F375666

General Info

Members Datasets Scaffolds Average Seq Length
268 163 536 122

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_00689|Ga0400490_00689_517_918
Length 133
Sequence MEAIMKFEPVNFREKLGLFDEHWSPKIIAQMNDYHFKLVKIQGEFVWHSHAETDEVFIVLSGEMRIEMRNGHFDLAQCRRVHLRPGELFVVPKGVEHKPIADNECHILLVEPAGLVNTGDAESDLTAPNDVWI

Samples

Sample ID Description Type Environment
1 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
93 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
94 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
95 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
96 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
97 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
98 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
101 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
112 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
113 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
114 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
117 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
118 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
130 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
131 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
138 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
139 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
140 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
141 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
148 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
149 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
150 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
151 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
152 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.24
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 8.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400490_00689 3300038726 Bacteria 1074
2 Ga0065704_10664820 3300005289 Bacteria 576
3 Ga0070690_100797987 3300005330 Bacteria 732
4 Ga0068869_100382941 3300005334 Bacteria 1153
5 Ga0070680_100231957 3300005336 Bacteria 1559
6 Ga0070689_100672724 3300005340 Bacteria 902
7 Ga0070669_100183755 3300005353 Bacteria 1637
8 Ga0070674_100472543 3300005356 Bacteria 1039
9 Ga0070705_100354560 3300005440 Unclassified 1071
10 Ga0070694_100236047 3300005444 Bacteria 1377
11 Ga0070708_100012974 3300005445 Bacteria 6808
12 Ga0070708_100408906 3300005445 Bacteria 1280
13 Ga0068867_100801307 3300005459 Bacteria 840
14 Ga0068867_101917966 3300005459 Bacteria 559
15 Ga0070706_100008711 3300005467 Bacteria 9457
16 Ga0070707_100040176 3300005468 Bacteria 4475
17 Ga0070707_101687112 3300005468 Unclassified 601
18 Ga0070707_101788108 3300005468 Unclassified 582
19 Ga0070698_100318493 3300005471 Unclassified 1486
20 Ga0070699_100063879 3300005518 Bacteria 3193
21 Ga0070699_100132624 3300005518 Bacteria 2196
22 Ga0070699_100706986 3300005518 Bacteria 921
23 Ga0070672_100809214 3300005543 Bacteria 825
24 Ga0070672_101628937 3300005543 Bacteria 579
25 Ga0070695_100012840 3300005545 Bacteria 5028
26 Ga0070695_100033204 3300005545 Unclassified 3228
27 Ga0070696_100036979 3300005546 Bacteria 3368
