F375276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 192 | 268 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100794219|Ga0070690_1007942191 |
| Length | 208 |
| Sequence | MTRPAIGTPTPKRCAWSGGSPEYIRYHDEEWGVPVHDDRTLFEFLILEGAQAGLSWSTILNKRAGYRKAFVDFDAERVARFTTRQISALLDNEGIVRNRLKIESTVRNARAFLEIRDQIGSFDTYIWRFVDGAPIQNAWRSGEVPAQTAESDAMSKDLKKRGFNFVGSTICYAFMQAVGMVNDHLVDCFRWRELSATPPPRRTKKATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 133 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.1 |
| Rhizosphere | 94.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10189211 | 3300003323 | Bacteria | 8347 |
| 2 | Ga0065707_10049920 | 3300005295 | Bacteria | 868 |
| 3 | Ga0070683_100000382 | 3300005329 | Bacteria | 30781 |
| 4 | Ga0070690_100794219 | 3300005330 | Bacteria | 734 |
| 5 | Ga0070670_100240337 | 3300005331 | Bacteria | 1577 |
| 6 | Ga0070670_100595448 | 3300005331 | Bacteria | 989 |
| 7 | Ga0068869_100041656 | 3300005334 | Bacteria | 3289 |
| 8 | Ga0070660_100074656 | 3300005339 | Bacteria | 2653 |
| 9 | Ga0070660_100114925 | 3300005339 | Bacteria | 2145 |
| 10 | Ga0070689_100135765 | 3300005340 | Bacteria | 1975 |
| 11 | Ga0070689_100158994 | 3300005340 | Bacteria | 1825 |
| 12 | Ga0070691_10312522 | 3300005341 | Bacteria | 862 |
| 13 | Ga0070661_100569543 | 3300005344 | Bacteria | 913 |
| 14 | Ga0070668_100294573 | 3300005347 | Bacteria | 1359 |
| 15 | Ga0070669_100606005 | 3300005353 | Bacteria | 918 |
| 16 | Ga0070675_100070841 | 3300005354 | Bacteria | 2891 |
| 17 | Ga0070675_100178213 | 3300005354 | Bacteria | 1836 |
| 18 | Ga0070675_100528030 | 3300005354 | Bacteria | 1065 |
| 19 | Ga0070671_100072444 | 3300005355 | Bacteria | 2877 |
| 20 | Ga0070671_100110742 | 3300005355 | Bacteria | 2306 |
| 21 | Ga0070671_100224278 | 3300005355 | Bacteria | 1595 |
| 22 | Ga0070673_100327983 | 3300005364 | Bacteria | 1353 |
| 23 | Ga0070688_100176315 | 3300005365 | Unclassified | 1479 |
| 24 | Ga0070688_100255889 | 3300005365 | Bacteria | 1248 |
| 25 | Ga0070688_100842688 | 3300005365 | Bacteria | 720 |
| 26 | Ga0070659_100362665 | 3300005366 | Bacteria | 1218 |
| 27 | Ga0070709_10242978 | 3300005434 | Bacteria | 1293 |
| 28 | Ga0070713_100082554 | 3300005436 | Bacteria | 2745 |
| 29 | Ga0070694_100389945 | 3300005444 | Bacteria | 1088 |
| 30 | Ga0070708_100497492 | 3300005445 | Bacteria | 1150 |
| 31 | Ga0070678_100051808 | 3300005456 | Bacteria | 2977 |
| 32 | Ga0068867_100191447 | 3300005459 | Bacteria | 1632 |
| 33 | Ga0068867_100418632 | 3300005459 | Bacteria | 1134 |
| 34 | Ga0070706_100726083 | 3300005467 | Bacteria | 921 |
| 35 | Ga0070707_100006513 | 3300005468 | Bacteria | 10844 |
| 36 | Ga0070707_100217730 | 3300005468 | Bacteria | 1860 |
| 37 | Ga0070679_100015170 | 3300005530 | Bacteria | 7404 |
| 38 | Ga0070684_100009496 | 3300005535 | Bacteria | 7663 |
| 39 | Ga0070697_100036272 | 3300005536 | Bacteria | 3982 |
| 40 | Ga0070696_100741040 | 3300005546 | Bacteria | 804 |
| 41 | Ga0070693_100148637 | 3300005547 | Bacteria | 1482 |
| 42 | Ga0070665_100287186 | 3300005548 | Bacteria | 1647 |
| 43 | Ga0070704_100245801 | 3300005549 | Bacteria | 1467 |
| 44 | Ga0070704_100561141 | 3300005549 | Bacteria | 999 |
| 45 | Ga0070704_100694404 | 3300005549 | Bacteria | 902 |
| 46 | Ga0070664_100048295 | 3300005564 | Bacteria | 3596 |
| 47 | Ga0070664_100561347 | 3300005564 | Bacteria | 1056 |
| 48 | Ga0068852_100005499 | 3300005616 | Bacteria | 9075 |
| 49 | Ga0068852_100890964 | 3300005616 | Bacteria | 906 |
| 50 | Ga0068859_100028533 | 3300005617 | Bacteria | 5596 |
| 51 | Ga0068859_101478201 | 3300005617 | Bacteria | 750 |
| 52 | Ga0068866_10090699 | 3300005718 | Bacteria | 1664 |
| 53 | Ga0068861_100225832 | 3300005719 | Bacteria | 1585 |
| 54 | Ga0068863_100104171 | 3300005841 | Bacteria | 2699 |
| 55 | Ga0068858_100093081 | 3300005842 | Bacteria | 2806 |
| 56 | Ga0068858_100362222 | 3300005842 | Bacteria | 1390 |
| 57 | Ga0070717_10000436 | 3300006028 | Bacteria | 26575 |
| 58 | Ga0070716_100059575 | 3300006173 | Bacteria | 2202 |
| 59 | Ga0070716_100481995 | 3300006173 | Bacteria | 911 |
| 60 | Ga0070712_100010204 | 3300006175 | Bacteria | 5921 |
| 61 | Ga0097621_100037273 | 3300006237 | Bacteria | 3894 |
| 62 | Ga0097621_100080936 | 3300006237 | Bacteria | 2702 |
| 63 | Ga0068871_100020067 | 3300006358 | Bacteria | 5115 |
| 64 | Ga0068871_100624108 | 3300006358 | Bacteria | 982 |
| 65 | Ga0075428_100007567 | 3300006844 | Bacteria | 12034 |
| 66 | Ga0075433_10232550 | 3300006852 | Bacteria | 1637 |
| 67 | Ga0075433_10298953 | 3300006852 | Bacteria | 1425 |
| 68 | Ga0075434_100319502 | 3300006871 | Bacteria | 1573 |
| 69 | Ga0075429_100316585 | 3300006880 | Bacteria | 1366 |
| 70 | Ga0068865_100658620 | 3300006881 | Bacteria | 891 |
| 71 | Ga0075436_100116430 | 3300006914 | Bacteria | 1868 |
| 72 | Ga0075436_100273587 | 3300006914 | Bacteria | 1206 |
| 73 | Ga0075436_100577342 | 3300006914 | Bacteria | 827 |
| 74 | Ga0097620_100028534 | 3300006931 | Bacteria | 5596 |
| 75 | Ga0097620_101478124 | 3300006931 | Bacteria | 750 |
| 76 | Ga0075435_100232502 | 3300007076 | Bacteria | 1566 |
| 77 | Ga0111539_10196992 | 3300009094 | Bacteria | 2349 |
| 78 | Ga0105245_10282574 | 3300009098 | Bacteria | 1623 |
| 79 | Ga0105245_10849510 | 3300009098 | Bacteria | 953 |
| 80 | Ga0105247_10528508 | 3300009101 | Bacteria | 864 |
| 81 | Ga0114129_10004890 | 3300009147 | Bacteria | 18909 |
| 82 | Ga0114129_11070836 | 3300009147 | Bacteria | 1011 |
| 83 | Ga0105241_10015774 | 3300009174 | Bacteria | 5534 |
| 84 | Ga0105242_10135317 | 3300009176 | Bacteria | 2132 |
| 85 | Ga0105242_10320742 | 3300009176 | Bacteria | 1421 |
| 86 | Ga0105248_10014635 | 3300009177 | Bacteria | 8631 |
| 87 | Ga0105248_10159108 | 3300009177 | Bacteria | 2548 |
| 88 | Ga0105248_10720122 | 3300009177 | Bacteria | 1126 |
| 89 | Ga0157373_10038085 | 3300013100 | Bacteria | 3447 |
| 90 | Ga0157370_10094034 | 3300013104 | Bacteria | 2813 |
| 91 | Ga0157370_11036875 | 3300013104 | Bacteria | 742 |
| 92 | Ga0157369_10183287 | 3300013105 | Bacteria | 2202 |
| 93 | Ga0157378_10621989 | 3300013297 | Bacteria | 1093 |
| 94 | Ga0157378_11063189 | 3300013297 | Bacteria | 845 |
| 95 | Ga0157378_11634795 | 3300013297 | Bacteria | 690 |
| 96 | Ga0163162_10022972 | 3300013306 | Bacteria | 6151 |
| 97 | Ga0163162_10629688 | 3300013306 | Bacteria | 1197 |
| 98 | Ga0157372_10091430 | 3300013307 | Bacteria | 3461 |
| 99 | Ga0157372_10139874 | 3300013307 | Bacteria | 2788 |
| 100 | Ga0157375_10370080 | 3300013308 | Bacteria | 1599 |
| 101 | Ga0163163_10455080 | 3300014325 | Bacteria | 1340 |
| 102 | Ga0157379_10171487 | 3300014968 | Bacteria | 1959 |
| 103 | Ga0157379_10268012 | 3300014968 | Unclassified | 1552 |
| 104 | Ga0163161_10050645 | 3300017792 | Bacteria | 3006 |
| 105 | Ga0207642_10036751 | 3300025899 | Bacteria | 2105 |
| 106 | Ga0207647_10449060 | 3300025904 | Bacteria | 723 |
| 107 | Ga0207699_10122849 | 3300025906 | Bacteria | 1682 |
| 108 | Ga0207643_10051821 | 3300025908 | Bacteria | 2330 |
| 109 | Ga0207693_10019593 | 3300025915 | Bacteria | 5379 |
| 110 | Ga0207662_10101965 | 3300025918 | Bacteria | 1779 |
| 111 | Ga0207649_10586281 | 3300025920 | Bacteria | 856 |
| 112 | Ga0207652_10045157 | 3300025921 | Bacteria | 3755 |
| 113 | Ga0207646_10000540 | 3300025922 | Bacteria | 50029 |
| 114 | Ga0207646_10000548 | 3300025922 | Bacteria | 49427 |
| 115 | Ga0207646_10217091 | 3300025922 | Bacteria | 1728 |
| 116 | Ga0207681_10685265 | 3300025923 | Bacteria | 851 |
| 117 | Ga0207659_10070619 | 3300025926 | Bacteria | 2547 |
| 118 | Ga0207659_10198266 | 3300025926 | Bacteria | 1601 |
| 119 | Ga0207687_10126861 | 3300025927 | Bacteria | 1917 |
| 120 | Ga0207700_10763823 | 3300025928 | Bacteria | 864 |
| 121 | Ga0207644_10001551 | 3300025931 | Bacteria | 14827 |
| 122 | Ga0207706_10228707 | 3300025933 | Bacteria | 1628 |
| 123 | Ga0207706_10929441 | 3300025933 | Bacteria | 734 |
| 124 | Ga0207670_10806097 | 3300025936 | Bacteria | 782 |
| 125 | Ga0207665_10207028 | 3300025939 | Bacteria | 1431 |
| 126 | Ga0207691_10003793 | 3300025940 | Bacteria | 14668 |
| 127 | Ga0207711_10005309 | 3300025941 | Bacteria | 10925 |
| 128 | Ga0207711_10558593 | 3300025941 | Bacteria | 1068 |
| 129 | Ga0207689_10028715 | 3300025942 | Bacteria | 4651 |
| 130 | Ga0207661_10045822 | 3300025944 | Bacteria | 3464 |
| 131 | Ga0207679_10527511 | 3300025945 | Bacteria | 1057 |
| 132 | Ga0207651_10067403 | 3300025960 | Bacteria | 2519 |
| 133 | Ga0207677_10244897 | 3300026023 | Bacteria | 1452 |
| 134 | Ga0207677_10360652 | 3300026023 | Bacteria | 1221 |
| 135 | Ga0207703_10073148 | 3300026035 | Unclassified | 2835 |
| 136 | Ga0207641_10105079 | 3300026088 | Bacteria | 2494 |
| 137 | Ga0207641_10998377 | 3300026088 | Bacteria | 834 |
| 138 | Ga0207648_10034437 | 3300026089 | Bacteria | 4464 |
| 139 | Ga0207675_100060826 | 3300026118 | Bacteria | 3526 |
| 140 | Ga0207683_10029389 | 3300026121 | Bacteria | 4759 |
| 141 | Ga0207683_10414699 | 3300026121 | Bacteria | 1240 |
| 142 | Ga0207683_10868882 | 3300026121 | Bacteria | 837 |
| 143 | Ga0207698_10008290 | 3300026142 | Bacteria | 6563 |
| 144 | Ga0209969_1017318 | 3300027360 | Bacteria | 1060 |
| 145 | Ga0209999_1021437 | 3300027543 | Bacteria | 1186 |
| 146 | Ga0210002_1002279 | 3300027617 | Bacteria | 2773 |
| 147 | Ga0209983_1004861 | 3300027665 | Bacteria | 2805 |
| 148 | Ga0209966_1038189 | 3300027695 | Bacteria | 993 |
| 149 | Ga0209998_10005096 | 3300027717 | Bacteria | 2759 |
| 150 | Ga0209974_10000142 | 3300027876 | Bacteria | 21532 |
| 151 | Ga0268264_10145395 | 3300028381 | Bacteria | 2119 |
| 152 | Ga0268264_10233160 | 3300028381 | Bacteria | 1701 |
| 153 | Ga0265326_10025018 | 3300028558 | Archaea | 1703 |
| 154 | Ga0265338_10054501 | 3300028800 | Bacteria | 3565 |
| 155 | Ga0265332_10060580 | 3300031238 | Bacteria | 1619 |
| 156 | Ga0265339_10005519 | 3300031249 | Bacteria | 8421 |
| 157 | Ga0265331_10005600 | 3300031250 | Bacteria | 7558 |
| 158 | Ga0307408_100263636 | 3300031548 | Bacteria | 1427 |
| 159 | Ga0265342_10267767 | 3300031712 | Bacteria | 907 |
| 160 | Ga0307405_10088745 | 3300031731 | Bacteria | 2041 |
| 161 | Ga0307410_11048801 | 3300031852 | Bacteria | 705 |
| 162 | Ga0307409_100981893 | 3300031995 | Bacteria | 862 |
| 163 | Ga0373953_0111538 | 3300035117 | Bacteria | 1157 |
| 164 | Ga0373956_0203018 | 3300035119 | Bacteria | 940 |
| 165 | Ga0373955_0041859 | 3300035172 | Bacteria | 2458 |
| 166 | Ga0373955_0238629 | 3300035172 | Bacteria | 1089 |
| 167 | Ga0373961_0123274 | 3300035241 | Bacteria | 861 |
| 168 | Ga0316574_0077932 | 3300035398 | Bacteria | 2101 |
| 169 | Ga0316574_0321164 | 3300035398 | Bacteria | 983 |
| 170 | Ga0373933_0152790 | 3300035724 | Bacteria | 1463 |
| 171 | Ga0373937_0087731 | 3300036401 | Bacteria | 2880 |
| 172 | Ga0373937_1097684 | 3300036401 | Bacteria | 744 |
| 173 | Ga0373925_0312554 | 3300037068 | Bacteria | 1270 |
| 174 | Ga0395899_0003054 | 3300037312 | Bacteria | 13365 |
| 175 | Ga0395899_0127325 | 3300037312 | Bacteria | 1820 |
| 176 | Ga0395900_0040956 | 3300037418 | Bacteria | 4775 |
| 177 | Ga0395900_0060639 | 3300037418 | Bacteria | 3892 |
| 178 | Ga0395900_1157929 | 3300037418 | Bacteria | 689 |
| 179 | Ga0395898_0042878 | 3300037466 | Bacteria | 4461 |
| 180 | Ga0395898_0070998 | 3300037466 | Bacteria | 3365 |
| 181 | Ga0395905_0017785 | 3300037471 | Bacteria | 6752 |
| 182 | Ga0395905_0018349 | 3300037471 | Bacteria | 6640 |
| 183 | Ga0395905_0210744 | 3300037471 | Bacteria | 1820 |
| 184 | Ga0395905_0333357 | 3300037471 | Bacteria | 1408 |
| 185 | Ga0395905_1234100 | 3300037471 | Bacteria | 651 |
| 186 | Ga0395901_0014222 | 3300038443 | Bacteria | 8102 |
| 187 | Ga0395901_0083209 | 3300038443 | Bacteria | 3345 |
| 188 | Ga0395901_0151517 | 3300038443 | Bacteria | 2436 |
| 189 | Ga0436365_1364049 | 3300039437 | Bacteria | 624 |
| 190 | Ga0436365_1718584 | 3300039437 | Bacteria | 1442 |
| 191 | Ga0451797_1078276 | 3300041453 | Bacteria | 731 |
| 192 | Ga0439441_082868 | 3300042001 | Bacteria | 701 |
| 193 | Ga0451577_0124624 | 3300042876 | Bacteria | 2309 |
| 194 | Ga0453683_0029331 | 3300044673 | Bacteria | 3479 |
| 195 | Ga0466963_0007746 | 3300044694 | Bacteria | 6419 |
| 196 | Ga0453684_2038081 | 3300044712 | Bacteria | 577 |
| 197 | Ga0451576_0382605 | 3300045051 | Unclassified | 1475 |
| 198 | Ga0451576_0594041 | 3300045051 | Bacteria | 1163 |
| 199 | Ga0466967_0026899 | 3300045976 | Bacteria | 4775 |
| 200 | Ga0495592_0101204 | 3300046454 | Bacteria | 2053 |
| 201 | Ga0495605_0244682 | 3300046474 | Bacteria | 769 |
| 202 | Ga0495594_0299173 | 3300046499 | Bacteria | 917 |
| 203 | Ga0495630_0612826 | 3300046517 | Bacteria | 834 |
| 204 | Ga0495665_0085995 | 3300046531 | Bacteria | 1653 |
| 205 | Ga0495586_0274045 | 3300046535 | Bacteria | 965 |
| 206 | Ga0495586_0321666 | 3300046535 | Bacteria | 887 |
| 207 | Ga0495633_0059428 | 3300046558 | Bacteria | 1793 |
| 208 | Ga0495599_0091223 | 3300046678 | Bacteria | 1901 |
| 209 | Ga0495599_0280081 | 3300046678 | Bacteria | 1010 |
| 210 | Ga0495658_0039427 | 3300046683 | Bacteria | 2621 |
| 211 | Ga0495658_0072603 | 3300046683 | Bacteria | 2002 |
| 212 | Ga0495658_0126512 | 3300046683 | Bacteria | 1551 |
| 213 | Ga0495658_0365119 | 3300046683 | Bacteria | 918 |
| 214 | Ga0495669_0452658 | 3300046684 | Bacteria | 623 |
| 215 | Ga0495613_0056524 | 3300046689 | Bacteria | 2881 |
| 216 | Ga0495604_0651372 | 3300047317 | Bacteria | 672 |
| 217 | Ga0495674_0046840 | 3300047319 | Bacteria | 3837 |
| 218 | Ga0495674_0235825 | 3300047319 | Bacteria | 1509 |
| 219 | Ga0495674_0430233 | 3300047319 | Bacteria | 1062 |
| 220 | Ga0495675_0177680 | 3300047444 | Bacteria | 1305 |
| 221 | Ga0495677_0308964 | 3300047445 | Bacteria | 622 |
| 222 | Ga0495684_0335654 | 3300047471 | Bacteria | 1077 |
| 223 | Ga0496100_0093314 | 3300048903 | Bacteria | 2059 |
| 224 | Ga0496100_0327723 | 3300048903 | Bacteria | 1152 |
| 225 | Ga0496102_0164735 | 3300048905 | Bacteria | 2086 |
| 226 | Ga0496102_0169497 | 3300048905 | Bacteria | 2055 |
| 227 | Ga0496103_0152962 | 3300048906 | Bacteria | 1478 |
| 228 | Ga0496104_0010128 | 3300048907 | Bacteria | 8418 |
| 229 | Ga0496106_0195978 | 3300048909 | Bacteria | 1607 |
| 230 | Ga0496106_0253847 | 3300048909 | Bacteria | 1406 |
| 231 | Ga0496107_0043147 | 3300048910 | Bacteria | 3240 |
| 232 | Ga0496114_0000328 | 3300048917 | Bacteria | 34453 |
| 233 | Ga0501032_0026990 | 3300049569 | Bacteria | 3948 |
| 234 | Ga0501034_0001601 | 3300049571 | Bacteria | 29434 |
| 235 | Ga0501036_0028518 | 3300049572 | Bacteria | 4717 |
| 236 | Ga0501037_0008355 | 3300049573 | Bacteria | 7588 |
| 237 | Ga0501039_0023982 | 3300049575 | Bacteria | 4685 |
| 238 | Ga0501043_0112901 | 3300049579 | Bacteria | 2134 |
| 239 | Ga0501046_0011740 | 3300049580 | Bacteria | 7479 |
| 240 | Ga0501071_0020175 | 3300049587 | Bacteria | 4630 |
| 241 | Ga0501071_0350149 | 3300049587 | Bacteria | 1124 |
| 242 | Ga0501074_0058737 | 3300049590 | Bacteria | 2771 |
| 243 | Ga0501075_0004808 | 3300049591 | Bacteria | 9188 |
| 244 | Ga0501076_0106105 | 3300049592 | Bacteria | 2267 |
| 245 | Ga0501077_0004391 | 3300049593 | Bacteria | 8551 |
| 246 | Ga0501223_081190 | 3300049663 | Unclassified | 649 |
| 247 | Ga0501079_0603139 | 3300049741 | Bacteria | 864 |
| 248 | Ga0501080_0090950 | 3300049742 | Bacteria | 2834 |
| 249 | Ga0501081_0065768 | 3300049743 | Bacteria | 2520 |
| 250 | Ga0501083_0260020 | 3300049744 | Bacteria | 1129 |
| 251 | Ga0501264_018265 | 3300049761 | Bacteria | 726 |
| 252 | Ga0501035_0693215 | 3300049822 | Bacteria | 822 |
| 253 | Ga0501045_0016144 | 3300049824 | Bacteria | 5299 |
| 254 | nmdc:mga05p37_7283_c1 | 3300050507 | Bacteria | 13053 |
| 255 | nmdc:mga05p37_891059_c1 | 3300050507 | Bacteria | 961 |
| 256 | nmdc:mga09592_32983_c1 | 3300050508 | Bacteria | 4319 |
| 257 | nmdc:mga08y16_141332_c1 | 3300050511 | Bacteria | 2503 |
| 258 | nmdc:mga08y16_432264_c1 | 3300050511 | Bacteria | 1344 |
| 259 | nmdc:mga0n895_778567_c1 | 3300050512 | Unclassified | 948 |
| 260 | nmdc:mga0rr50_1087940_c1 | 3300050513 | Bacteria | 680 |
| 261 | nmdc:mga0rr50_97478_c1 | 3300050513 | Bacteria | 2303 |
| 262 | nmdc:mga08x19_189762_c1 | 3300050514 | Bacteria | 1406 |
| 263 | nmdc:mga0a205_71859_c2 | 3300050515 | Bacteria | 1650 |
| 264 | nmdc:mga0a205_7352_c1 | 3300050515 | Bacteria | 9974 |
| 265 | nmdc:mga0a205_789194_c1 | 3300050515 | Unclassified | 798 |
| 266 | Ga0495655_0005334 | 3300053083 | Bacteria | 2266 |
| 267 | Ga0590077_004545 | 3300059426 | Bacteria | 2844 |
| 268 | Ga0530510_0007458 | 3300061734 | Bacteria | 7617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_778567_c1 | nmdc:mga0n895_778567_c1_23_565 | 166 |
| 2 | 3300009177 | Ga0105248_10720122 | Ga0105248_107201222 | 167 |
| 3 | 3300025906 | Ga0207699_10122849 | Ga0207699_101228492 | 170 |
| 4 | 3300005547 | Ga0070693_100148637 | Ga0070693_1001486372 | 171 |
| 5 | 3300005549 | Ga0070704_100694404 | Ga0070704_1006944041 | 171 |
| 6 | 3300005617 | Ga0068859_101478201 | Ga0068859_1014782012 | 171 |
| 7 | 3300005842 | Ga0068858_100093081 | Ga0068858_1000930813 | 171 |
| 8 | 3300006931 | Ga0097620_101478124 | Ga0097620_1014781241 | 171 |
| 9 | 3300009101 | Ga0105247_10528508 | Ga0105247_105285081 | 171 |
| 10 | 3300025918 | Ga0207662_10101965 | Ga0207662_101019652 | 171 |
| 11 | 3300026035 | Ga0207703_10073148 | Ga0207703_100731483 | 171 |
| 12 | 3300028381 | Ga0268264_10233160 | Ga0268264_102331602 | 171 |
| 13 | 3300005331 | Ga0070670_100595448 | Ga0070670_1005954481 | 172 |
| 14 | 3300049663 | Ga0501223_081190 | Ga0501223_081190_71_631 | 174 |
| 15 | 3300028558 | Ga0265326_10025018 | Ga0265326_100250181 | 176 |
| 16 | 3300042876 | Ga0451577_0124624 | Ga0451577_0124624_20_553 | 176 |
| 17 | 3300006871 | Ga0075434_100319502 | Ga0075434_1003195023 | 177 |
| 18 | 3300037418 | Ga0395900_1157929 | Ga0395900_1157929_33_566 | 177 |
| 19 | 3300044673 | Ga0453683_0029331 | Ga0453683_0029331_2148_2684 | 177 |
| 20 | 3300013297 | Ga0157378_10621989 | Ga0157378_106219892 | 178 |
| 21 | 3300013297 | Ga0157378_11634795 | Ga0157378_116347951 | 178 |
| 22 | 3300046684 | Ga0495669_0452658 | Ga0495669_0452658_70_606 | 178 |
| 23 | 3300047445 | Ga0495677_0308964 | Ga0495677_0308964_45_581 | 178 |
| 24 | 3300048905 | Ga0496102_0169497 | Ga0496102_0169497_1311_1847 | 178 |
| 25 | 3300048906 | Ga0496103_0152962 | Ga0496103_0152962_285_821 | 178 |
| 26 | 3300006852 | Ga0075433_10232550 | Ga0075433_102325502 | 179 |
| 27 | 3300050515 | nmdc:mga0a205_71859_c2 | nmdc:mga0a205_71859_c2_129_680 | 179 |
| 28 | 3300007076 | Ga0075435_100232502 | Ga0075435_1002325023 | 180 |
| 29 | 3300005341 | Ga0070691_10312522 | Ga0070691_103125221 | 181 |
| 30 | 3300044712 | Ga0453684_2038081 | Ga0453684_2038081_11_556 | 181 |
| 31 | 3300047317 | Ga0495604_0651372 | Ga0495604_0651372_51_596 | 181 |
| 32 | 3300005445 | Ga0070708_100497492 | Ga0070708_1004974921 | 182 |
| 33 | 3300039437 | Ga0436365_1364049 | Ga0436365_1364049_27_575 | 182 |
| 34 | 3300037312 | Ga0395899_0127325 | Ga0395899_0127325_935_1489 | 183 |
| 35 | 3300037418 | Ga0395900_0060639 | Ga0395900_0060639_1908_2462 | 183 |
| 36 | 3300037466 | Ga0395898_0042878 | Ga0395898_0042878_3199_3753 | 183 |
| 37 | 3300037471 | Ga0395905_0210744 | Ga0395905_0210744_332_886 | 183 |
| 38 | 3300038443 | Ga0395901_0151517 | Ga0395901_0151517_1431_1985 | 183 |
| 39 | 3300044694 | Ga0466963_0007746 | Ga0466963_0007746_1665_2219 | 183 |
| 40 | 3300005468 | Ga0070707_100217730 | Ga0070707_1002177302 | 184 |
| 41 | 3300025922 | Ga0207646_10217091 | Ga0207646_102170912 | 184 |
| 42 | 3300031852 | Ga0307410_11048801 | Ga0307410_110488012 | 184 |
| 43 | 3300036401 | Ga0373937_0087731 | Ga0373937_0087731_233_793 | 185 |
| 44 | 3300050511 | nmdc:mga08y16_432264_c1 | nmdc:mga08y16_432264_c1_103_660 | 185 |
| 45 | 3300031238 | Ga0265332_10060580 | Ga0265332_100605802 | 186 |
| 46 | 3300031249 | Ga0265339_10005519 | Ga0265339_100055193 | 186 |
| 47 | 3300031250 | Ga0265331_10005600 | Ga0265331_100056005 | 186 |
| 48 | 3300031712 | Ga0265342_10267767 | Ga0265342_102677671 | 186 |
| 49 | 3300049569 | Ga0501032_0026990 | Ga0501032_0026990_1868_2431 | 186 |
| 50 | 3300005355 | Ga0070671_100072444 | Ga0070671_1000724444 | 187 |
| 51 | 3300005436 | Ga0070713_100082554 | Ga0070713_1000825542 | 187 |
| 52 | 3300006028 | Ga0070717_10000436 | Ga0070717_1000043610 | 187 |
| 53 | 3300025928 | Ga0207700_10763823 | Ga0207700_107638232 | 187 |
| 54 | 3300025931 | Ga0207644_10001551 | Ga0207644_1000155110 | 187 |
| 55 | 3300026121 | Ga0207683_10868882 | Ga0207683_108688821 | 187 |
| 56 | 3300035398 | Ga0316574_0321164 | Ga0316574_0321164_162_725 | 187 |
| 57 | 3300048903 | Ga0496100_0327723 | Ga0496100_0327723_161_727 | 187 |
| 58 | 3300005340 | Ga0070689_100158994 | Ga0070689_1001589942 | 188 |
| 59 | 3300005344 | Ga0070661_100569543 | Ga0070661_1005695431 | 188 |
| 60 | 3300005347 | Ga0070668_100294573 | Ga0070668_1002945732 | 188 |
| 61 | 3300005353 | Ga0070669_100606005 | Ga0070669_1006060051 | 188 |
| 62 | 3300005354 | Ga0070675_100528030 | Ga0070675_1005280302 | 188 |
| 63 | 3300005355 | Ga0070671_100110742 | Ga0070671_1001107423 | 188 |
| 64 | 3300005364 | Ga0070673_100327983 | Ga0070673_1003279832 | 188 |
| 65 | 3300005365 | Ga0070688_100255889 | Ga0070688_1002558892 | 188 |
| 66 | 3300005549 | Ga0070704_100561141 | Ga0070704_1005611411 | 188 |
| 67 | 3300005564 | Ga0070664_100048295 | Ga0070664_1000482952 | 188 |
| 68 | 3300006880 | Ga0075429_100316585 | Ga0075429_1003165852 | 188 |
| 69 | 3300025908 | Ga0207643_10051821 | Ga0207643_100518212 | 188 |
| 70 | 3300025923 | Ga0207681_10685265 | Ga0207681_106852652 | 188 |
| 71 | 3300025926 | Ga0207659_10198266 | Ga0207659_101982661 | 188 |
| 72 | 3300025960 | Ga0207651_10067403 | Ga0207651_100674032 | 188 |
| 73 | 3300026121 | Ga0207683_10414699 | Ga0207683_104146992 | 188 |
| 74 | 3300035241 | Ga0373961_0123274 | Ga0373961_0123274_30_596 | 188 |
| 75 | 3300037312 | Ga0395899_0003054 | Ga0395899_0003054_1793_2362 | 188 |
| 76 | 3300037418 | Ga0395900_0040956 | Ga0395900_0040956_3734_4303 | 188 |
| 77 | 3300037466 | Ga0395898_0070998 | Ga0395898_0070998_284_853 | 188 |
| 78 | 3300037471 | Ga0395905_0018349 | Ga0395905_0018349_380_949 | 188 |
| 79 | 3300038443 | Ga0395901_0014222 | Ga0395901_0014222_1597_2166 | 188 |
| 80 | 3300045976 | Ga0466967_0026899 | Ga0466967_0026899_1610_2179 | 188 |
| 81 | 3300046499 | Ga0495594_0299173 | Ga0495594_0299173_333_899 | 188 |
| 82 | 3300005467 | Ga0070706_100726083 | Ga0070706_1007260831 | 189 |
| 83 | 3300025904 | Ga0207647_10449060 | Ga0207647_104490602 | 189 |
| 84 | 3300031548 | Ga0307408_100263636 | Ga0307408_1002636362 | 189 |
| 85 | 3300037471 | Ga0395905_0017785 | Ga0395905_0017785_66_638 | 189 |
| 86 | 3300037471 | Ga0395905_0333357 | Ga0395905_0333357_82_654 | 189 |
| 87 | 3300037471 | Ga0395905_1234100 | Ga0395905_1234100_63_635 | 189 |
| 88 | 3300038443 | Ga0395901_0083209 | Ga0395901_0083209_922_1494 | 189 |
| 89 | 3300005339 | Ga0070660_100114925 | Ga0070660_1001149252 | 190 |
| 90 | 3300005366 | Ga0070659_100362665 | Ga0070659_1003626652 | 190 |
| 91 | 3300005468 | Ga0070707_100006513 | Ga0070707_1000065137 | 190 |
| 92 | 3300005536 | Ga0070697_100036272 | Ga0070697_1000362724 | 190 |
| 93 | 3300005616 | Ga0068852_100890964 | Ga0068852_1008909642 | 190 |
| 94 | 3300013104 | Ga0157370_11036875 | Ga0157370_110368751 | 190 |
| 95 | 3300025920 | Ga0207649_10586281 | Ga0207649_105862812 | 190 |
| 96 | 3300031731 | Ga0307405_10088745 | Ga0307405_100887453 | 190 |
| 97 | 3300035398 | Ga0316574_0077932 | Ga0316574_0077932_915_1487 | 190 |
| 98 | 3300049587 | Ga0501071_0350149 | Ga0501071_0350149_278_853 | 190 |
| 99 | 3300009098 | Ga0105245_10849510 | Ga0105245_108495101 | 191 |
| 100 | 3300025922 | Ga0207646_10000540 | Ga0207646_1000054015 | 191 |
| 101 | 3300025922 | Ga0207646_10000548 | Ga0207646_1000054818 | 191 |
| 102 | 3300028800 | Ga0265338_10054501 | Ga0265338_100545011 | 191 |
| 103 | 3300045051 | Ga0451576_0594041 | Ga0451576_0594041_268_846 | 191 |
| 104 | 3300049741 | Ga0501079_0603139 | Ga0501079_0603139_190_768 | 191 |
| 105 | 3300005339 | Ga0070660_100074656 | Ga0070660_1000746564 | 192 |
| 106 | 3300005355 | Ga0070671_100224278 | Ga0070671_1002242783 | 192 |
| 107 | 3300005365 | Ga0070688_100176315 | Ga0070688_1001763152 | 192 |
| 108 | 3300005444 | Ga0070694_100389945 | Ga0070694_1003899452 | 192 |
| 109 | 3300005459 | Ga0068867_100418632 | Ga0068867_1004186322 | 192 |
| 110 | 3300006173 | Ga0070716_100481995 | Ga0070716_1004819952 | 192 |
| 111 | 3300013308 | Ga0157375_10370080 | Ga0157375_103700802 | 192 |
| 112 | 3300026023 | Ga0207677_10360652 | Ga0207677_103606522 | 192 |
| 113 | 3300027695 | Ga0209966_1038189 | Ga0209966_10381892 | 192 |
| 114 | 3300005295 | Ga0065707_10049920 | Ga0065707_100499201 | 193 |
| 115 | 3300005329 | Ga0070683_100000382 | Ga0070683_10000038211 | 193 |
| 116 | 3300005456 | Ga0070678_100051808 | Ga0070678_1000518082 | 193 |
| 117 | 3300005535 | Ga0070684_100009496 | Ga0070684_1000094969 | 193 |
| 118 | 3300005549 | Ga0070704_100245801 | Ga0070704_1002458012 | 193 |
| 119 | 3300005564 | Ga0070664_100561347 | Ga0070664_1005613472 | 193 |
| 120 | 3300005616 | Ga0068852_100005499 | Ga0068852_1000054998 | 193 |
| 121 | 3300006175 | Ga0070712_100010204 | Ga0070712_1000102046 | 193 |
| 122 | 3300009174 | Ga0105241_10015774 | Ga0105241_100157746 | 193 |
| 123 | 3300013307 | Ga0157372_10139874 | Ga0157372_101398744 | 193 |
| 124 | 3300014968 | Ga0157379_10268012 | Ga0157379_102680123 | 193 |
| 125 | 3300025915 | Ga0207693_10019593 | Ga0207693_100195936 | 193 |
| 126 | 3300025944 | Ga0207661_10045822 | Ga0207661_100458222 | 193 |
| 127 | 3300025945 | Ga0207679_10527511 | Ga0207679_105275112 | 193 |
| 128 | 3300026121 | Ga0207683_10029389 | Ga0207683_100293893 | 193 |
| 129 | 3300026142 | Ga0207698_10008290 | Ga0207698_100082909 | 193 |
| 130 | 3300035119 | Ga0373956_0203018 | Ga0373956_0203018_131_712 | 193 |
| 131 | 3300035172 | Ga0373955_0041859 | Ga0373955_0041859_555_1136 | 193 |
| 132 | 3300036401 | Ga0373937_1097684 | Ga0373937_1097684_53_634 | 193 |
| 133 | 3300042001 | Ga0439441_082868 | Ga0439441_082868_10_591 | 193 |
| 134 | 3300045051 | Ga0451576_0382605 | Ga0451576_0382605_797_1378 | 193 |
| 135 | 3300046454 | Ga0495592_0101204 | Ga0495592_0101204_1076_1657 | 193 |
| 136 | 3300046474 | Ga0495605_0244682 | Ga0495605_0244682_168_752 | 193 |
| 137 | 3300046517 | Ga0495630_0612826 | Ga0495630_0612826_187_768 | 193 |
| 138 | 3300046535 | Ga0495586_0274045 | Ga0495586_0274045_56_637 | 193 |
| 139 | 3300046535 | Ga0495586_0321666 | Ga0495586_0321666_154_735 | 193 |
| 140 | 3300046678 | Ga0495599_0091223 | Ga0495599_0091223_1291_1872 | 193 |
| 141 | 3300046678 | Ga0495599_0280081 | Ga0495599_0280081_197_778 | 193 |
| 142 | 3300046683 | Ga0495658_0365119 | Ga0495658_0365119_53_634 | 193 |
| 143 | 3300046689 | Ga0495613_0056524 | Ga0495613_0056524_1091_1672 | 193 |
| 144 | 3300047319 | Ga0495674_0235825 | Ga0495674_0235825_740_1321 | 193 |
| 145 | 3300047319 | Ga0495674_0430233 | Ga0495674_0430233_397_978 | 193 |
| 146 | 3300047444 | Ga0495675_0177680 | Ga0495675_0177680_77_658 | 193 |
| 147 | 3300049571 | Ga0501034_0001601 | Ga0501034_0001601_135_716 | 193 |
| 148 | 3300053083 | Ga0495655_0005334 | Ga0495655_0005334_424_1008 | 193 |
| 149 | 3300059426 | Ga0590077_004545 | Ga0590077_004545_1256_1840 | 193 |
| 150 | 3300006914 | Ga0075436_100116430 | Ga0075436_1001164303 | 194 |
| 151 | 3300025941 | Ga0207711_10558593 | Ga0207711_105585931 | 194 |
| 152 | 3300035117 | Ga0373953_0111538 | Ga0373953_0111538_181_765 | 194 |
| 153 | 3300035172 | Ga0373955_0238629 | Ga0373955_0238629_325_909 | 194 |
| 154 | 3300035724 | Ga0373933_0152790 | Ga0373933_0152790_94_678 | 194 |
| 155 | 3300041453 | Ga0451797_1078276 | Ga0451797_1078276_64_675 | 194 |
| 156 | 3300046531 | Ga0495665_0085995 | Ga0495665_0085995_58_642 | 194 |
| 157 | 3300046558 | Ga0495633_0059428 | Ga0495633_0059428_551_1135 | 194 |
| 158 | 3300047471 | Ga0495684_0335654 | Ga0495684_0335654_23_607 | 194 |
| 159 | 3300050513 | nmdc:mga0rr50_1087940_c1 | nmdc:mga0rr50_1087940_c1_11_598 | 194 |
| 160 | 3300006914 | Ga0075436_100577342 | Ga0075436_1005773422 | 195 |
| 161 | 3300025933 | Ga0207706_10228707 | Ga0207706_102287072 | 195 |
| 162 | 3300039437 | Ga0436365_1718584 | Ga0436365_1718584_91_678 | 195 |
| 163 | 3300005365 | Ga0070688_100842688 | Ga0070688_1008426881 | 196 |
| 164 | 3300005842 | Ga0068858_100362222 | Ga0068858_1003622222 | 196 |
| 165 | 3300009094 | Ga0111539_10196992 | Ga0111539_101969922 | 196 |
| 166 | 3300009147 | Ga0114129_11070836 | Ga0114129_110708362 | 196 |
| 167 | 3300009177 | Ga0105248_10159108 | Ga0105248_101591083 | 196 |
| 168 | 3300025936 | Ga0207670_10806097 | Ga0207670_108060971 | 196 |
| 169 | 3300027360 | Ga0209969_1017318 | Ga0209969_10173181 | 196 |
| 170 | 3300027543 | Ga0209999_1021437 | Ga0209999_10214371 | 196 |
| 171 | 3300027617 | Ga0210002_1002279 | Ga0210002_10022793 | 196 |
| 172 | 3300027665 | Ga0209983_1004861 | Ga0209983_10048614 | 196 |
| 173 | 3300027717 | Ga0209998_10005096 | Ga0209998_100050963 | 196 |
| 174 | 3300027876 | Ga0209974_10000142 | Ga0209974_1000014216 | 196 |
| 175 | 3300048909 | Ga0496106_0195978 | Ga0496106_0195978_467_1060 | 196 |
| 176 | 3300050515 | nmdc:mga0a205_789194_c1 | nmdc:mga0a205_789194_c1_105_698 | 196 |
| 177 | 3300046683 | Ga0495658_0072603 | Ga0495658_0072603_823_1416 | 197 |
| 178 | 3300050513 | nmdc:mga0rr50_97478_c1 | nmdc:mga0rr50_97478_c1_303_899 | 197 |
| 179 | 3300006173 | Ga0070716_100059575 | Ga0070716_1000595753 | 198 |
| 180 | 3300006358 | Ga0068871_100624108 | Ga0068871_1006241081 | 198 |
| 181 | 3300006844 | Ga0075428_100007567 | Ga0075428_10000756711 | 198 |
| 182 | 3300006852 | Ga0075433_10298953 | Ga0075433_102989532 | 198 |
| 183 | 3300006914 | Ga0075436_100273587 | Ga0075436_1002735871 | 198 |
| 184 | 3300009147 | Ga0114129_10004890 | Ga0114129_1000489016 | 198 |
| 185 | 3300013306 | Ga0163162_10629688 | Ga0163162_106296881 | 198 |
| 186 | 3300025933 | Ga0207706_10929441 | Ga0207706_109294412 | 198 |
| 187 | 3300025939 | Ga0207665_10207028 | Ga0207665_102070281 | 198 |
| 188 | 3300050507 | nmdc:mga05p37_7283_c1 | nmdc:mga05p37_7283_c1_11765_12367 | 198 |
| 189 | 3300050514 | nmdc:mga08x19_189762_c1 | nmdc:mga08x19_189762_c1_127_726 | 198 |
| 190 | 3300050515 | nmdc:mga0a205_7352_c1 | nmdc:mga0a205_7352_c1_627_1229 | 198 |
| 191 | 3300046683 | Ga0495658_0126512 | Ga0495658_0126512_519_1121 | 199 |
| 192 | 3300050511 | nmdc:mga08y16_141332_c1 | nmdc:mga08y16_141332_c1_1606_2232 | 199 |
| 193 | 3300031995 | Ga0307409_100981893 | Ga0307409_1009818931 | 200 |
| 194 | 3300047319 | Ga0495674_0046840 | Ga0495674_0046840_2275_2898 | 200 |
| 195 | 3300049572 | Ga0501036_0028518 | Ga0501036_0028518_638_1246 | 200 |
| 196 | 3300049573 | Ga0501037_0008355 | Ga0501037_0008355_4940_5554 | 200 |
| 197 | 3300049575 | Ga0501039_0023982 | Ga0501039_0023982_984_1592 | 200 |
| 198 | 3300049579 | Ga0501043_0112901 | Ga0501043_0112901_771_1379 | 200 |
| 199 | 3300049580 | Ga0501046_0011740 | Ga0501046_0011740_3423_4031 | 200 |
| 200 | 3300049587 | Ga0501071_0020175 | Ga0501071_0020175_333_941 | 200 |
| 201 | 3300049590 | Ga0501074_0058737 | Ga0501074_0058737_1931_2539 | 200 |
| 202 | 3300049591 | Ga0501075_0004808 | Ga0501075_0004808_5478_6086 | 200 |
| 203 | 3300049592 | Ga0501076_0106105 | Ga0501076_0106105_585_1193 | 200 |
| 204 | 3300049593 | Ga0501077_0004391 | Ga0501077_0004391_6655_7263 | 200 |
| 205 | 3300049742 | Ga0501080_0090950 | Ga0501080_0090950_399_1007 | 200 |
| 206 | 3300049743 | Ga0501081_0065768 | Ga0501081_0065768_170_778 | 200 |
| 207 | 3300049822 | Ga0501035_0693215 | Ga0501035_0693215_170_778 | 200 |
| 208 | 3300049824 | Ga0501045_0016144 | Ga0501045_0016144_3174_3782 | 200 |
| 209 | 3300050508 | nmdc:mga09592_32983_c1 | nmdc:mga09592_32983_c1_563_1195 | 200 |
| 210 | 3300061734 | Ga0530510_0007458 | Ga0530510_0007458_1579_2187 | 200 |
| 211 | 3300049744 | Ga0501083_0260020 | Ga0501083_0260020_77_682 | 201 |
| 212 | 3300050507 | nmdc:mga05p37_891059_c1 | nmdc:mga05p37_891059_c1_179_823 | 201 |
| 213 | 3300005354 | Ga0070675_100178213 | Ga0070675_1001782133 | 202 |
| 214 | 3300005434 | Ga0070709_10242978 | Ga0070709_102429782 | 202 |
| 215 | 3300005530 | Ga0070679_100015170 | Ga0070679_1000151708 | 202 |
| 216 | 3300006237 | Ga0097621_100037273 | Ga0097621_1000372735 | 202 |
| 217 | 3300009176 | Ga0105242_10135317 | Ga0105242_101353172 | 202 |
| 218 | 3300013100 | Ga0157373_10038085 | Ga0157373_100380851 | 202 |
| 219 | 3300013104 | Ga0157370_10094034 | Ga0157370_100940345 | 202 |
| 220 | 3300013105 | Ga0157369_10183287 | Ga0157369_101832874 | 202 |
| 221 | 3300013307 | Ga0157372_10091430 | Ga0157372_100914304 | 202 |
| 222 | 3300017792 | Ga0163161_10050645 | Ga0163161_100506453 | 202 |
| 223 | 3300025921 | Ga0207652_10045157 | Ga0207652_100451572 | 202 |
| 224 | 3300048903 | Ga0496100_0093314 | Ga0496100_0093314_575_1186 | 202 |
| 225 | 3300048905 | Ga0496102_0164735 | Ga0496102_0164735_1061_1672 | 202 |
| 226 | 3300048907 | Ga0496104_0010128 | Ga0496104_0010128_1243_1854 | 202 |
| 227 | 3300048909 | Ga0496106_0253847 | Ga0496106_0253847_287_898 | 202 |
| 228 | 3300048910 | Ga0496107_0043147 | Ga0496107_0043147_2180_2791 | 202 |
| 229 | 3300048917 | Ga0496114_0000328 | Ga0496114_0000328_13191_13802 | 202 |
| 230 | 3300049761 | Ga0501264_018265 | Ga0501264_018265_47_661 | 202 |
| 231 | 3300005331 | Ga0070670_100240337 | Ga0070670_1002403372 | 205 |
| 232 | 3300025940 | Ga0207691_10003793 | Ga0207691_100037932 | 205 |
| 233 | 3300026088 | Ga0207641_10998377 | Ga0207641_109983772 | 205 |
| 234 | 3300046683 | Ga0495658_0039427 | Ga0495658_0039427_899_1549 | 205 |
| 235 | 3300005330 | Ga0070690_100794219 | Ga0070690_1007942191 | 207 |
| 236 | 3300005334 | Ga0068869_100041656 | Ga0068869_1000416564 | 207 |
| 237 | 3300005340 | Ga0070689_100135765 | Ga0070689_1001357652 | 207 |
| 238 | 3300005354 | Ga0070675_100070841 | Ga0070675_1000708413 | 207 |
| 239 | 3300005459 | Ga0068867_100191447 | Ga0068867_1001914472 | 207 |
| 240 | 3300005546 | Ga0070696_100741040 | Ga0070696_1007410401 | 207 |
| 241 | 3300005548 | Ga0070665_100287186 | Ga0070665_1002871862 | 207 |
| 242 | 3300005617 | Ga0068859_100028533 | Ga0068859_1000285335 | 207 |
| 243 | 3300005718 | Ga0068866_10090699 | Ga0068866_100906993 | 207 |
| 244 | 3300005719 | Ga0068861_100225832 | Ga0068861_1002258323 | 207 |
| 245 | 3300005841 | Ga0068863_100104171 | Ga0068863_1001041712 | 207 |
| 246 | 3300006237 | Ga0097621_100080936 | Ga0097621_1000809364 | 207 |
| 247 | 3300006358 | Ga0068871_100020067 | Ga0068871_1000200676 | 207 |
| 248 | 3300006881 | Ga0068865_100658620 | Ga0068865_1006586201 | 207 |
| 249 | 3300006931 | Ga0097620_100028534 | Ga0097620_1000285346 | 207 |
| 250 | 3300009098 | Ga0105245_10282574 | Ga0105245_102825743 | 207 |
| 251 | 3300009176 | Ga0105242_10320742 | Ga0105242_103207422 | 207 |
| 252 | 3300009177 | Ga0105248_10014635 | Ga0105248_100146355 | 207 |
| 253 | 3300013297 | Ga0157378_11063189 | Ga0157378_110631892 | 207 |
| 254 | 3300013306 | Ga0163162_10022972 | Ga0163162_100229725 | 207 |
| 255 | 3300014325 | Ga0163163_10455080 | Ga0163163_104550802 | 207 |
| 256 | 3300014968 | Ga0157379_10171487 | Ga0157379_101714872 | 207 |
| 257 | 3300025899 | Ga0207642_10036751 | Ga0207642_100367512 | 207 |
| 258 | 3300025926 | Ga0207659_10070619 | Ga0207659_100706192 | 207 |
| 259 | 3300025927 | Ga0207687_10126861 | Ga0207687_101268614 | 207 |
| 260 | 3300025941 | Ga0207711_10005309 | Ga0207711_100053095 | 207 |
| 261 | 3300025942 | Ga0207689_10028715 | Ga0207689_100287155 | 207 |
| 262 | 3300026023 | Ga0207677_10244897 | Ga0207677_102448972 | 207 |
| 263 | 3300026088 | Ga0207641_10105079 | Ga0207641_101050794 | 207 |
| 264 | 3300026089 | Ga0207648_10034437 | Ga0207648_100344375 | 207 |
| 265 | 3300026118 | Ga0207675_100060826 | Ga0207675_1000608263 | 207 |
| 266 | 3300028381 | Ga0268264_10145395 | Ga0268264_101453953 | 207 |
| 267 | 3300037068 | Ga0373925_0312554 | Ga0373925_0312554_54_680 | 207 |
| 268 | 3300003323 | rootH1_10189211 | rootH1_101892118 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ai5-assembly3.cif.gz_C | crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine | 0.977 | 14 | 190 |
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9752 | 13 | 191 |
| 4aia-assembly4.cif.gz_D | the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus | 0.9744 | 14 | 190 |
| 4ai4-assembly1.cif.gz_A | crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus | 0.965 | 14 | 190 |
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9543 | 13 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR7_1_186_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9837 | 20 | 190 | 1.10.340.30 |
| af_P05100_1_187_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9803 | 13 | 190 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9732 | 13 | 193 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9475 | 13 | 193 | 1.10.340.30 |
| af_A0A1D6E6V3_212_372_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9414 | 36 | 192 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F5ANT2-F1-model_v4 | DNA-3-methyladenine glycosylase | 0.9992 | 25 | 192 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A7X7PQJ5-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9983 | 11 | 197 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A2V9PNG7-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9982 | 27 | 166 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A7V1PWT8-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9974 | 13 | 170 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A357VPW6-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9972 | 39 | 196 |
GO:0006284
GO:0008725 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar