F375455

General Info

Members Datasets Scaffolds Average Seq Length
268 166 536 170

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10023903|Ga0111539_100239035
Length 201
Sequence VVLSLPQAPIGAQRAEYVNGLISVMALLQILEFPDPRLRTRAQPVAQVDAALRKLVDDMFETMYAAPGIGLAATQVNVAKRLLVIDVSEKRDQPLVFINPEILAREGIEETEEGCLSVPGVFDKVTRAEKILVRALDRDGKQFEMPADGLLAVCIQHEIDHLDGKLFVDYLSELKRTRIRKKLEKERKERPGSARSAPKAL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
119 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
120 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
145 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
162 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
163 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
164 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
165 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
166 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.07
Nodule 0
Rhizoplane 1.49
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10023903 3300009094 Bacteria 7508
2 Ga0065712_10191862 3300005290 Bacteria 1145
3 Ga0065707_10088589 3300005295 Bacteria 4612
4 Ga0070683_100877547 3300005329 Bacteria 860
5 Ga0070690_100570606 3300005330 Bacteria 855
6 Ga0070670_100110132 3300005331 Bacteria 2373
7 Ga0070677_10096479 3300005333 Bacteria 1295
8 Ga0068869_100137273 3300005334 Bacteria 1885
9 Ga0070680_100355930 3300005336 Bacteria 1245
10 Ga0070680_100409807 3300005336 Bacteria 1156
11 Ga0068868_100231297 3300005338 Bacteria 1551
12 Ga0070660_100296492 3300005339 Bacteria 1325
13 Ga0070661_100055777 3300005344 Bacteria 2893
14 Ga0070661_100276033 3300005344 Bacteria 1303
15 Ga0070669_100012699 3300005353 Bacteria 5979
16 Ga0070675_100943316 3300005354 Bacteria 791
17 Ga0070674_100203671 3300005356 Bacteria 1530
18 Ga0070701_10447744 3300005438 Bacteria 828
19 Ga0070694_100201622 3300005444 Bacteria 1483
20 Ga0070662_100008325 3300005457 Bacteria 6758
21 Ga0070662_100116407 3300005457 Bacteria 2043
22 Ga0070681_10109674 3300005458 Bacteria 2700
23 Ga0068867_100030227 3300005459 Bacteria 3907
24 Ga0070679_100462128 3300005530 Bacteria 1214
25 Ga0070684_101123967 3300005535 Bacteria 738
26 Ga0070672_100178819 3300005543 Bacteria 1767
27 Ga0070665_100067766 3300005548 Bacteria 3579
28 Ga0070665_101696987 3300005548 Bacteria 639
29 Ga0070664_100103864 3300005564 Bacteria 2474
30 Ga0068861_100001252 3300005719 Bacteria 15844
31 Ga0068861_100002302 3300005719 Bacteria 12403
32 Ga0068863_100802073 3300005841 Bacteria 939
33 Ga0068858_100445026 3300005842 Bacteria 1248
34 Ga0068860_100336730 3300005843 Bacteria 1483
35 Ga0068862_100014919 3300005844 Bacteria 6454
36 Ga0075365_10006548 3300006038 Bacteria 6420
37 Ga0075365_10064294 3300006038 Bacteria 2457
38 Ga0075365_10522971 3300006038 Bacteria 839
39 Ga0075368_10104168 3300006042 Bacteria 1167
40 Ga0075363_100005061 3300006048 Bacteria 5829
41 Ga0075364_10000115 3300006051 Bacteria 33272
42 Ga0075364_10008361 3300006051 Bacteria 6182
43 Ga0070716_100017006 3300006173 Bacteria 3764
