F380018

General Info

Members Datasets Scaffolds Average Seq Length
274 187 548 139

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0033176|Ga0501067_0033176_1678_2094
Length 138
Sequence MITGNTRNHGLAAALDRLAYDDNGLIPAIAQQHDTREVLMMAWMNRAAIEETLQTGRVCYWSRSRRRLWRKGETSGQTQALVELRIDCDNDCLLLLLVDQTGVACHTGRRSCFFTALRGGLPQTIADVVIDPAKLYGG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
180 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
184 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
185 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
186 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
187 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.03
Nodule 0
Rhizoplane 1.09
Rhizosphere 83.58
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0033176 3300049583 Bacteria 2865
2 JGI25406J46586_10055996 3300003203 Bacteria 1296
3 Ga0065165_1088697 3300005262 Bacteria 791
4 Ga0070676_10269485 3300005328 Bacteria 1143
5 Ga0070690_100173143 3300005330 Bacteria 1487
6 Ga0068869_101685801 3300005334 Bacteria 565
7 Ga0070680_100016149 3300005336 Bacteria 5870
8 Ga0070680_100945443 3300005336 Bacteria 744
9 Ga0068868_100525081 3300005338 Bacteria 1040
10 Ga0068868_101060222 3300005338 Bacteria 744
11 Ga0070691_10278117 3300005341 Bacteria 907
12 Ga0070669_101580400 3300005353 Bacteria 571
13 Ga0070671_100342791 3300005355 Bacteria 1275
14 Ga0070674_100078078 3300005356 Bacteria 2359
15 Ga0070667_100289189 3300005367 Bacteria 1473
16 Ga0070713_100050444 3300005436 Bacteria 3438
17 Ga0070710_10491183 3300005437 Bacteria 839
18 Ga0070711_100316231 3300005439 Bacteria 1246
19 Ga0070678_100047921 3300005456 Bacteria 3074
20 Ga0070681_10002569 3300005458 Bacteria 16650
21 Ga0070681_10006870 3300005458 Bacteria 11073
22 Ga0070706_100363546 3300005467 Bacteria 1348
23 Ga0070707_100070046 3300005468 Bacteria 3378
24 Ga0070698_100000125 3300005471 Bacteria 66620
25 Ga0070698_101191496 3300005471 Bacteria 711
26 Ga0070699_100067085 3300005518 Bacteria 3116
27 Ga0070699_100119723 3300005518 Bacteria 2314
28 Ga0070679_100128429 3300005530 Bacteria 2516
29 Ga0070679_100350705 3300005530 Bacteria 1423
30 Ga0070697_101077462 3300005536 Bacteria 715
31 Ga0070695_100249919 3300005545 Bacteria 1290
32 Ga0070696_100008414 3300005546 Bacteria 6903
33 Ga0070665_100054242 3300005548 Bacteria 4020
34 Ga0070665_101074939 3300005548 Bacteria 816
35 Ga0070704_100402279 3300005549 Bacteria 1168
36 Ga0068855_100006632 3300005563 Bacteria 14058
37 Ga0068855_101158272 3300005563 Bacteria 806
38 Ga0068857_100171673 3300005577 Bacteria 1971
39 Ga0068856_100204768 3300005614 Bacteria 1988
40 Ga0068856_100849664 3300005614 Bacteria 932
41 Ga0068864_100647259 3300005618 Bacteria 1029
42 Ga0068863_100472803 3300005841 Bacteria 1232
43 Ga0068858_100777227 3300005842 Bacteria 934
44 Ga0081455_10000835 3300005937 Bacteria 39661
45 Ga0081455_10022990 3300005937 Bacteria 5812
46 Ga0081455_10189328 3300005937 Bacteria 1551
47 Ga0081455_10450436 3300005937 Bacteria 879
48 Ga0081455_10720762 3300005937 Bacteria 633