28 Ga0070696_100375918 3300005546 Bacteria 1106
29 Ga0070693_100019192 3300005547 Bacteria 3580
30 Ga0070693_100055663 3300005547 Bacteria 2280
31 Ga0070704_100178289 3300005549 Bacteria 1697
32 Ga0070704_100327188 3300005549 Bacteria 1286
33 Ga0070704_100376664 3300005549 Bacteria 1205
34 Ga0068857_101018942 3300005577 Unclassified 797
35 Ga0068856_101118044 3300005614 Bacteria 805
36 Ga0070702_100132948 3300005615 Bacteria 1574
37 Ga0070702_100665288 3300005615 Bacteria 789
38 Ga0070702_101228659 3300005615 Bacteria 605
39 Ga0068866_11089658 3300005718 Bacteria 572
40 Ga0068861_100848715 3300005719 Bacteria 861
41 Ga0068860_100472439 3300005843 Bacteria 1249
42 Ga0068862_100600096 3300005844 Bacteria 1057
43 Ga0081455_10297094 3300005937 Bacteria 1160
44 Ga0081539_10000481 3300005985 Bacteria 84382
45 Ga0075432_10321809 3300006058 Bacteria 648
46 Ga0070715_10242365 3300006163 Bacteria 938
47 Ga0070716_100318932 3300006173 Bacteria 1088
48 Ga0075428_100275498 3300006844 Bacteria 1810
49 Ga0075430_100002844 3300006846 Bacteria 14485
50 Ga0075431_100016972 3300006847 Bacteria 7392
51 Ga0075433_10003481 3300006852 Bacteria 12160
52 Ga0075433_10007986 3300006852 Bacteria 8422
53 Ga0075433_10067350 3300006852 Bacteria 3143
54 Ga0075433_10067511 3300006852 Bacteria 3139
55 Ga0075434_100013348 3300006871 Bacteria 7814
56 Ga0075434_100091388 3300006871 Bacteria 3046
57 Ga0075434_100214292 3300006871 Bacteria 1946
58 Ga0075434_100547850 3300006871 Bacteria 1176
59 Ga0075429_100010603 3300006880 Bacteria 7973
60 Ga0075429_100031343 3300006880 Bacteria 4620
61 Ga0075429_100080590 3300006880 Bacteria 2838
62 Ga0075436_100052897 3300006914 Bacteria 2803
63 Ga0075436_100465774 3300006914 Bacteria 922
64 Ga0075435_100013796 3300007076 Bacteria 6022
65 Ga0075435_100016168 3300007076 Bacteria 5622
66 Ga0075435_100099974 3300007076 Bacteria 2403
67 Ga0075435_100697100 3300007076 Bacteria 882
68 Ga0111539_10012489 3300009094 Bacteria 10645
69 Ga0111539_10042891 3300009094 Bacteria 5428
70 Ga0111539_10618889 3300009094 Bacteria 1261
71 Ga0114129_10079022 3300009147 Bacteria 4574
72 Ga0114129_10089089 3300009147 Bacteria 4277
73 Ga0114129_10311331 3300009147 Bacteria 2096
74 Ga0114129_10474986 3300009147 Bacteria 1637
75 Ga0114129_13487740 3300009147 Bacteria 503
76 Ga0105242_10210564 3300009176 Bacteria 1732
77 Ga0105242_11849152 3300009176 Bacteria 643
78 Ga0105246_12325944 3300011119 Unclassified 524
79 Ga0157373_10099198 3300013100 Bacteria 2050
80 Ga0157374_10740398 3300013296 Unclassified 997
81 Ga0157378_11023962 3300013297 Bacteria 861
82 Ga0163162_11041835 3300013306 Bacteria 926
83 Ga0157375_10024375 3300013308 Bacteria 5598
84 Ga0182006_1327203 3300015261 Bacteria 504
85 Ga0182007_10139314 3300015262 Bacteria 820
86 Ga0163161_11702918 3300017792 Bacteria 558
87 Ga0207646_10003290 3300025922 Bacteria 18400
88 Ga0207681_10142100 3300025923 Bacteria 1789
89 Ga0207686_10134421 3300025934 Bacteria 1701
90 Ga0207689_10284415 3300025942 Bacteria 1369
91 Ga0207668_11437314 3300025972 Bacteria 622
92 Ga0207708_11023833 3300026075 Bacteria 718
93 Ga0207648_10027103 3300026089 Bacteria 5090
94 Ga0207674_10174193 3300026116 Bacteria 2104
95 Ga0207675_101937209 3300026118 Bacteria 607
96 Ga0207428_10024843 3300027907 Bacteria 5026
97 Ga0207428_10751130 3300027907 Unclassified 695
98 Ga0268265_10592858 3300028380 Bacteria 1058
99 Ga0265318_10003693 3300028577 Bacteria 7646
100 Ga0265338_10028584 3300028800 Bacteria 5556
101 Ga0265330_10074785 3300031235 Bacteria 1464
102 Ga0265320_10063269 3300031240 Bacteria 1760
103 Ga0265325_10090015 3300031241 Bacteria 1515
104 Ga0265340_10005133 3300031247 Bacteria 7278
105 Ga0265331_10068101 3300031250 Bacteria 1669
106 Ga0265316_10438316 3300031344 Bacteria 938
107 Ga0316575_10046017 3300031665 Bacteria 1733
108 Ga0316575_10058446 3300031665 Bacteria 1538
109 Ga0316575_10231195 3300031665 Bacteria 773
110 Ga0316579_10198051 3300031691 Bacteria 971
111 Ga0265342_10260540 3300031712 Bacteria 923
112 Ga0316576_10026261 3300031727 Unclassified 4086
113 Ga0316576_10033873 3300031727 Unclassified 3638
114 Ga0316576_10083871 3300031727 Bacteria 2368
115 Ga0316576_10288027 3300031727 Unclassified 1229
116 Ga0316576_10382438 3300031727 Bacteria 1045
117 Ga0316576_10415552 3300031727 Unclassified 996
118 Ga0316576_10598862 3300031727 Unclassified 805
119 Ga0316578_10005346 3300031728 Bacteria 6212
120 Ga0316578_10031619 3300031728 Bacteria 3018
121 Ga0316578_10579679 3300031728 Bacteria 658
122 Ga0316578_10905145 3300031728 Unclassified 509
123 Ga0316577_10055833 3300031733 Bacteria 2204
124 Ga0316577_10107138 3300031733 Bacteria 1568
125 Ga0316577_10108007 3300031733 Unclassified 1561
126 Ga0316577_10203053 3300031733 Unclassified 1120
127 Ga0307410_10164498 3300031852 Unclassified 1666
128 Ga0307406_10570780 3300031901 Bacteria 928
129 Ga0307407_11044668 3300031903 Bacteria 633
130 Ga0307412_10533666 3300031911 Bacteria 982
131 Ga0307412_11192711 3300031911 Bacteria 681
132 Ga0307409_100099338 3300031995 Bacteria 2410
133 Ga0307416_100235650 3300032002 Bacteria 1768
134 Ga0307416_100461536 3300032002 Bacteria 1325
135 Ga0307416_102092242 3300032002 Bacteria 668
136 Ga0307414_10548635 3300032004 Bacteria 1030
137 Ga0307411_10021867 3300032005 Bacteria 3754
138 Ga0307415_100416920 3300032126 Bacteria 1151
139 Ga0307415_101055298 3300032126 Bacteria 758
140 Ga0307415_101273072 3300032126 Bacteria 695
141 Ga0316583_10014276 3300032133 Bacteria 2864
142 Ga0316583_10166439 3300032133 Bacteria 767
143 Ga0316583_10221639 3300032133 Bacteria 656
144 Ga0316574_0047888 3300035398 Bacteria 2654
145 Ga0316582_0007542 3300036647 Bacteria 5796
146 Ga0316582_0170101 3300036647 Bacteria 1479
147 Ga0316582_0570301 3300036647 Bacteria 780
148 Ga0316584_0034627 3300036712 Bacteria 3744
149 Ga0316581_0136534 3300037588 Bacteria 756
150 Ga0400484_01270 3300038725 Bacteria 1349
151 Ga0400484_28510 3300038725 Bacteria 4055
152 Ga0400484_38229 3300038725 Bacteria 1620
153 Ga0400484_42165 3300038725 Bacteria 1334
154 Ga0400490_17812 3300038726 Bacteria 1298
155 Ga0400490_24394 3300038726 Bacteria 5137
156 Ga0400491_11598 3300038727 Bacteria 1066
157 Ga0400491_17564 3300038727 Bacteria 2433
158 Ga0400485_17302 3300038735 Bacteria 1807
159 Ga0400488_15825 3300038741 Bacteria 1977