44 Ga0075369_10000063 3300006186 Bacteria 27877
45 Ga0075427_10000985 3300006194 Bacteria 3529
46 Ga0075427_10006540 3300006194 Bacteria 1692
47 Ga0075366_10016280 3300006195 Bacteria 4272
48 Ga0075366_10038861 3300006195 Bacteria 2811
49 Ga0075366_10151098 3300006195 Bacteria 1406
50 Ga0075366_10411549 3300006195 Bacteria 832
51 Ga0075370_10000036 3300006353 Bacteria 42166
52 Ga0075428_100001563 3300006844 Bacteria 24553
53 Ga0075428_100013566 3300006844 Bacteria 9073
54 Ga0075428_100112065 3300006844 Bacteria 2971
55 Ga0075430_100006575 3300006846 Bacteria 9803
56 Ga0075430_100010345 3300006846 Bacteria 7899
57 Ga0075430_100026527 3300006846 Bacteria 4927
58 Ga0075430_100129932 3300006846 Bacteria 2100
59 Ga0075430_100130893 3300006846 Bacteria 2091
60 Ga0075430_100337236 3300006846 Bacteria 1245
61 Ga0075431_100000019 3300006847 Bacteria 83837
62 Ga0075431_100003107 3300006847 Bacteria 16076
63 Ga0075431_100017488 3300006847 Bacteria 7288
64 Ga0075431_101010050 3300006847 Bacteria 798
65 Ga0075434_100134277 3300006871 Bacteria 2494
66 Ga0075434_100208009 3300006871 Bacteria 1978
67 Ga0075429_100005162 3300006880 Bacteria 11231
68 Ga0075429_100027629 3300006880 Bacteria 4926
69 Ga0075429_100037066 3300006880 Bacteria 4244
70 Ga0075429_100070192 3300006880 Bacteria 3050
71 Ga0075429_100573754 3300006880 Bacteria 988
72 Ga0068865_100139270 3300006881 Bacteria 1828
73 Ga0111539_10002850 3300009094 Bacteria 22972
74 Ga0111539_10022813 3300009094 Bacteria 7688
75 Ga0105245_10455414 3300009098 Bacteria 1289
76 Ga0105245_11517846 3300009098 Bacteria 721
77 Ga0114129_10000072 3300009147 Bacteria 92950
78 Ga0114129_10022131 3300009147 Bacteria 9022
79 Ga0114129_10513770 3300009147 Bacteria 1563
80 Ga0114129_10535660 3300009147 Bacteria 1525
81 Ga0105241_10450425 3300009174 Bacteria 1138
82 Ga0105241_11568820 3300009174 Bacteria 636
83 Ga0105248_11116669 3300009177 Bacteria 891
84 Ga0105237_10795238 3300009545 Bacteria 953
85 Ga0105237_11993666 3300009545 Bacteria 589
86 Ga0105249_10159328 3300009553 Bacteria 2180
87 Ga0105239_10140086 3300010375 Bacteria 2695
88 Ga0105239_10239717 3300010375 Bacteria 2035
89 Ga0157374_10013874 3300013296 Bacteria 7041
90 Ga0157374_10615727 3300013296 Bacteria 1096
91 Ga0157378_10257660 3300013297 Bacteria 1672
92 Ga0157378_10878183 3300013297 Bacteria 926
93 Ga0163162_10080862 3300013306 Bacteria 3319
94 Ga0163162_10744207 3300013306 Bacteria 1100
95 Ga0163162_10888188 3300013306 Bacteria 1005
96 Ga0157375_10071047 3300013308 Bacteria 3493
97 Ga0157375_10191066 3300013308 Bacteria 2202
98 Ga0157380_11055781 3300014326 Bacteria 849
99 Ga0157380_11072591 3300014326 Bacteria 843
100 Ga0157377_10289741 3300014745 Bacteria 1076
101 Ga0157379_10336073 3300014968 Bacteria 1381
102 Ga0163161_10128807 3300017792 Bacteria 1907
103 Ga0213872_10010028 3300021361 Bacteria 4520
104 Ga0207682_10061098 3300025893 Bacteria 1577
105 Ga0207688_10171204 3300025901 Bacteria 1291
106 Ga0207688_10562191 3300025901 Unclassified 717
107 Ga0207645_10034108 3300025907 Bacteria 3270
108 Ga0207645_10121713 3300025907 Bacteria 1694
109 Ga0207643_10082501 3300025908 Bacteria 1864
110 Ga0207707_10114541 3300025912 Bacteria 2356
111 Ga0207660_10062875 3300025917 Bacteria 2675
112 Ga0207662_10386078 3300025918 Bacteria 947
113 Ga0207649_10068773 3300025920 Bacteria 2253
114 Ga0207649_10353702 3300025920 Bacteria 1088
115 Ga0207649_10563930 3300025920 Bacteria 872
116 Ga0207652_10097394 3300025921 Bacteria 2593
117 Ga0207681_10003023 3300025923 Bacteria 10565
118 Ga0207681_10244641 3300025923 Bacteria 1398
119 Ga0207650_11023219 3300025925 Bacteria 703
120 Ga0207690_10289543 3300025932 Bacteria 1278
121 Ga0207706_10009886 3300025933 Bacteria 8749
122 Ga0207706_10104554 3300025933 Bacteria 2491
123 Ga0207669_10283820 3300025937 Bacteria 1250
124 Ga0207704_10043424 3300025938 Bacteria 2655
125 Ga0207704_10450542 3300025938 Bacteria 1027
126 Ga0207665_10074624 3300025939 Bacteria 2321
127 Ga0207691_10445104 3300025940 Bacteria 1103
128 Ga0207689_10281747 3300025942 Bacteria 1376
129 Ga0207679_10408468 3300025945 Bacteria 1196
130 Ga0207679_10594543 3300025945 Bacteria 996
131 Ga0207679_10609238 3300025945 Bacteria 985
132 Ga0207651_10537621 3300025960 Bacteria 1015
133 Ga0207712_10007632 3300025961 Bacteria 6838
134 Ga0207712_10146697 3300025961 Bacteria 1817
135 Ga0207640_10253628 3300025981 Bacteria 1367
136 Ga0207677_10249048 3300026023 Bacteria 1442
137 Ga0207703_11768118 3300026035 Unclassified 594
138 Ga0207641_10549535 3300026088 Bacteria 1126
139 Ga0207648_10059179 3300026089 Bacteria 3341
140 Ga0207674_10030829 3300026116 Bacteria 5636
141 Ga0207675_100005159 3300026118 Bacteria 12580
142 Ga0207675_100005340 3300026118 Bacteria 12345
143 Ga0207675_100627672 3300026118 Bacteria 1079
144 Ga0207698_11215142 3300026142 Bacteria 768
145 Ga0207698_11708357 3300026142 Unclassified 645
146 Ga0209999_1015500 3300027543 Bacteria 1387
147 Ga0209971_1004224 3300027682 Bacteria 3408
148 Ga0207428_10007666 3300027907 Bacteria 9825
149 Ga0207428_10007754 3300027907 Bacteria 9769
150 Ga0207428_10043075 3300027907 Bacteria 3647
151 Ga0268266_10053027 3300028379 Bacteria 3484
152 Ga0268265_10001517 3300028380 Bacteria 19354
153 Ga0268264_10461086 3300028381 Bacteria 1233
154 Ga0265316_10092483 3300031344 Bacteria 2306
155 Ga0307513_10318219 3300031456 Bacteria 1315
156 Ga0307408_100098490 3300031548 Bacteria 2223
157 Ga0307408_100268544 3300031548 Bacteria 1415
158 Ga0307508_10065074 3300031616 Bacteria 3213
159 Ga0316575_10182366 3300031665 Bacteria 872
160 Ga0316579_10020735 3300031691 Bacteria 2921
161 Ga0316578_10017343 3300031728 Bacteria 3915
162 Ga0307405_10098602 3300031731 Bacteria 1954
163 Ga0307405_10726110 3300031731 Bacteria 825
164 Ga0316577_10021407 3300031733 Bacteria 3587
165 Ga0307413_10134641 3300031824 Bacteria 1697
166 Ga0307410_10129380 3300031852 Bacteria 1853
167 Ga0307410_10169236 3300031852 Bacteria 1645
168 Ga0307410_10316762 3300031852 Bacteria 1236
169 Ga0307406_10363464 3300031901 Bacteria 1135
170 Ga0307409_100103432 3300031995 Bacteria 2369