49 Ga0081540_1182046 3300005983 Bacteria 785
50 Ga0081539_10005430 3300005985 Bacteria 13014
51 Ga0081539_10152647 3300005985 Bacteria 1109
52 Ga0075365_10033365 3300006038 Bacteria 3316
53 Ga0075365_10106345 3300006038 Bacteria 1925
54 Ga0075365_10460405 3300006038 Bacteria 898
55 Ga0075363_100031068 3300006048 Bacteria 2768
56 Ga0075369_10609099 3300006186 Bacteria 523
57 Ga0075366_10063939 3300006195 Bacteria 2188
58 Ga0097621_101597412 3300006237 Bacteria 620
59 Ga0075428_100665832 3300006844 Bacteria 1110
60 Ga0075430_100560847 3300006846 Bacteria 942
61 Ga0075431_101655689 3300006847 Bacteria 597
62 Ga0068865_100342742 3300006881 Bacteria 1208
63 Ga0099794_10060120 3300007265 Bacteria 1845
64 Ga0105240_10059387 3300009093 Bacteria 4773
65 Ga0105240_10167669 3300009093 Bacteria 2603
66 Ga0114129_11496621 3300009147 Bacteria 830
67 Ga0105248_11843892 3300009177 Bacteria 686
68 Ga0105248_12414325 3300009177 Bacteria 599
69 Ga0105249_11511415 3300009553 Bacteria 744
70 Ga0157370_10080632 3300013104 Bacteria 3064
71 Ga0157375_10605748 3300013308 Bacteria 1254
72 Ga0163163_10251102 3300014325 Bacteria 1819
73 Ga0182008_10198719 3300014497 Bacteria 1020
74 Ga0157376_10287011 3300014969 Bacteria 1552
75 Ga0157376_10865590 3300014969 Bacteria 920
76 Ga0157376_11099430 3300014969 Bacteria 821
77 Ga0157376_12911210 3300014969 Bacteria 518
78 Ga0163161_11390948 3300017792 Bacteria 613
79 Ga0213873_10264152 3300021358 Bacteria 548
80 Ga0213875_10001372 3300021388 Bacteria 15985
81 Ga0213875_10006288 3300021388 Bacteria 6251
82 Ga0213875_10088914 3300021388 Bacteria 1441
83 Ga0213875_10239040 3300021388 Bacteria 856
84 Ga0213871_10180139 3300021441 Bacteria 653
85 Ga0207426_1009315 3300025302 Bacteria 3895
86 Ga0207692_10075731 3300025898 Bacteria 1786
87 Ga0207645_10125399 3300025907 Bacteria 1669
88 Ga0207705_10031706 3300025909 Bacteria 3774
89 Ga0207684_10423843 3300025910 Bacteria 1143
90 Ga0207707_10016070 3300025912 Bacteria 6527
91 Ga0207707_10109999 3300025912 Bacteria 2408
92 Ga0207695_10099469 3300025913 Bacteria 2906
93 Ga0207663_10201686 3300025916 Bacteria 1435
94 Ga0207660_10158487 3300025917 Bacteria 1744
95 Ga0207662_10066751 3300025918 Bacteria 2168
96 Ga0207652_10743283 3300025921 Bacteria 873
97 Ga0207646_10169328 3300025922 Bacteria 1972
98 Ga0207681_10896815 3300025923 Bacteria 742
99 Ga0207700_10310862 3300025928 Bacteria 1363
100 Ga0207644_10262500 3300025931 Bacteria 1381
101 Ga0207706_11186018 3300025933 Bacteria 635
102 Ga0207669_10584155 3300025937 Bacteria 906
103 Ga0207704_10711280 3300025938 Bacteria 832
104 Ga0207665_10761288 3300025939 Bacteria 764
105 Ga0207691_10170220 3300025940 Bacteria 1908
106 Ga0207667_10014080 3300025949 Bacteria 9131
107 Ga0207651_10586606 3300025960 Bacteria 973
108 Ga0207640_10211893 3300025981 Bacteria 1477
109 Ga0207658_10273377 3300025986 Bacteria 1445
110 Ga0207677_10499332 3300026023 Bacteria 1052
111 Ga0207677_10640034 3300026023 Bacteria 937
112 Ga0207702_10268661 3300026078 Bacteria 1608
113 Ga0207648_10752969 3300026089 Bacteria 905
114 Ga0207676_11344918 3300026095 Bacteria 710
115 Ga0207683_10065004 3300026121 Bacteria 3216
116 Ga0268266_10019356 3300028379 Bacteria 5797
117 Ga0268266_10052121 3300028379 Bacteria 3513
118 Ga0265334_10004583 3300028573 Bacteria 6123
119 Ga0265340_10020175 3300031247 Bacteria 3429
120 Ga0265316_10091135 3300031344 Bacteria 2326
121 Ga0307408_100017655 3300031548 Bacteria 4778
122 Ga0307408_100580762 3300031548 Bacteria 993
123 Ga0307508_10558846 3300031616 Bacteria 743
124 Ga0265314_10151489 3300031711 Bacteria 1421
125 Ga0316576_10072728 3300031727 Unclassified 2538
126 Ga0316578_10091145 3300031728 Bacteria 1820
127 Ga0307413_10288776 3300031824 Bacteria 1238
128 Ga0307413_11009886 3300031824 Bacteria 714
129 Ga0307410_10572670 3300031852 Bacteria 939
130 Ga0307406_10072823 3300031901 Bacteria 2257
131 Ga0307406_11473858 3300031901 Bacteria 598
132 Ga0307407_10077384 3300031903 Bacteria 2001
133 Ga0307407_10349404 3300031903 Bacteria 1047
134 Ga0307412_10376062 3300031911 Bacteria 1149
135 Ga0307409_100014635 3300031995 Bacteria 5113
136 Ga0307409_100243793 3300031995 Bacteria 1638
137 Ga0307409_101005091 3300031995 Bacteria 852
138 Ga0307416_100623076 3300032002 Bacteria 1161
139 Ga0307416_100928918 3300032002 Bacteria 971
140 Ga0307414_10751926 3300032004 Bacteria 886
141 Ga0307414_10838348 3300032004 Bacteria 840
142 Ga0307414_10943222 3300032004 Bacteria 793
143 Ga0307411_10399769 3300032005 Bacteria 1135
144 Ga0307415_100266571 3300032126 Bacteria 1401
145 Ga0316580_10022853 3300032139 Bacteria 1930
146 Ga0316574_0035838 3300035398 Unclassified 3034
147 Ga0373931_0244618 3300035691 Bacteria 1089
148 Ga0373927_0125208 3300035695 Bacteria 1677
149 Ga0373927_0155183 3300035695 Bacteria 1499
150 Ga0316582_0229898 3300036647 Bacteria 1269
151 Ga0316584_0910819 3300036712 Bacteria 592
152 Ga0373925_0418688 3300037068 Bacteria 1094
153 Ga0373925_1761711 3300037068 Bacteria 505
154 Ga0395899_0166431 3300037312 Bacteria 1555
155 Ga0395900_0018597 3300037418 Bacteria 7086
156 Ga0395900_0619013 3300037418 Bacteria 1022
157 Ga0395898_0139008 3300037466 Bacteria 2325
158 Ga0436364_0121299 3300037853 Bacteria 57560
159 Ga0436364_0301271 3300037853 Bacteria 888
160 Ga0436364_0419004 3300037853 Bacteria 1404
161 Ga0436364_0714857 3300037853 Bacteria 42197
162 Ga0436364_0978222 3300037853 Bacteria 2040
163 Ga0436364_1243131 3300037853 Bacteria 694
164 Ga0436364_1267280 3300037853 Bacteria 5042
165 Ga0395901_0011835 3300038443 Bacteria 8847
166 Ga0395901_0331219 3300038443 Bacteria 1574
167 Ga0400483_253761 3300039062 Bacteria 1815
168 Ga0436365_0815848 3300039437 Bacteria 854
169 Ga0436365_1386313 3300039437 Bacteria 2040
170 Ga0436360_0125257 3300039438 Bacteria 877
171 Ga0436360_0839304 3300039438 Bacteria 3573
172 Ga0436360_1110167 3300039438 Bacteria 916
173 Ga0436361_0073837 3300039447 Bacteria 604
174 Ga0436361_0530901 3300039447 Bacteria 803
175 Ga0436361_1207796 3300039447 Bacteria 10633
176 Ga0436362_0267751 3300039453 Bacteria 614
177 Ga0436362_0592316 3300039453 Bacteria 1574
178 Ga0439445_0228937 3300042004 Bacteria 553
179 Ga0450904_035728 3300042139 Bacteria 526
180 Ga0466961_0759968 3300044693 Bacteria 579
181 Ga0453684_0008120 3300044712 Bacteria 18960
182 Ga0466957_0011609 3300044842 Bacteria 5091
183 Ga0451576_0000040 3300045051 Bacteria 349778
184 Ga0466967_0978905 3300045976 Bacteria 842
185 Ga0495597_0294617 3300046542 Bacteria 630
186 Ga0495671_0455751 3300046692 Bacteria 611
187 Ga0496106_1035942 3300048909 Bacteria 645
188 Ga0496108_0705471 3300048911 Bacteria 875
189 Ga0496109_1618799 3300048912 Bacteria 582
190 Ga0501032_0001025 3300049569 Bacteria 22442
191 Ga0501032_0773900 3300049569 Bacteria 607
192 Ga0501033_0003029 3300049570 Bacteria 13990
193 Ga0501033_0552823 3300049570 Bacteria 793
194 Ga0501033_0894315 3300049570 Bacteria 597
195 Ga0501034_0025438 3300049571 Bacteria 6026
196 Ga0501034_0970569 3300049571 Bacteria 735
197 Ga0501036_0005474 3300049572 Bacteria 10294
198 Ga0501036_0646516 3300049572 Bacteria 876
199 Ga0501037_0069607 3300049573 Bacteria 2561
200 Ga0501037_0205869 3300049573 Bacteria 1389
201 Ga0501037_0801437 3300049573 Bacteria 622
202 Ga0501038_0600272 3300049574 Bacteria 833
203 Ga0501041_0462148 3300049577 Bacteria 806
204 Ga0501042_0797406 3300049578 Bacteria 687
205 Ga0501043_0000339 3300049579 Bacteria 42404
206 Ga0501043_0077381 3300049579 Bacteria 2614
207 Ga0501043_0122708 3300049579 Bacteria 2038
208 Ga0501043_0577781 3300049579 Bacteria 832
209 Ga0501046_0000671 3300049580 Bacteria 33150
210 Ga0501046_0097503 3300049580 Bacteria 2258
211 Ga0501047_0001976 3300049581 Bacteria 19681
212 Ga0501047_0226682 3300049581 Bacteria 1723
213 Ga0501047_0271178 3300049581 Bacteria 1543
214 Ga0501048_0170110 3300049582 Bacteria 1543
215 Ga0501069_0000349 3300049585 Bacteria 20802
216 Ga0501070_0013881 3300049586 Bacteria 6784
217 Ga0501070_0296871 3300049586 Bacteria 1317
218 Ga0501070_0563362 3300049586 Bacteria 911
219 Ga0501070_1187428 3300049586 Bacteria 586
220 Ga0501071_0099863 3300049587 Bacteria 2139
221 Ga0501072_0326871 3300049588 Bacteria 1218
222 Ga0501072_0704157 3300049588 Bacteria 794
223 Ga0501073_0008073 3300049589 Bacteria 7809
224 Ga0501073_0082691 3300049589 Bacteria 2234
225 Ga0501073_0413912 3300049589 Bacteria 931
226 Ga0501074_0000220 3300049590 Bacteria 31534
227 Ga0501074_0848270 3300049590 Bacteria 643
228 Ga0501076_0538104 3300049592 Bacteria 963
229 Ga0501076_0645196 3300049592 Bacteria 874
230 Ga0501077_0208958 3300049593 Bacteria 1240
231 Ga0501261_118668 3300049690 Bacteria 522
232 Ga0501079_0240892 3300049741 Bacteria 1413
233 Ga0501080_0000471 3300049742 Bacteria 31285
234 Ga0501080_0263108 3300049742 Bacteria 1571
235 Ga0501080_0771894 3300049742 Bacteria 844
236 Ga0501081_0130900 3300049743 Bacteria 1793
237 Ga0501081_0175409 3300049743 Bacteria 1549
238 Ga0501083_0000746 3300049744 Bacteria 21235
239 Ga0501083_0031103 3300049744 Bacteria 3663
240 Ga0501083_0039113 3300049744 Bacteria 3222
241 Ga0501083_0155045 3300049744 Bacteria 1499
242 Ga0501035_0001114 3300049822 Bacteria 28107
243 Ga0501044_0002829 3300049823 Bacteria 19746
244 Ga0501044_0156230 3300049823 Bacteria 2260
245 Ga0501044_0166715 3300049823 Bacteria 2177
246 Ga0501044_0186904 3300049823 Bacteria 2036
247 Ga0501044_0381218 3300049823 Bacteria 1325
248 nmdc:mga03683_132518_c1 3300050489 Bacteria 1116
249 nmdc:mga00v17_92175_c1 3300050491 Bacteria 1904
250 nmdc:mga0yw44_75304_c1 3300050492 Bacteria 2104
251 nmdc:mga0yw44_767302_c1 3300050492 Bacteria 655
252 nmdc:mga0k408_200705_c1 3300050493 Bacteria 1190
253 nmdc:mga04h51_464899_c1 3300050495 Bacteria 537
254 nmdc:mga07m45_60483_c1 3300050496 Bacteria 2144
255 nmdc:mga09592_505363_c1 3300050508 Bacteria 1040
256 nmdc:mga0qj67_669788_c1 3300050509 Bacteria 827
257 nmdc:mga06r32_1762589_c1 3300050510 Bacteria 555
258 Ga0500651_0052156 3300053093 Bacteria 2565
259 Ga0500650_0185754 3300053098 Bacteria 951
260 Ga0500595_068929 3300053119 Bacteria 1053
261 Ga0500642_0000247 3300053130 Bacteria 20388
262 Ga0500658_0115238 3300053134 Bacteria 1187
263 Ga0500577_0319001 3300053142 Bacteria 679
264 Ga0500609_027311 3300053731 Bacteria 782
265 Ga0501084_0051250 3300054114 Bacteria 3454
266 Ga0501084_0354897 3300054114 Bacteria 1239
267 Ga0501082_0001076 3300060353 Bacteria 24166
268 Ga0501082_0039058 3300060353 Bacteria 4095
269 Ga0501082_0257508 3300060353 Bacteria 1518
270 2599101139 2597490356 Bacteria 7030811
271 2687579115 2687453129 Bacteria 4387428
272 2846954141 2846952575 Bacteria 6587527
273 2929203823 2929199973 Bacteria 7260745
274 8055916458 8055909800 Bacteria 7278581
275 Ga0501067_0033176
276 JGI25406J46586_10055996
277 Ga0065165_1088697
278 Ga0070676_10269485
279 Ga0070690_100173143
280 Ga0068869_101685801
281 Ga0070680_100016149
282 Ga0070680_100945443
283 Ga0068868_100525081
284 Ga0068868_101060222
285 Ga0070691_10278117
286 Ga0070669_101580400
287 Ga0070671_100342791
288 Ga0070674_100078078
289 Ga0070667_100289189
290 Ga0070713_100050444
291 Ga0070710_10491183
292 Ga0070711_100316231
293 Ga0070678_100047921
294 Ga0070681_10002569
295 Ga0070681_10006870
296 Ga0070706_100363546
297 Ga0070707_100070046
298 Ga0070698_100000125
299 Ga0070698_101191496
300 Ga0070699_100067085
301 Ga0070699_100119723
302 Ga0070679_100128429
303 Ga0070679_100350705
304 Ga0070697_101077462
305 Ga0070695_100249919
306 Ga0070696_100008414
307 Ga0070665_100054242
308 Ga0070665_101074939
309 Ga0070704_100402279
310 Ga0068855_100006632
311 Ga0068855_101158272
312 Ga0068857_100171673
313 Ga0068856_100204768
314 Ga0068856_100849664
315 Ga0068864_100647259
316 Ga0068863_100472803
317 Ga0068858_100777227
318 Ga0081455_10000835
319 Ga0081455_10022990
320 Ga0081455_10189328
321 Ga0081455_10450436
322 Ga0081455_10720762
323 Ga0081540_1182046
324 Ga0081539_10005430
325 Ga0081539_10152647
326 Ga0075365_10033365
327 Ga0075365_10106345
328 Ga0075365_10460405
329 Ga0075363_100031068
330 Ga0075369_10609099
331 Ga0075366_10063939
332 Ga0097621_101597412
333 Ga0075428_100665832
334 Ga0075430_100560847
335 Ga0075431_101655689
336 Ga0068865_100342742
337 Ga0099794_10060120
338 Ga0105240_10059387
339 Ga0105240_10167669
340 Ga0114129_11496621
341 Ga0105248_11843892
342 Ga0105248_12414325
343 Ga0105249_11511415
344 Ga0157370_10080632
345 Ga0157375_10605748
346 Ga0163163_10251102
347 Ga0182008_10198719
348 Ga0157376_10287011
349 Ga0157376_10865590
350 Ga0157376_11099430
351 Ga0157376_12911210
352 Ga0163161_11390948
353 Ga0213873_10264152
354 Ga0213875_10001372
355 Ga0213875_10006288
356 Ga0213875_10088914
357 Ga0213875_10239040
358 Ga0213871_10180139
359 Ga0207426_1009315
360 Ga0207692_10075731
361 Ga0207645_10125399
362 Ga0207705_10031706
363 Ga0207684_10423843
364 Ga0207707_10016070
365 Ga0207707_10109999
366 Ga0207695_10099469
367 Ga0207663_10201686
368 Ga0207660_10158487
369 Ga0207662_10066751
370 Ga0207652_10743283
371 Ga0207646_10169328
372 Ga0207681_10896815
373 Ga0207700_10310862
374 Ga0207644_10262500
375 Ga0207706_11186018
376 Ga0207669_10584155
377 Ga0207704_10711280
378 Ga0207665_10761288
379 Ga0207691_10170220
380 Ga0207667_10014080
381 Ga0207651_10586606
382 Ga0207640_10211893
383 Ga0207658_10273377
384 Ga0207677_10499332
385 Ga0207677_10640034
386 Ga0207702_10268661
387 Ga0207648_10752969
388 Ga0207676_11344918
389 Ga0207683_10065004
390 Ga0268266_10019356
391 Ga0268266_10052121
392 Ga0265334_10004583
393 Ga0265340_10020175
394 Ga0265316_10091135
395 Ga0307408_100017655
396 Ga0307408_100580762
397 Ga0307508_10558846
398 Ga0265314_10151489
399 Ga0316576_10072728
400 Ga0316578_10091145
401 Ga0307413_10288776
402 Ga0307413_11009886
403 Ga0307410_10572670
404 Ga0307406_10072823
405 Ga0307406_11473858
406 Ga0307407_10077384
407 Ga0307407_10349404
408 Ga0307412_10376062
409 Ga0307409_100014635
410 Ga0307409_100243793
411 Ga0307409_101005091
412 Ga0307416_100623076
413 Ga0307416_100928918
414 Ga0307414_10751926
415 Ga0307414_10838348
416 Ga0307414_10943222
417 Ga0307411_10399769
418 Ga0307415_100266571
419 Ga0316580_10022853
420 Ga0316574_0035838
421 Ga0373931_0244618
422 Ga0373927_0125208
423 Ga0373927_0155183
424 Ga0316582_0229898
425 Ga0316584_0910819
426 Ga0373925_0418688
427 Ga0373925_1761711
428 Ga0395899_0166431
429 Ga0395900_0018597
430 Ga0395900_0619013
431 Ga0395898_0139008
432 Ga0436364_0121299
433 Ga0436364_0301271
434 Ga0436364_0419004
435 Ga0436364_0714857
436 Ga0436364_0978222
437 Ga0436364_1243131
438 Ga0436364_1267280
439 Ga0395901_0011835
440 Ga0395901_0331219
441 Ga0400483_253761
442 Ga0436365_0815848
443 Ga0436365_1386313
444 Ga0436360_0125257
445 Ga0436360_0839304
446 Ga0436360_1110167
447 Ga0436361_0073837
448 Ga0436361_0530901
449 Ga0436361_1207796
450 Ga0436362_0267751
451 Ga0436362_0592316
452 Ga0439445_0228937
453 Ga0450904_035728
454 Ga0466961_0759968
455 Ga0453684_0008120
456 Ga0466957_0011609
457 Ga0451576_0000040
458 Ga0466967_0978905
459 Ga0495597_0294617
460 Ga0495671_0455751
461 Ga0496106_1035942
462 Ga0496108_0705471
463 Ga0496109_1618799
464 Ga0501032_0001025
465 Ga0501032_0773900
466 Ga0501033_0003029
467 Ga0501033_0552823
468 Ga0501033_0894315
469 Ga0501034_0025438
470 Ga0501034_0970569
471 Ga0501036_0005474
472 Ga0501036_0646516
473 Ga0501037_0069607
474 Ga0501037_0205869
475 Ga0501037_0801437
476 Ga0501038_0600272
477 Ga0501041_0462148
478 Ga0501042_0797406
479 Ga0501043_0000339
480 Ga0501043_0077381
481 Ga0501043_0122708
482 Ga0501043_0577781
483 Ga0501046_0000671
484 Ga0501046_0097503
485 Ga0501047_0001976
486 Ga0501047_0226682
487 Ga0501047_0271178
488 Ga0501048_0170110
489 Ga0501069_0000349
490 Ga0501070_0013881
491 Ga0501070_0296871
492 Ga0501070_0563362
493 Ga0501070_1187428
494 Ga0501071_0099863
495 Ga0501072_0326871
496 Ga0501072_0704157
497 Ga0501073_0008073
498 Ga0501073_0082691
499 Ga0501073_0413912
500 Ga0501074_0000220
501 Ga0501074_0848270
502 Ga0501076_0538104
503 Ga0501076_0645196
504 Ga0501077_0208958
505 Ga0501261_118668
506 Ga0501079_0240892
507 Ga0501080_0000471
508 Ga0501080_0263108
509 Ga0501080_0771894
510 Ga0501081_0130900
511 Ga0501081_0175409
512 Ga0501083_0000746
513 Ga0501083_0031103
514 Ga0501083_0039113
515 Ga0501083_0155045
516 Ga0501035_0001114
517 Ga0501044_0002829
518 Ga0501044_0156230
519 Ga0501044_0166715
520 Ga0501044_0186904
521 Ga0501044_0381218
522 nmdc:mga03683_132518_c1
523 nmdc:mga00v17_92175_c1
524 nmdc:mga0yw44_75304_c1
525 nmdc:mga0yw44_767302_c1
526 nmdc:mga0k408_200705_c1
527 nmdc:mga04h51_464899_c1
528 nmdc:mga07m45_60483_c1
529 nmdc:mga09592_505363_c1
530 nmdc:mga0qj67_669788_c1
531 nmdc:mga06r32_1762589_c1
532 Ga0500651_0052156
533 Ga0500650_0185754
534 Ga0500595_068929
535 Ga0500642_0000247
536 Ga0500658_0115238
537 Ga0500577_0319001
538 Ga0500609_027311
539 Ga0501084_0051250
540 Ga0501084_0354897
541 Ga0501082_0001076
542 Ga0501082_0039058
543 Ga0501082_0257508
544 2599101139
545 2687579115
546 2846954141
547 2929203823
548 8055916458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

40

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9723 18 123
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9424 22 137
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.8971 19 126
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8928 19 125
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8925 19 124
ID Description Score Start End Superfamily
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9665 18 111 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9533 22 111 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.947 18 111 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9363 18 111 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9296 11 111 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A3B8SXS2-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9943 14 104 GO:0000105
GO:0004635
AF-A0A522Z809-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9906 8 140 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A259MAT4-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9885 8 140 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A3M2FVE2-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9881 18 108 GO:0000105
GO:0004635
AF-A0A6N7AHL1-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9877 19 138 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270

Map