160 Ga0400488_22313 3300038741 Bacteria 2408
161 Ga0400488_36163 3300038741 Bacteria 1058
162 Ga0400488_54942 3300038741 Bacteria 5496
163 Ga0400488_62728 3300038741 Bacteria 9942
164 Ga0400486_20882 3300038742 Bacteria 1062
165 Ga0400486_24700 3300038742 Bacteria 1044
166 Ga0242420_074243 3300038996 Unclassified 695
167 Ga0400483_047221 3300039062 Bacteria 4406
168 Ga0400483_053567 3300039062 Unclassified 1858
169 Ga0400483_102139 3300039062 Bacteria 14393
170 Ga0400483_121221 3300039062 Bacteria 2218
171 Ga0400483_125980 3300039062 Bacteria 1024
172 Ga0400483_166418 3300039062 Bacteria 5751
173 Ga0400483_184198 3300039062 Bacteria 5249
174 Ga0400483_226407 3300039062 Bacteria 4390
175 Ga0400483_288022 3300039062 Bacteria 1860
176 Ga0400489_07473 3300039093 Bacteria 9098
177 Ga0400489_19314 3300039093 Bacteria 3017
178 Ga0400489_37531 3300039093 Bacteria 7222
179 Ga0400487_19589 3300039110 Bacteria 1305
180 Ga0400487_53768 3300039110 Bacteria 3811
181 Ga0400487_60354 3300039110 Bacteria 1262
182 Ga0451577_0465007 3300042876 Bacteria 1149
183 Ga0466965_0210032 3300044683 Bacteria 1035
184 Ga0453684_0031204 3300044712 Bacteria 7496
185 Ga0451576_0838729 3300045051 Unclassified 965
186 Ga0495636_0375363 3300047318 Bacteria 674
187 Ga0496104_0965860 3300048907 Bacteria 756
188 Ga0496110_0445847 3300048913 Bacteria 1180
189 Ga0496111_0544218 3300048914 Bacteria 853
190 Ga0496112_0476402 3300048915 Bacteria 1185
191 Ga0496112_0567879 3300048915 Unclassified 1068
192 Ga0496112_1350414 3300048915 Bacteria 628
193 Ga0501291_004919 3300049514 Bacteria 1724
194 Ga0501291_112029 3300049514 Bacteria 582
195 Ga0501292_016541 3300049515 Bacteria 1161
196 Ga0501296_004254 3300049519 Bacteria 1555
197 Ga0501297_010465 3300049520 Bacteria 1050
198 Ga0501298_003071 3300049521 Bacteria 2574
199 Ga0501299_098367 3300049522 Bacteria 675
200 Ga0501300_007644 3300049523 Bacteria 1585
201 Ga0501303_010412 3300049526 Bacteria 870
202 Ga0501041_0510513 3300049577 Bacteria 765
203 Ga0501043_0308000 3300049579 Bacteria 1209
204 Ga0501048_0072291 3300049582 Bacteria 2435
205 Ga0501069_0147037 3300049585 Bacteria 1353
206 Ga0501071_0061098 3300049587 Bacteria 2729
207 Ga0501072_0033892 3300049588 Bacteria 4001
208 Ga0501074_0070188 3300049590 Bacteria 2519
209 Ga0501075_0014505 3300049591 Bacteria 5648
210 Ga0501076_0079021 3300049592 Bacteria 2640
211 Ga0501077_1031583 3300049593 Bacteria 529
212 Ga0501202_014423 3300049652 Bacteria 1513
213 Ga0501207_069345 3300049654 Bacteria 659
214 Ga0501216_014902 3300049660 Bacteria 1305
215 Ga0501217_003889 3300049661 Bacteria 3042
216 Ga0501223_024592 3300049663 Bacteria 1172
217 Ga0501227_045694 3300049665 Bacteria 1093
218 Ga0501228_026889 3300049666 Bacteria 684
219 Ga0501235_005669 3300049669 Bacteria 2716
220 Ga0501243_030983 3300049675 Bacteria 913
221 Ga0501246_042337 3300049676 Bacteria 548
222 Ga0501250_011463 3300049680 Bacteria 1034
223 Ga0501255_026609 3300049684 Bacteria 782
224 Ga0501221_009744 3300049704 Bacteria 1691
225 Ga0501225_0014137 3300049705 Bacteria 2230
226 Ga0501234_096356 3300049707 Bacteria 534
227 Ga0501079_0081556 3300049741 Bacteria 2501
228 Ga0501081_0004796 3300049743 Bacteria 8694
229 Ga0501083_0547450 3300049744 Bacteria 753
230 Ga0501266_014822 3300049763 Bacteria 1025
231 Ga0501270_007737 3300049767 Bacteria 1340
232 Ga0501273_006634 3300049770 Bacteria 1343
233 Ga0501275_021568 3300049772 Bacteria 795
234 Ga0501278_014694 3300049774 Bacteria 668
235 Ga0501212_022916 3300049851 Bacteria 976
236 nmdc:mga05p37_108848_c1 3300050507 Bacteria 3409
237 nmdc:mga05p37_648816_c1 3300050507 Bacteria 1182
238 nmdc:mga05p37_758976_c1 3300050507 Bacteria 1068
239 nmdc:mga09592_28446_c1 3300050508 Unclassified 4643
240 nmdc:mga09592_38001_c1 3300050508 Bacteria 4040
241 nmdc:mga0qj67_14716_c1 3300050509 Bacteria 5915
242 nmdc:mga06r32_1737179_c1 3300050510 Bacteria 560
243 nmdc:mga06r32_98559_c1 3300050510 Bacteria 2865
244 nmdc:mga06r32_99802_c1 3300050510 Bacteria 2848
245 nmdc:mga08y16_180955_c1 3300050511 Bacteria 2189
246 nmdc:mga08y16_29699_c1 3300050511 Bacteria 5756
247 nmdc:mga08y16_36348_c1 3300050511 Bacteria 5173
248 nmdc:mga0n895_176944_c1 3300050512 Bacteria 2164
249 nmdc:mga0n895_2858_c1 3300050512 Bacteria 13687
250 nmdc:mga0n895_342302_c1 3300050512 Bacteria 1515
251 nmdc:mga0n895_4742_c1 3300050512 Bacteria 11234
252 nmdc:mga0n895_475991_c1 3300050512 Bacteria 1260
253 nmdc:mga0n895_749315_c1 3300050512 Bacteria 970
254 nmdc:mga0rr50_13718_c1 3300050513 Bacteria 5288
255 nmdc:mga0rr50_14025_c1 3300050513 Bacteria 5240
256 nmdc:mga0rr50_323217_c1 3300050513 Bacteria 1294
257 nmdc:mga0rr50_398331_c1 3300050513 Bacteria 1162
258 nmdc:mga0rr50_888836_c1 3300050513 Bacteria 760
259 nmdc:mga08x19_23301_c1 3300050514 Bacteria 3840
260 nmdc:mga08x19_295212_c1 3300050514 Bacteria 1125
261 nmdc:mga08x19_403738_c1 3300050514 Bacteria 959
262 nmdc:mga0a205_1244621_c1 3300050515 Bacteria 592
263 nmdc:mga0a205_152288_c1 3300050515 Bacteria 2212
264 nmdc:mga0a205_307250_c1 3300050515 Bacteria 1458
265 nmdc:mga0a205_90869_c1 3300050515 Bacteria 2950
266 nmdc:mga0a205_930774_c1 3300050515 Bacteria 716
267 Ga0500622_0035979 3300053156 Bacteria 2589
268 Ga0501084_0004301 3300054114 Bacteria 11597
269 Ga0400490_00689
270 Ga0065704_10664820
271 Ga0070690_100797987
272 Ga0068869_100382941
273 Ga0070680_100231957
274 Ga0070689_100672724
275 Ga0070669_100183755
276 Ga0070674_100472543
277 Ga0070705_100354560
278 Ga0070694_100236047
279 Ga0070708_100012974
280 Ga0070708_100408906
281 Ga0068867_100801307
282 Ga0068867_101917966
283 Ga0070706_100008711
284 Ga0070707_100040176
285 Ga0070707_101687112
286 Ga0070707_101788108
287 Ga0070698_100318493
288 Ga0070699_100063879
289 Ga0070699_100132624
290 Ga0070699_100706986
291 Ga0070672_100809214
292 Ga0070672_101628937
293 Ga0070695_100012840
294 Ga0070695_100033204
295 Ga0070696_100036979
296 Ga0070696_100375918
297 Ga0070693_100019192
298 Ga0070693_100055663
299 Ga0070704_100178289
300 Ga0070704_100327188
301 Ga0070704_100376664
302 Ga0068857_101018942
303 Ga0068856_101118044
304 Ga0070702_100132948
305 Ga0070702_100665288
306 Ga0070702_101228659
307 Ga0068866_11089658
308 Ga0068861_100848715
309 Ga0068860_100472439
310 Ga0068862_100600096
311 Ga0081455_10297094
312 Ga0081539_10000481
313 Ga0075432_10321809
314 Ga0070715_10242365
315 Ga0070716_100318932
316 Ga0075428_100275498
317 Ga0075430_100002844
318 Ga0075431_100016972
319 Ga0075433_10003481
320 Ga0075433_10007986
321 Ga0075433_10067350
322 Ga0075433_10067511
323 Ga0075434_100013348
324 Ga0075434_100091388
325 Ga0075434_100214292
326 Ga0075434_100547850
327 Ga0075429_100010603
328 Ga0075429_100031343
329 Ga0075429_100080590
330 Ga0075436_100052897
331 Ga0075436_100465774
332 Ga0075435_100013796
333 Ga0075435_100016168
334 Ga0075435_100099974
335 Ga0075435_100697100
336 Ga0111539_10012489
337 Ga0111539_10042891
338 Ga0111539_10618889
339 Ga0114129_10079022
340 Ga0114129_10089089
341 Ga0114129_10311331
342 Ga0114129_10474986
343 Ga0114129_13487740
344 Ga0105242_10210564
345 Ga0105242_11849152
346 Ga0105246_12325944
347 Ga0157373_10099198
348 Ga0157374_10740398
349 Ga0157378_11023962
350 Ga0163162_11041835
351 Ga0157375_10024375
352 Ga0182006_1327203
353 Ga0182007_10139314
354 Ga0163161_11702918
355 Ga0207646_10003290
356 Ga0207681_10142100
357 Ga0207686_10134421
358 Ga0207689_10284415
359 Ga0207668_11437314
360 Ga0207708_11023833
361 Ga0207648_10027103
362 Ga0207674_10174193
363 Ga0207675_101937209
364 Ga0207428_10024843
365 Ga0207428_10751130
366 Ga0268265_10592858
367 Ga0265318_10003693
368 Ga0265338_10028584
369 Ga0265330_10074785
370 Ga0265320_10063269
371 Ga0265325_10090015
372 Ga0265340_10005133
373 Ga0265331_10068101
374 Ga0265316_10438316
375 Ga0316575_10046017
376 Ga0316575_10058446
377 Ga0316575_10231195
378 Ga0316579_10198051
379 Ga0265342_10260540
380 Ga0316576_10026261
381 Ga0316576_10033873
382 Ga0316576_10083871
383 Ga0316576_10288027
384 Ga0316576_10382438
385 Ga0316576_10415552
386 Ga0316576_10598862
387 Ga0316578_10005346
388 Ga0316578_10031619
389 Ga0316578_10579679
390 Ga0316578_10905145
391 Ga0316577_10055833
392 Ga0316577_10107138
393 Ga0316577_10108007
394 Ga0316577_10203053
395 Ga0307410_10164498
396 Ga0307406_10570780
397 Ga0307407_11044668
398 Ga0307412_10533666
399 Ga0307412_11192711
400 Ga0307409_100099338
401 Ga0307416_100235650
402 Ga0307416_100461536
403 Ga0307416_102092242
404 Ga0307414_10548635
405 Ga0307411_10021867
406 Ga0307415_100416920
407 Ga0307415_101055298
408 Ga0307415_101273072
409 Ga0316583_10014276
410 Ga0316583_10166439
411 Ga0316583_10221639
412 Ga0316574_0047888
413 Ga0316582_0007542
414 Ga0316582_0170101
415 Ga0316582_0570301
416 Ga0316584_0034627
417 Ga0316581_0136534
418 Ga0400484_01270
419 Ga0400484_28510
420 Ga0400484_38229
421 Ga0400484_42165
422 Ga0400490_17812
423 Ga0400490_24394
424 Ga0400491_11598
425 Ga0400491_17564
426 Ga0400485_17302
427 Ga0400488_15825
428 Ga0400488_22313
429 Ga0400488_36163
430 Ga0400488_54942
431 Ga0400488_62728
432 Ga0400486_20882
433 Ga0400486_24700
434 Ga0242420_074243
435 Ga0400483_047221
436 Ga0400483_053567
437 Ga0400483_102139
438 Ga0400483_121221
439 Ga0400483_125980
440 Ga0400483_166418
441 Ga0400483_184198
442 Ga0400483_226407
443 Ga0400483_288022
444 Ga0400489_07473
445 Ga0400489_19314
446 Ga0400489_37531
447 Ga0400487_19589
448 Ga0400487_53768
449 Ga0400487_60354
450 Ga0451577_0465007
451 Ga0466965_0210032
452 Ga0453684_0031204
453 Ga0451576_0838729
454 Ga0495636_0375363
455 Ga0496104_0965860
456 Ga0496110_0445847
457 Ga0496111_0544218
458 Ga0496112_0476402
459 Ga0496112_0567879
460 Ga0496112_1350414
461 Ga0501291_004919
462 Ga0501291_112029
463 Ga0501292_016541
464 Ga0501296_004254
465 Ga0501297_010465
466 Ga0501298_003071
467 Ga0501299_098367
468 Ga0501300_007644
469 Ga0501303_010412
470 Ga0501041_0510513
471 Ga0501043_0308000
472 Ga0501048_0072291
473 Ga0501069_0147037
474 Ga0501071_0061098
475 Ga0501072_0033892
476 Ga0501074_0070188
477 Ga0501075_0014505
478 Ga0501076_0079021
479 Ga0501077_1031583
480 Ga0501202_014423
481 Ga0501207_069345
482 Ga0501216_014902
483 Ga0501217_003889
484 Ga0501223_024592
485 Ga0501227_045694
486 Ga0501228_026889
487 Ga0501235_005669
488 Ga0501243_030983
489 Ga0501246_042337
490 Ga0501250_011463
491 Ga0501255_026609
492 Ga0501221_009744
493 Ga0501225_0014137
494 Ga0501234_096356
495 Ga0501079_0081556
496 Ga0501081_0004796
497 Ga0501083_0547450
498 Ga0501266_014822
499 Ga0501270_007737
500 Ga0501273_006634
501 Ga0501275_021568
502 Ga0501278_014694
503 Ga0501212_022916
504 nmdc:mga05p37_108848_c1
505 nmdc:mga05p37_648816_c1
506 nmdc:mga05p37_758976_c1
507 nmdc:mga09592_28446_c1
508 nmdc:mga09592_38001_c1
509 nmdc:mga0qj67_14716_c1
510 nmdc:mga06r32_1737179_c1
511 nmdc:mga06r32_98559_c1
512 nmdc:mga06r32_99802_c1
513 nmdc:mga08y16_180955_c1
514 nmdc:mga08y16_29699_c1
515 nmdc:mga08y16_36348_c1
516 nmdc:mga0n895_176944_c1
517 nmdc:mga0n895_2858_c1
518 nmdc:mga0n895_342302_c1
519 nmdc:mga0n895_4742_c1
520 nmdc:mga0n895_475991_c1
521 nmdc:mga0n895_749315_c1
522 nmdc:mga0rr50_13718_c1
523 nmdc:mga0rr50_14025_c1
524 nmdc:mga0rr50_323217_c1
525 nmdc:mga0rr50_398331_c1
526 nmdc:mga0rr50_888836_c1
527 nmdc:mga08x19_23301_c1
528 nmdc:mga08x19_295212_c1
529 nmdc:mga08x19_403738_c1
530 nmdc:mga0a205_1244621_c1
531 nmdc:mga0a205_152288_c1
532 nmdc:mga0a205_307250_c1
533 nmdc:mga0a205_90869_c1
534 nmdc:mga0a205_930774_c1
535 Ga0500622_0035979
536 Ga0501084_0004301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

35

111

0.89

PF05899

Cupin_3

EutQ-like cupin domain

34

106

0.86

PF00190

Cupin_1

Cupin

30

118

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9981 6 100
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9207 6 100
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9148 4 100
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.9131 5 100
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9117 4 100
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9721 2 100 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.952 2 100 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9102 29 100 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9067 29 100 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.904 29 99 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2E6VUN2-F1-model_v4 Cupin 1.001 5 121
AF-A0A2M7ALE4-F1-model_v4 Cupin 1.001 21 121
AF-A0A536TM35-F1-model_v4 Cupin domain-containing protein 1 21 121
AF-A0A2E8EV71-F1-model_v4 Cupin type-2 domain-containing protein 1 27 111
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9989 7 95

Map