171 Ga0307416_100016831 3300032002 Bacteria 5095
172 Ga0307416_100077771 3300032002 Bacteria 2788
173 Ga0307414_10045475 3300032004 Bacteria 3007
174 Ga0307414_10371155 3300032004 Bacteria 1234
175 Ga0307414_11438479 3300032004 Bacteria 641
176 Ga0307411_10051441 3300032005 Bacteria 2688
177 Ga0307415_100326015 3300032126 Bacteria 1283
178 Ga0316583_10105230 3300032133 Bacteria 983
179 Ga0316574_0061755 3300035398 Bacteria 2353
180 Ga0316574_0470374 3300035398 Bacteria 786
181 Ga0373937_0168102 3300036401 Bacteria 2057
182 Ga0316582_0022471 3300036647 Bacteria 3745
183 Ga0400490_04320 3300038726 Bacteria 26431
184 Ga0400483_009092 3300039062 Bacteria 7014
185 Ga0400483_182982 3300039062 Bacteria 8688
186 Ga0400487_19658 3300039110 Bacteria 1973
187 Ga0436365_0774915 3300039437 Bacteria 14025
188 Ga0436361_0510189 3300039447 Bacteria 5563
189 Ga0436363_0714719 3300039450 Bacteria 886
190 Ga0451843_0868704 3300041509 Bacteria 749
191 Ga0451577_0041063 3300042876 Bacteria 4154
192 Ga0451577_0050773 3300042876 Bacteria 3702
193 Ga0451577_0055449 3300042876 Bacteria 3536
194 Ga0451577_0434023 3300042876 Bacteria 1193
195 Ga0453683_0206202 3300044673 Bacteria 1248
196 Ga0453684_0001536 3300044712 Bacteria 64524
197 Ga0453684_0004449 3300044712 Bacteria 29574
198 Ga0453684_0052069 3300044712 Bacteria 5357
199 Ga0453684_0112115 3300044712 Bacteria 3311
200 Ga0453684_0158867 3300044712 Bacteria 2676
201 Ga0453684_0161407 3300044712 Bacteria 2651
202 Ga0453684_0218258 3300044712 Bacteria 2211
203 Ga0451576_0005548 3300045051 Bacteria 15762
204 Ga0451576_0019043 3300045051 Bacteria 7500
205 Ga0451576_0662640 3300045051 Bacteria 1097
206 Ga0495638_0001423 3300046460 Bacteria 21729
207 Ga0495638_0094821 3300046460 Bacteria 1793
208 Ga0495650_0100234 3300046471 Bacteria 1088
209 Ga0495611_0094436 3300046648 Bacteria 1384
210 Ga0495625_0003217 3300046660 Bacteria 16556
211 Ga0495625_0120818 3300046660 Bacteria 1783
212 Ga0495625_0328175 3300046660 Bacteria 973
213 Ga0495672_0140101 3300047320 Bacteria 1264
214 Ga0495686_0017979 3300047472 Bacteria 4754
215 Ga0496100_1025780 3300048903 Bacteria 649
216 Ga0496102_0084082 3300048905 Bacteria 2937
217 Ga0496104_0919458 3300048907 Bacteria 780
218 Ga0496114_0304027 3300048917 Bacteria 1408
219 Ga0496121_0017684 3300048924 Bacteria 7256
220 Ga0501300_006407 3300049523 Bacteria 1732
221 Ga0501069_0007544 3300049585 Bacteria 5709
222 Ga0501069_0060980 3300049585 Bacteria 2106
223 Ga0501070_0017524 3300049586 Bacteria 6013
224 Ga0501074_0017626 3300049590 Bacteria 5186
225 Ga0501280_002147 3300049776 Bacteria 3390
226 Ga0501282_005152 3300049778 Bacteria 1397
227 nmdc:mga03n38_2415_c1 3300050490 Bacteria 5765
228 nmdc:mga00v17_51308_c1 3300050491 Bacteria 2508
229 nmdc:mga00v17_583_c1 3300050491 Bacteria 20360
230 nmdc:mga00v17_5912_c1 3300050491 Bacteria 6468
231 nmdc:mga00v17_879_c1 3300050491 Bacteria 16252
232 nmdc:mga0yw44_607_c1 3300050492 Bacteria 12964
233 nmdc:mga0k408_2968_c1 3300050493 Bacteria 8998
234 nmdc:mga0k408_32099_c1 3300050493 Bacteria 3000
235 nmdc:mga0k408_63535_c1 3300050493 Bacteria 2148
236 nmdc:mga06z11_9223_c1 3300050494 Bacteria 4150
237 nmdc:mga04h51_5075_c1 3300050495 Bacteria 3332
238 nmdc:mga07m45_27_c1 3300050496 Bacteria 91154
239 nmdc:mga05p37_30999_c1 3300050507 Bacteria 6529
240 nmdc:mga05p37_465405_c1 3300050507 Bacteria 1460
241 nmdc:mga05p37_624191_c1 3300050507 Bacteria 1212
242 nmdc:mga05p37_6727_c1 3300050507 Bacteria 13552
243 nmdc:mga09592_2604_c1 3300050508 Bacteria 14605
244 nmdc:mga09592_3508_c1 3300050508 Bacteria 12669
245 nmdc:mga09592_4134_c1 3300050508 Bacteria 11725
246 nmdc:mga09592_97783_c1 3300050508 Bacteria 2512
247 nmdc:mga0qj67_12189_c1 3300050509 Bacteria 6470
248 nmdc:mga0qj67_123543_c1 3300050509 Bacteria 2094
249 nmdc:mga0qj67_152289_c1 3300050509 Bacteria 1876
250 nmdc:mga0qj67_2309_c1 3300050509 Bacteria 13554
251 nmdc:mga0qj67_2371_c1 3300050509 Bacteria 13414
252 nmdc:mga06r32_106881_c1 3300050510 Bacteria 2750
253 nmdc:mga06r32_3_c1 3300050510 Bacteria 164616
254 nmdc:mga06r32_595274_c1 3300050510 Bacteria 1077
255 nmdc:mga06r32_632_c1 3300050510 Bacteria 30531
256 nmdc:mga06r32_8045_c1 3300050510 Bacteria 9487
257 nmdc:mga08y16_1997_c1 3300050511 Bacteria 20847
258 nmdc:mga08y16_740_c1 3300050511 Bacteria 31072
259 nmdc:mga0n895_135087_c1 3300050512 Bacteria 2493
260 nmdc:mga0n895_1462745_c1 3300050512 Bacteria 650
261 nmdc:mga0a205_359690_c1 3300050515 Bacteria 1322
262 nmdc:mga0sz30_18_c2 3300050516 Bacteria 68595
263 Ga0500588_0241581 3300053146 Bacteria 677
264 2526212407 2526164512 Bacteria 4025691
265 2547375928 2547132103 Bacteria 5115736
266 2843691238 2843690924 Bacteria 5169057
267 2846033993 2846033681 Bacteria 4377894
268 2998344507 2998344455 Bacteria 4222996
269 Ga0111539_10023903
270 Ga0065712_10191862
271 Ga0065707_10088589
272 Ga0070683_100877547
273 Ga0070690_100570606
274 Ga0070670_100110132
275 Ga0070677_10096479
276 Ga0068869_100137273
277 Ga0070680_100355930
278 Ga0070680_100409807
279 Ga0068868_100231297
280 Ga0070660_100296492
281 Ga0070661_100055777
282 Ga0070661_100276033
283 Ga0070669_100012699
284 Ga0070675_100943316
285 Ga0070674_100203671
286 Ga0070701_10447744
287 Ga0070694_100201622
288 Ga0070662_100008325
289 Ga0070662_100116407
290 Ga0070681_10109674
291 Ga0068867_100030227
292 Ga0070679_100462128
293 Ga0070684_101123967
294 Ga0070672_100178819
295 Ga0070665_100067766
296 Ga0070665_101696987
297 Ga0070664_100103864
298 Ga0068861_100001252
299 Ga0068861_100002302
300 Ga0068863_100802073
301 Ga0068858_100445026
302 Ga0068860_100336730
303 Ga0068862_100014919
304 Ga0075365_10006548
305 Ga0075365_10064294
306 Ga0075365_10522971
307 Ga0075368_10104168
308 Ga0075363_100005061
309 Ga0075364_10000115
310 Ga0075364_10008361
311 Ga0070716_100017006
312 Ga0075369_10000063
313 Ga0075427_10000985
314 Ga0075427_10006540
315 Ga0075366_10016280
316 Ga0075366_10038861
317 Ga0075366_10151098
318 Ga0075366_10411549
319 Ga0075370_10000036
320 Ga0075428_100001563
321 Ga0075428_100013566
322 Ga0075428_100112065
323 Ga0075430_100006575
324 Ga0075430_100010345
325 Ga0075430_100026527
326 Ga0075430_100129932
327 Ga0075430_100130893
328 Ga0075430_100337236
329 Ga0075431_100000019
330 Ga0075431_100003107
331 Ga0075431_100017488
332 Ga0075431_101010050
333 Ga0075434_100134277
334 Ga0075434_100208009
335 Ga0075429_100005162
336 Ga0075429_100027629
337 Ga0075429_100037066
338 Ga0075429_100070192
339 Ga0075429_100573754
340 Ga0068865_100139270
341 Ga0111539_10002850
342 Ga0111539_10022813
343 Ga0105245_10455414
344 Ga0105245_11517846
345 Ga0114129_10000072
346 Ga0114129_10022131
347 Ga0114129_10513770
348 Ga0114129_10535660
349 Ga0105241_10450425
350 Ga0105241_11568820
351 Ga0105248_11116669
352 Ga0105237_10795238
353 Ga0105237_11993666
354 Ga0105249_10159328
355 Ga0105239_10140086
356 Ga0105239_10239717
357 Ga0157374_10013874
358 Ga0157374_10615727
359 Ga0157378_10257660
360 Ga0157378_10878183
361 Ga0163162_10080862
362 Ga0163162_10744207
363 Ga0163162_10888188
364 Ga0157375_10071047
365 Ga0157375_10191066
366 Ga0157380_11055781
367 Ga0157380_11072591
368 Ga0157377_10289741
369 Ga0157379_10336073
370 Ga0163161_10128807
371 Ga0213872_10010028
372 Ga0207682_10061098
373 Ga0207688_10171204
374 Ga0207688_10562191
375 Ga0207645_10034108
376 Ga0207645_10121713
377 Ga0207643_10082501
378 Ga0207707_10114541
379 Ga0207660_10062875
380 Ga0207662_10386078
381 Ga0207649_10068773
382 Ga0207649_10353702
383 Ga0207649_10563930
384 Ga0207652_10097394
385 Ga0207681_10003023
386 Ga0207681_10244641
387 Ga0207650_11023219
388 Ga0207690_10289543
389 Ga0207706_10009886
390 Ga0207706_10104554
391 Ga0207669_10283820
392 Ga0207704_10043424
393 Ga0207704_10450542
394 Ga0207665_10074624
395 Ga0207691_10445104
396 Ga0207689_10281747
397 Ga0207679_10408468
398 Ga0207679_10594543
399 Ga0207679_10609238
400 Ga0207651_10537621
401 Ga0207712_10007632
402 Ga0207712_10146697
403 Ga0207640_10253628
404 Ga0207677_10249048
405 Ga0207703_11768118
406 Ga0207641_10549535
407 Ga0207648_10059179
408 Ga0207674_10030829
409 Ga0207675_100005159
410 Ga0207675_100005340
411 Ga0207675_100627672
412 Ga0207698_11215142
413 Ga0207698_11708357
414 Ga0209999_1015500
415 Ga0209971_1004224
416 Ga0207428_10007666
417 Ga0207428_10007754
418 Ga0207428_10043075
419 Ga0268266_10053027
420 Ga0268265_10001517
421 Ga0268264_10461086
422 Ga0265316_10092483
423 Ga0307513_10318219
424 Ga0307408_100098490
425 Ga0307408_100268544
426 Ga0307508_10065074
427 Ga0316575_10182366
428 Ga0316579_10020735
429 Ga0316578_10017343
430 Ga0307405_10098602
431 Ga0307405_10726110
432 Ga0316577_10021407
433 Ga0307413_10134641
434 Ga0307410_10129380
435 Ga0307410_10169236
436 Ga0307410_10316762
437 Ga0307406_10363464
438 Ga0307409_100103432
439 Ga0307416_100016831
440 Ga0307416_100077771
441 Ga0307414_10045475
442 Ga0307414_10371155
443 Ga0307414_11438479
444 Ga0307411_10051441
445 Ga0307415_100326015
446 Ga0316583_10105230
447 Ga0316574_0061755
448 Ga0316574_0470374
449 Ga0373937_0168102
450 Ga0316582_0022471
451 Ga0400490_04320
452 Ga0400483_009092
453 Ga0400483_182982
454 Ga0400487_19658
455 Ga0436365_0774915
456 Ga0436361_0510189
457 Ga0436363_0714719
458 Ga0451843_0868704
459 Ga0451577_0041063
460 Ga0451577_0050773
461 Ga0451577_0055449
462 Ga0451577_0434023
463 Ga0453683_0206202
464 Ga0453684_0001536
465 Ga0453684_0004449
466 Ga0453684_0052069
467 Ga0453684_0112115
468 Ga0453684_0158867
469 Ga0453684_0161407
470 Ga0453684_0218258
471 Ga0451576_0005548
472 Ga0451576_0019043
473 Ga0451576_0662640
474 Ga0495638_0001423
475 Ga0495638_0094821
476 Ga0495650_0100234
477 Ga0495611_0094436
478 Ga0495625_0003217
479 Ga0495625_0120818
480 Ga0495625_0328175
481 Ga0495672_0140101
482 Ga0495686_0017979
483 Ga0496100_1025780
484 Ga0496102_0084082
485 Ga0496104_0919458
486 Ga0496114_0304027
487 Ga0496121_0017684
488 Ga0501300_006407
489 Ga0501069_0007544
490 Ga0501069_0060980
491 Ga0501070_0017524
492 Ga0501074_0017626
493 Ga0501280_002147
494 Ga0501282_005152
495 nmdc:mga03n38_2415_c1
496 nmdc:mga00v17_51308_c1
497 nmdc:mga00v17_583_c1
498 nmdc:mga00v17_5912_c1
499 nmdc:mga00v17_879_c1
500 nmdc:mga0yw44_607_c1
501 nmdc:mga0k408_2968_c1
502 nmdc:mga0k408_32099_c1
503 nmdc:mga0k408_63535_c1
504 nmdc:mga06z11_9223_c1
505 nmdc:mga04h51_5075_c1
506 nmdc:mga07m45_27_c1
507 nmdc:mga05p37_30999_c1
508 nmdc:mga05p37_465405_c1
509 nmdc:mga05p37_624191_c1
510 nmdc:mga05p37_6727_c1
511 nmdc:mga09592_2604_c1
512 nmdc:mga09592_3508_c1
513 nmdc:mga09592_4134_c1
514 nmdc:mga09592_97783_c1
515 nmdc:mga0qj67_12189_c1
516 nmdc:mga0qj67_123543_c1
517 nmdc:mga0qj67_152289_c1
518 nmdc:mga0qj67_2309_c1
519 nmdc:mga0qj67_2371_c1
520 nmdc:mga06r32_106881_c1
521 nmdc:mga06r32_3_c1
522 nmdc:mga06r32_595274_c1
523 nmdc:mga06r32_632_c1
524 nmdc:mga06r32_8045_c1
525 nmdc:mga08y16_1997_c1
526 nmdc:mga08y16_740_c1
527 nmdc:mga0n895_135087_c1
528 nmdc:mga0n895_1462745_c1
529 nmdc:mga0a205_359690_c1
530 nmdc:mga0sz30_18_c2
531 Ga0500588_0241581
532 2526212407
533 2547375928
534 2843691238
535 2846033993
536 2998344507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

27

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9934 4 159
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9916 3 164
5j46-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans 0.9874 1 166
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.9872 4 164
5j46-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans 0.9815 1 166
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9632 4 148 3.90.45.10
3u04A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9621 1 162 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.957 1 145 3.90.45.10
2defA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9524 4 148 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.95 6 142 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A5E8PDI2-F1-model_v4 deleted 1.003 6 143
AF-A0A1Z5I8T4-F1-model_v4 deleted 1 35 121
AF-A0A074UB39-F1-model_v4 deleted 0.9982 29 158
AF-A0A382QVV7-F1-model_v4 Peptide deformylase 0.9971 4 103 GO:0042586
GO:0043686
AF-A0A090TF77-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9946 35 164 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map