 | 3300028381 | Ga0268264_10014614 | Ga0268264_100146142 | 264 |
| 213 | 3300028573 | Ga0265334_10002554 | Ga0265334_100025542 | 264 |
| 214 | 3300028786 | Ga0307517_10005913 | Ga0307517_1000591318 | 264 |
| 215 | 3300028786 | Ga0307517_10072212 | Ga0307517_100722125 | 264 |
| 216 | 3300028800 | Ga0265338_10050223 | Ga0265338_100502232 | 264 |
| 217 | 3300028800 | Ga0265338_10090754 | Ga0265338_100907542 | 264 |
| 218 | 3300031247 | Ga0265340_10043199 | Ga0265340_100431992 | 264 |
| 219 | 3300031251 | Ga0265327_10000198 | Ga0265327_10000198103 | 264 |
| 220 | 3300031251 | Ga0265327_10096096 | Ga0265327_100960962 | 264 |
| 221 | 3300031456 | Ga0307513_10005691 | Ga0307513_1000569116 | 264 |
| 222 | 3300031456 | Ga0307513_10006289 | Ga0307513_1000628914 | 264 |
| 223 | 3300031456 | Ga0307513_10015298 | Ga0307513_100152986 | 264 |
| 224 | 3300031730 | Ga0307516_10000035 | Ga0307516_10000035119 | 264 |
| 225 | 3300031824 | Ga0307413_10464691 | Ga0307413_104646911 | 264 |
| 226 | 3300032004 | Ga0307414_10335302 | Ga0307414_103353022 | 264 |
| 227 | 3300033180 | Ga0307510_10007326 | Ga0307510_1000732610 | 264 |
| 228 | 3300033180 | Ga0307510_10041503 | Ga0307510_100415035 | 264 |
| 229 | 3300035692 | Ga0373935_0062422 | Ga0373935_0062422_11_805 | 264 |
| 230 | 3300035695 | Ga0373927_0049446 | Ga0373927_0049446_447_1244 | 264 |
| 231 | 3300036401 | Ga0373937_0281112 | Ga0373937_0281112_390_1184 | 264 |
| 232 | 3300037068 | Ga0373925_0000003 | Ga0373925_0000003_535_1332 | 264 |
| 233 | 3300037418 | Ga0395900_0007156 | Ga0395900_0007156_7218_8015 | 264 |
| 234 | 3300037466 | Ga0395898_0043219 | Ga0395898_0043219_3282_4079 | 264 |
| 235 | 3300037471 | Ga0395905_0024735 | Ga0395905_0024735_1100_1897 | 264 |
| 236 | 3300037471 | Ga0395905_0162010 | Ga0395905_0162010_331_1125 | 264 |
| 237 | 3300037471 | Ga0395905_0179914 | Ga0395905_0179914_214_1011 | 264 |
| 238 | 3300037471 | Ga0395905_0220375 | Ga0395905_0220375_887_1684 | 264 |
| 239 | 3300037853 | Ga0436364_0234908 | Ga0436364_0234908_1921_2715 | 264 |
| 240 | 3300037853 | Ga0436364_0254679 | Ga0436364_0254679_78_872 | 264 |
| 241 | 3300039437 | Ga0436365_1817404 | Ga0436365_1817404_115_909 | 264 |
| 242 | 3300039437 | Ga0436365_1884511 | Ga0436365_1884511_14862_15656 | 264 |
| 243 | 3300039438 | Ga0436360_0443561 | Ga0436360_0443561_291_1085 | 264 |
| 244 | 3300039447 | Ga0436361_1110998 | Ga0436361_1110998_14820_15617 | 264 |
| 245 | 3300039450 | Ga0436363_0112210 | Ga0436363_0112210_464_1258 | 264 |
| 246 | 3300042435 | Ga0439434_0057135 | Ga0439434_0057135_373_1167 | 264 |
| 247 | 3300044658 | Ga0466972_0247252 | Ga0466972_0247252_22_816 | 264 |
| 248 | 3300044712 | Ga0453684_0365670 | Ga0453684_0365670_325_1128 | 264 |
| 249 | 3300044901 | Ga0466960_0037334 | Ga0466960_0037334_1408_2202 | 264 |
| 250 | 3300046537 | Ga0495598_0126140 | Ga0495598_0126140_33_827 | 264 |
| 251 | 3300046684 | Ga0495669_0006972 | Ga0495669_0006972_2702_3499 | 264 |
| 252 | 3300047320 | Ga0495672_0019869 | Ga0495672_0019869_43_840 | 264 |
| 253 | 3300048905 | Ga0496102_0289746 | Ga0496102_0289746_463_1257 | 264 |
| 254 | 3300048909 | Ga0496106_0371410 | Ga0496106_0371410_291_1085 | 264 |
| 255 | 3300048915 | Ga0496112_0609544 | Ga0496112_0609544_92_901 | 264 |
| 256 | 3300048918 | Ga0496115_0002362 | Ga0496115_0002362_6927_7724 | 264 |
| 257 | 3300048918 | Ga0496115_0351451 | Ga0496115_0351451_203_997 | 264 |
| 258 | 3300048919 | Ga0496116_0067404 | Ga0496116_0067404_204_998 | 264 |
| 259 | 3300048921 | Ga0496118_0005744 | Ga0496118_0005744_10586_11380 | 264 |
| 260 | 3300048922 | Ga0496119_0043149 | Ga0496119_0043149_1054_1848 | 264 |
| 261 | 3300048924 | Ga0496121_0000397 | Ga0496121_0000397_3506_4300 | 264 |
| 262 | 3300049569 | Ga0501032_0028322 | Ga0501032_0028322_2750_3547 | 264 |
| 263 | 3300049570 | Ga0501033_0022133 | Ga0501033_0022133_597_1457 | 264 |
| 264 | 3300049579 | Ga0501043_0138810 | Ga0501043_0138810_355_1149 | 264 |
| 265 | 3300049579 | Ga0501043_0312073 | Ga0501043_0312073_209_1003 | 264 |
| 266 | 3300049581 | Ga0501047_0010382 | Ga0501047_0010382_3818_4660 | 264 |
| 267 | 3300049686 | Ga0501257_006080 | Ga0501257_006080_1799_2593 | 264 |
| 268 | 3300049823 | Ga0501044_0008645 | Ga0501044_0008645_2234_3094 | 264 |
| 269 | 3300050491 | nmdc:mga00v17_1199_c1 | nmdc:mga00v17_1199_c1_5173_5967 | 264 |
| 270 | 3300050493 | nmdc:mga0k408_96955_c1 | nmdc:mga0k408_96955_c1_77_871 | 264 |
| 271 | 3300050494 | nmdc:mga06z11_1695_c1 | nmdc:mga06z11_1695_c1_1695_2489 | 264 |
| 272 | 3300050496 | nmdc:mga07m45_21398_c1 | nmdc:mga07m45_21398_c1_612_1406 | 264 |
| 273 | 3300053087 | Ga0500643_012721 | Ga0500643_012721_2084_2878 | 264 |
| 274 | 3300053119 | Ga0500595_004052 | Ga0500595_004052_5398_6192 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3luz-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9831 | 3 | 261 |
| 3luz-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9802 | 5 | 261 |
| 3luz-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9748 | 3 | 261 |
| 3luz-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.9721 | 5 | 261 |
| 2p3v-assembly1.cif.gz_A | thermotoga maritima impase tm1415 | 0.946 | 46 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3luzB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9902 | 144 | 261 | 3.40.190.80 |
| 3luzB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9724 | 144 | 261 | 3.40.190.80 |
| 6ib8A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9643 | 144 | 263 | 3.40.190.80 |
| af_Q54U72_147_270_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9523 | 145 | 260 | 3.40.190.80 |
| af_I1KNJ4_148_270_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9457 | 144 | 264 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1PI53-F1-model_v4 | Inositol monophosphatase | 0.9857 | 133 | 260 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A3N5HRF3-F1-model_v4 | Inositol-1-monophosphatase (EC 3.1.3.25) | 0.9808 | 9 | 263 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A258UJN8-F1-model_v4 | Inositol monophosphatase | 0.9798 | 177 | 264 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A534HNV8-F1-model_v4 | Inositol-1-monophosphatase (EC 3.1.3.25) | 0.9785 | 55 | 231 |
GO:0006020
GO:0007165 GO:0008934 GO:0031564 GO:0046854 GO:0046872 |
| AF-A0A528V7A3-F1-model_v4 | Inositol monophosphatase | 0.975 | 107 | 204 |
GO:0006020
GO:0007165 GO:0008934 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar