F375276

General Info

Members Datasets Scaffolds Average Seq Length
268 192 268 195

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100794219|Ga0070690_1007942191
Length 208
Sequence MTRPAIGTPTPKRCAWSGGSPEYIRYHDEEWGVPVHDDRTLFEFLILEGAQAGLSWSTILNKRAGYRKAFVDFDAERVARFTTRQISALLDNEGIVRNRLKIESTVRNARAFLEIRDQIGSFDTYIWRFVDGAPIQNAWRSGEVPAQTAESDAMSKDLKKRGFNFVGSTICYAFMQAVGMVNDHLVDCFRWRELSATPPPRRTKKATR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.1
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10189211 3300003323 Bacteria 8347
2 Ga0065707_10049920 3300005295 Bacteria 868
3 Ga0070683_100000382 3300005329 Bacteria 30781
4 Ga0070690_100794219 3300005330 Bacteria 734
5 Ga0070670_100240337 3300005331 Bacteria 1577
6 Ga0070670_100595448 3300005331 Bacteria 989
7 Ga0068869_100041656 3300005334 Bacteria 3289
8 Ga0070660_100074656 3300005339 Bacteria 2653
9 Ga0070660_100114925 3300005339 Bacteria 2145
10 Ga0070689_100135765 3300005340 Bacteria 1975
11 Ga0070689_100158994 3300005340 Bacteria 1825
12 Ga0070691_10312522 3300005341 Bacteria 862
13 Ga0070661_100569543 3300005344 Bacteria 913
14 Ga0070668_100294573 3300005347 Bacteria 1359
15 Ga0070669_100606005 3300005353 Bacteria 918
16 Ga0070675_100070841 3300005354 Bacteria 2891
17 Ga0070675_100178213 3300005354 Bacteria 1836
18 Ga0070675_100528030 3300005354 Bacteria 1065
19 Ga0070671_100072444 3300005355 Bacteria 2877
20 Ga0070671_100110742 3300005355 Bacteria 2306
21 Ga0070671_100224278 3300005355 Bacteria 1595
22 Ga0070673_100327983 3300005364 Bacteria 1353
23 Ga0070688_100176315 3300005365 Unclassified 1479
24 Ga0070688_100255889 3300005365 Bacteria 1248
25 Ga0070688_100842688 3300005365 Bacteria 720
26 Ga0070659_100362665 3300005366 Bacteria 1218
27 Ga0070709_10242978 3300005434 Bacteria 1293
28 Ga0070713_100082554 3300005436 Bacteria 2745
29 Ga0070694_100389945 3300005444 Bacteria 1088
30 Ga0070708_100497492 3300005445 Bacteria 1150
31 Ga0070678_100051808 3300005456 Bacteria 2977
32 Ga0068867_100191447 3300005459 Bacteria 1632
33 Ga0068867_100418632 3300005459 Bacteria 1134
34 Ga0070706_100726083 3300005467 Bacteria 921
35 Ga0070707_100006513 3300005468 Bacteria 10844
36 Ga0070707_100217730 3300005468 Bacteria 1860
37 Ga0070679_100015170 3300005530 Bacteria 7404
38 Ga0070684_100009496 3300005535 Bacteria 7663
39 Ga0070697_100036272 3300005536 Bacteria 3982
40 Ga0070696_100741040 3300005546 Bacteria 804
41 Ga0070693_100148637 3300005547 Bacteria 1482
42 Ga0070665_100287186 3300005548 Bacteria 1647
43 Ga0070704_100245801 3300005549 Bacteria 1467
44 Ga0070704_100561141 3300005549 Bacteria 999
45 Ga0070704_100694404 3300005549 Bacteria 902
46 Ga0070664_100048295 3300005564 Bacteria 3596
47 Ga0070664_100561347 3300005564 Bacteria 1056
48 Ga0068852_100005499 3300005616 Bacteria 9075
49 Ga0068852_100890964 3300005616 Bacteria 906
50 Ga0068859_100028533 3300005617 Bacteria 5596
51 Ga0068859_101478201 3300005617 Bacteria 750
52 Ga0068866_10090699 3300005718 Bacteria 1664
53 Ga0068861_100225832 3300005719 Bacteria 1585
54 Ga0068863_100104171 3300005841 Bacteria 2699
55 Ga0068858_100093081 3300005842 Bacteria 2806
56 Ga0068858_100362222 3300005842 Bacteria 1390
57 Ga0070717_10000436 3300006028 Bacteria 26575
58 Ga0070716_100059575 3300006173 Bacteria 2202
59 Ga0070716_100481995 3300006173 Bacteria 911
60 Ga0070712_100010204 3300006175 Bacteria 5921
61 Ga0097621_100037273 3300006237 Bacteria 3894
62 Ga0097621_100080936 3300006237 Bacteria 2702
63 Ga0068871_100020067 3300006358 Bacteria 5115
64 Ga0068871_100624108 3300006358 Bacteria 982
65 Ga0075428_100007567 3300006844 Bacteria 12034
66 Ga0075433_10232550 3300006852 Bacteria 1637
67 Ga0075433_10298953 3300006852 Bacteria 1425
68 Ga0075434_100319502 3300006871 Bacteria 1573
69 Ga0075429_100316585 3300006880 Bacteria 1366
70 Ga0068865_100658620 3300006881 Bacteria 891
71 Ga0075436_100116430 3300006914 Bacteria 1868
72 Ga0075436_100273587 3300006914 Bacteria 1206
73 Ga0075436_100577342 3300006914 Bacteria 827
74 Ga0097620_100028534 3300006931 Bacteria 5596
75 Ga0097620_101478124 3300006931 Bacteria 750
76 Ga0075435_100232502 3300007076 Bacteria 1566
77 Ga0111539_10196992 3300009094 Bacteria 2349
78 Ga0105245_10282574 3300009098 Bacteria 1623
79 Ga0105245_10849510 3300009098 Bacteria 953
80 Ga0105247_10528508 3300009101 Bacteria 864
81 Ga0114129_10004890 3300009147 Bacteria 18909
82 Ga0114129_11070836 3300009147 Bacteria 1011
83 Ga0105241_10015774 3300009174 Bacteria 5534
84 Ga0105242_10135317 3300009176 Bacteria 2132
85 Ga0105242_10320742 3300009176 Bacteria 1421
86 Ga0105248_10014635 3300009177 Bacteria 8631
87 Ga0105248_10159108 3300009177 Bacteria 2548
88 Ga0105248_10720122 3300009177 Bacteria 1126
89 Ga0157373_10038085 3300013100 Bacteria 3447
90 Ga0157370_10094034 3300013104 Bacteria 2813
91 Ga0157370_11036875 3300013104 Bacteria 742
92 Ga0157369_10183287 3300013105 Bacteria 2202
93 Ga0157378_10621989 3300013297 Bacteria 1093
94 Ga0157378_11063189 3300013297 Bacteria 845
95 Ga0157378_11634795 3300013297 Bacteria 690
96 Ga0163162_10022972 3300013306 Bacteria 6151
97 Ga0163162_10629688 3300013306 Bacteria 1197
98 Ga0157372_10091430 3300013307 Bacteria 3461
99 Ga0157372_10139874 3300013307 Bacteria 2788
100 Ga0157375_10370080 3300013308 Bacteria 1599
101 Ga0163163_10455080 3300014325 Bacteria 1340
102 Ga0157379_10171487 3300014968 Bacteria 1959
103 Ga0157379_10268012 3300014968 Unclassified 1552
104 Ga0163161_10050645 3300017792 Bacteria 3006
105 Ga0207642_10036751 3300025899 Bacteria 2105
106 Ga0207647_10449060 3300025904 Bacteria 723
107 Ga0207699_10122849 3300025906 Bacteria 1682
108 Ga0207643_10051821 3300025908 Bacteria 2330
109 Ga0207693_10019593 3300025915 Bacteria 5379
110 Ga0207662_10101965 3300025918 Bacteria 1779
111 Ga0207649_10586281 3300025920 Bacteria 856
112 Ga0207652_10045157 3300025921 Bacteria 3755
113 Ga0207646_10000540 3300025922 Bacteria 50029
114 Ga0207646_10000548 3300025922 Bacteria 49427
115 Ga0207646_10217091 3300025922 Bacteria 1728
116 Ga0207681_10685265 3300025923 Bacteria 851
117 Ga0207659_10070619 3300025926 Bacteria 2547
118 Ga0207659_10198266 3300025926 Bacteria 1601
119 Ga0207687_10126861 3300025927 Bacteria 1917
120 Ga0207700_10763823 3300025928 Bacteria 864
121 Ga0207644_10001551 3300025931 Bacteria 14827
122 Ga0207706_10228707 3300025933 Bacteria 1628
123 Ga0207706_10929441 3300025933 Bacteria 734
124 Ga0207670_10806097 3300025936 Bacteria 782
125 Ga0207665_10207028 3300025939 Bacteria 1431
126 Ga0207691_10003793 3300025940 Bacteria 14668
127 Ga0207711_10005309 3300025941 Bacteria 10925
128 Ga0207711_10558593 3300025941 Bacteria 1068
129 Ga0207689_10028715 3300025942 Bacteria 4651
130 Ga0207661_10045822 3300025944 Bacteria 3464
131 Ga0207679_10527511 3300025945 Bacteria 1057
132 Ga0207651_10067403 3300025960 Bacteria 2519
133 Ga0207677_10244897 3300026023 Bacteria 1452
134 Ga0207677_10360652 3300026023 Bacteria 1221
135 Ga0207703_10073148 3300026035 Unclassified 2835
136 Ga0207641_10105079 3300026088 Bacteria 2494
137 Ga0207641_10998377 3300026088 Bacteria 834
138 Ga0207648_10034437 3300026089 Bacteria 4464
139 Ga0207675_100060826 3300026118 Bacteria 3526
140 Ga0207683_10029389 3300026121 Bacteria 4759
141 Ga0207683_10414699 3300026121 Bacteria 1240
142 Ga0207683_10868882 3300026121 Bacteria 837
143 Ga0207698_10008290 3300026142 Bacteria 6563
144 Ga0209969_1017318 3300027360 Bacteria 1060
145 Ga0209999_1021437 3300027543 Bacteria 1186
146 Ga0210002_1002279 3300027617 Bacteria 2773
147 Ga0209983_1004861 3300027665 Bacteria 2805
148 Ga0209966_1038189 3300027695 Bacteria 993
149 Ga0209998_10005096 3300027717 Bacteria 2759
150 Ga0209974_10000142 3300027876 Bacteria 21532
151 Ga0268264_10145395 3300028381 Bacteria 2119
152 Ga0268264_10233160 3300028381 Bacteria 1701
153 Ga0265326_10025018 3300028558 Archaea 1703
154 Ga0265338_10054501 3300028800 Bacteria 3565
155 Ga0265332_10060580 3300031238 Bacteria 1619
156 Ga0265339_10005519 3300031249 Bacteria 8421
157 Ga0265331_10005600 3300031250 Bacteria 7558
158 Ga0307408_100263636 3300031548 Bacteria 1427
159 Ga0265342_10267767 3300031712 Bacteria 907
160 Ga0307405_10088745 3300031731 Bacteria 2041
161 Ga0307410_11048801 3300031852 Bacteria 705
162 Ga0307409_100981893 3300031995 Bacteria 862
163 Ga0373953_0111538 3300035117 Bacteria 1157
164 Ga0373956_0203018 3300035119 Bacteria 940
165 Ga0373955_0041859 3300035172 Bacteria 2458
166 Ga0373955_0238629 3300035172 Bacteria 1089
167 Ga0373961_0123274 3300035241 Bacteria 861
168 Ga0316574_0077932 3300035398 Bacteria 2101
169 Ga0316574_0321164 3300035398 Bacteria 983
170 Ga0373933_0152790 3300035724 Bacteria 1463
171 Ga0373937_0087731 3300036401 Bacteria 2880
172 Ga0373937_1097684 3300036401 Bacteria 744
173 Ga0373925_0312554 3300037068 Bacteria 1270
174 Ga0395899_0003054 3300037312 Bacteria 13365
175 Ga0395899_0127325 3300037312 Bacteria 1820
176 Ga0395900_0040956 3300037418 Bacteria 4775
177 Ga0395900_0060639 3300037418 Bacteria 3892
178 Ga0395900_1157929 3300037418 Bacteria 689
179 Ga0395898_0042878 3300037466 Bacteria 4461
180 Ga0395898_0070998 3300037466 Bacteria 3365
181 Ga0395905_0017785 3300037471 Bacteria 6752
182 Ga0395905_0018349 3300037471 Bacteria 6640
183 Ga0395905_0210744 3300037471 Bacteria 1820
184 Ga0395905_0333357 3300037471 Bacteria 1408
185 Ga0395905_1234100 3300037471 Bacteria 651
186 Ga0395901_0014222 3300038443 Bacteria 8102
187 Ga0395901_0083209 3300038443 Bacteria 3345
188 Ga0395901_0151517 3300038443 Bacteria 2436
189 Ga0436365_1364049 3300039437 Bacteria 624
190 Ga0436365_1718584 3300039437 Bacteria 1442
191 Ga0451797_1078276 3300041453 Bacteria 731
192 Ga0439441_082868 3300042001 Bacteria 701
193 Ga0451577_0124624 3300042876 Bacteria 2309
194 Ga0453683_0029331 3300044673 Bacteria 3479
195 Ga0466963_0007746 3300044694 Bacteria 6419
196 Ga0453684_2038081 3300044712 Bacteria 577
197 Ga0451576_0382605 3300045051 Unclassified 1475
198 Ga0451576_0594041 3300045051 Bacteria 1163
199 Ga0466967_0026899 3300045976 Bacteria 4775
200 Ga0495592_0101204 3300046454 Bacteria 2053
201 Ga0495605_0244682 3300046474 Bacteria 769
202 Ga0495594_0299173 3300046499 Bacteria 917
203 Ga0495630_0612826 3300046517 Bacteria 834
204 Ga0495665_0085995 3300046531 Bacteria 1653
205 Ga0495586_0274045 3300046535 Bacteria 965
206 Ga0495586_0321666 3300046535 Bacteria 887
207 Ga0495633_0059428 3300046558 Bacteria 1793
208 Ga0495599_0091223 3300046678 Bacteria 1901
209 Ga0495599_0280081 3300046678 Bacteria 1010
210 Ga0495658_0039427 3300046683 Bacteria 2621
211 Ga0495658_0072603 3300046683 Bacteria 2002
212 Ga0495658_0126512 3300046683 Bacteria 1551
213 Ga0495658_0365119 3300046683 Bacteria 918
214 Ga0495669_0452658 3300046684 Bacteria 623
215 Ga0495613_0056524 3300046689 Bacteria 2881
216 Ga0495604_0651372 3300047317 Bacteria 672
217 Ga0495674_0046840 3300047319 Bacteria 3837
218 Ga0495674_0235825 3300047319 Bacteria 1509
219 Ga0495674_0430233 3300047319 Bacteria 1062
220 Ga0495675_0177680 3300047444 Bacteria 1305
221 Ga0495677_0308964 3300047445 Bacteria 622
222 Ga0495684_0335654 3300047471 Bacteria 1077
223 Ga0496100_0093314 3300048903 Bacteria 2059
224 Ga0496100_0327723 3300048903 Bacteria 1152
225 Ga0496102_0164735 3300048905 Bacteria 2086
226 Ga0496102_0169497 3300048905 Bacteria 2055
227 Ga0496103_0152962 3300048906 Bacteria 1478
228 Ga0496104_0010128 3300048907 Bacteria 8418
229 Ga0496106_0195978 3300048909 Bacteria 1607
230 Ga0496106_0253847 3300048909 Bacteria 1406
231 Ga0496107_0043147 3300048910 Bacteria 3240
232 Ga0496114_0000328 3300048917 Bacteria 34453
233 Ga0501032_0026990 3300049569 Bacteria 3948
234 Ga0501034_0001601 3300049571 Bacteria 29434
235 Ga0501036_0028518 3300049572 Bacteria 4717
236 Ga0501037_0008355 3300049573 Bacteria 7588
237 Ga0501039_0023982 3300049575 Bacteria 4685
238 Ga0501043_0112901 3300049579 Bacteria 2134
239 Ga0501046_0011740 3300049580 Bacteria 7479
240 Ga0501071_0020175 3300049587 Bacteria 4630
241 Ga0501071_0350149 3300049587 Bacteria 1124
242 Ga0501074_0058737 3300049590 Bacteria 2771
243 Ga0501075_0004808 3300049591 Bacteria 9188
244 Ga0501076_0106105 3300049592 Bacteria 2267
245 Ga0501077_0004391 3300049593 Bacteria 8551
246 Ga0501223_081190 3300049663 Unclassified 649
247 Ga0501079_0603139 3300049741 Bacteria 864
248 Ga0501080_0090950 3300049742 Bacteria 2834
249 Ga0501081_0065768 3300049743 Bacteria 2520
250 Ga0501083_0260020 3300049744 Bacteria 1129
251 Ga0501264_018265 3300049761 Bacteria 726
252 Ga0501035_0693215 3300049822 Bacteria 822
253 Ga0501045_0016144 3300049824 Bacteria 5299
254 nmdc:mga05p37_7283_c1 3300050507 Bacteria 13053
255 nmdc:mga05p37_891059_c1 3300050507 Bacteria 961
256 nmdc:mga09592_32983_c1 3300050508 Bacteria 4319
257 nmdc:mga08y16_141332_c1 3300050511 Bacteria 2503
258 nmdc:mga08y16_432264_c1 3300050511 Bacteria 1344
259 nmdc:mga0n895_778567_c1 3300050512 Unclassified 948
260 nmdc:mga0rr50_1087940_c1 3300050513 Bacteria 680
261 nmdc:mga0rr50_97478_c1 3300050513 Bacteria 2303
262 nmdc:mga08x19_189762_c1 3300050514 Bacteria 1406
263 nmdc:mga0a205_71859_c2 3300050515 Bacteria 1650
264 nmdc:mga0a205_7352_c1 3300050515 Bacteria 9974
265 nmdc:mga0a205_789194_c1 3300050515 Unclassified 798
266 Ga0495655_0005334 3300053083 Bacteria 2266
267 Ga0590077_004545 3300059426 Bacteria 2844
268 Ga0530510_0007458 3300061734 Bacteria 7617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_778567_c1 nmdc:mga0n895_778567_c1_23_565 166
2 3300009177 Ga0105248_10720122 Ga0105248_107201222 167
3 3300025906 Ga0207699_10122849 Ga0207699_101228492 170
4 3300005547 Ga0070693_100148637 Ga0070693_1001486372 171
5 3300005549 Ga0070704_100694404 Ga0070704_1006944041 171
6 3300005617 Ga0068859_101478201 Ga0068859_1014782012 171
7 3300005842 Ga0068858_100093081 Ga0068858_1000930813 171
8 3300006931 Ga0097620_101478124 Ga0097620_1014781241 171
9 3300009101 Ga0105247_10528508 Ga0105247_105285081 171
10 3300025918 Ga0207662_10101965 Ga0207662_101019652 171
11 3300026035 Ga0207703_10073148 Ga0207703_100731483 171
12 3300028381 Ga0268264_10233160 Ga0268264_102331602 171
13 3300005331 Ga0070670_100595448 Ga0070670_1005954481 172
14 3300049663 Ga0501223_081190 Ga0501223_081190_71_631 174
15 3300028558 Ga0265326_10025018 Ga0265326_100250181 176
16 3300042876 Ga0451577_0124624 Ga0451577_0124624_20_553 176
17 3300006871 Ga0075434_100319502 Ga0075434_1003195023 177
18 3300037418 Ga0395900_1157929 Ga0395900_1157929_33_566 177
19 3300044673 Ga0453683_0029331 Ga0453683_0029331_2148_2684 177
20 3300013297 Ga0157378_10621989 Ga0157378_106219892 178
21 3300013297 Ga0157378_11634795 Ga0157378_116347951 178
22 3300046684 Ga0495669_0452658 Ga0495669_0452658_70_606 178
23 3300047445 Ga0495677_0308964 Ga0495677_0308964_45_581 178
24 3300048905 Ga0496102_0169497 Ga0496102_0169497_1311_1847 178
25 3300048906 Ga0496103_0152962 Ga0496103_0152962_285_821 178
26 3300006852 Ga0075433_10232550 Ga0075433_102325502 179
27 3300050515 nmdc:mga0a205_71859_c2 nmdc:mga0a205_71859_c2_129_680 179
28 3300007076 Ga0075435_100232502 Ga0075435_1002325023 180
29 3300005341 Ga0070691_10312522 Ga0070691_103125221 181
30 3300044712 Ga0453684_2038081 Ga0453684_2038081_11_556 181
31 3300047317 Ga0495604_0651372 Ga0495604_0651372_51_596 181
32 3300005445 Ga0070708_100497492 Ga0070708_1004974921 182
33 3300039437 Ga0436365_1364049 Ga0436365_1364049_27_575 182
34 3300037312 Ga0395899_0127325 Ga0395899_0127325_935_1489 183
35 3300037418 Ga0395900_0060639 Ga0395900_0060639_1908_2462 183
36 3300037466 Ga0395898_0042878 Ga0395898_0042878_3199_3753 183
37 3300037471 Ga0395905_0210744 Ga0395905_0210744_332_886 183
38 3300038443 Ga0395901_0151517 Ga0395901_0151517_1431_1985 183
39 3300044694 Ga0466963_0007746 Ga0466963_0007746_1665_2219 183
40 3300005468 Ga0070707_100217730 Ga0070707_1002177302 184
41 3300025922 Ga0207646_10217091 Ga0207646_102170912 184
42 3300031852 Ga0307410_11048801 Ga0307410_110488012 184
43 3300036401 Ga0373937_0087731 Ga0373937_0087731_233_793 185
44 3300050511 nmdc:mga08y16_432264_c1 nmdc:mga08y16_432264_c1_103_660 185
45 3300031238 Ga0265332_10060580 Ga0265332_100605802 186
46 3300031249 Ga0265339_10005519 Ga0265339_100055193 186
47 3300031250 Ga0265331_10005600 Ga0265331_100056005 186
48 3300031712 Ga0265342_10267767 Ga0265342_102677671 186
49 3300049569 Ga0501032_0026990 Ga0501032_0026990_1868_2431 186
50 3300005355 Ga0070671_100072444 Ga0070671_1000724444 187
51 3300005436 Ga0070713_100082554 Ga0070713_1000825542 187
52 3300006028 Ga0070717_10000436 Ga0070717_1000043610 187
53 3300025928 Ga0207700_10763823 Ga0207700_107638232 187
54 3300025931 Ga0207644_10001551 Ga0207644_1000155110 187
55 3300026121 Ga0207683_10868882 Ga0207683_108688821 187
56 3300035398 Ga0316574_0321164 Ga0316574_0321164_162_725 187
57 3300048903 Ga0496100_0327723 Ga0496100_0327723_161_727 187
58 3300005340 Ga0070689_100158994 Ga0070689_1001589942 188
59 3300005344 Ga0070661_100569543 Ga0070661_1005695431 188
60 3300005347 Ga0070668_100294573 Ga0070668_1002945732 188
61 3300005353 Ga0070669_100606005 Ga0070669_1006060051 188
62 3300005354 Ga0070675_100528030 Ga0070675_1005280302 188
63 3300005355 Ga0070671_100110742 Ga0070671_1001107423 188
64 3300005364 Ga0070673_100327983 Ga0070673_1003279832 188
65 3300005365 Ga0070688_100255889 Ga0070688_1002558892 188
66 3300005549 Ga0070704_100561141 Ga0070704_1005611411 188
67 3300005564 Ga0070664_100048295 Ga0070664_1000482952 188
68 3300006880 Ga0075429_100316585 Ga0075429_1003165852 188
69 3300025908 Ga0207643_10051821 Ga0207643_100518212 188
70 3300025923 Ga0207681_10685265 Ga0207681_106852652 188
71 3300025926 Ga0207659_10198266 Ga0207659_101982661 188
72 3300025960 Ga0207651_10067403 Ga0207651_100674032 188
73 3300026121 Ga0207683_10414699 Ga0207683_104146992 188
74 3300035241 Ga0373961_0123274 Ga0373961_0123274_30_596 188
75 3300037312 Ga0395899_0003054 Ga0395899_0003054_1793_2362 188
76 3300037418 Ga0395900_0040956 Ga0395900_0040956_3734_4303 188
77 3300037466 Ga0395898_0070998 Ga0395898_0070998_284_853 188
78 3300037471 Ga0395905_0018349 Ga0395905_0018349_380_949 188
79 3300038443 Ga0395901_0014222 Ga0395901_0014222_1597_2166 188
80 3300045976 Ga0466967_0026899 Ga0466967_0026899_1610_2179 188
81 3300046499 Ga0495594_0299173 Ga0495594_0299173_333_899 188
82 3300005467 Ga0070706_100726083 Ga0070706_1007260831 189
83 3300025904 Ga0207647_10449060 Ga0207647_104490602 189
84 3300031548 Ga0307408_100263636 Ga0307408_1002636362 189
85 3300037471 Ga0395905_0017785 Ga0395905_0017785_66_638 189
86 3300037471 Ga0395905_0333357 Ga0395905_0333357_82_654 189
87 3300037471 Ga0395905_1234100 Ga0395905_1234100_63_635 189
88 3300038443 Ga0395901_0083209 Ga0395901_0083209_922_1494 189
89 3300005339 Ga0070660_100114925 Ga0070660_1001149252 190
90 3300005366 Ga0070659_100362665 Ga0070659_1003626652 190
91 3300005468 Ga0070707_100006513 Ga0070707_1000065137 190
92 3300005536 Ga0070697_100036272 Ga0070697_1000362724 190
93 3300005616 Ga0068852_100890964 Ga0068852_1008909642 190
94 3300013104 Ga0157370_11036875 Ga0157370_110368751 190
95 3300025920 Ga0207649_10586281 Ga0207649_105862812 190
96 3300031731 Ga0307405_10088745 Ga0307405_100887453 190
97 3300035398 Ga0316574_0077932 Ga0316574_0077932_915_1487 190
98 3300049587 Ga0501071_0350149 Ga0501071_0350149_278_853 190
99 3300009098 Ga0105245_10849510 Ga0105245_108495101 191
100 3300025922 Ga0207646_10000540 Ga0207646_1000054015 191
101 3300025922 Ga0207646_10000548 Ga0207646_1000054818 191
102 3300028800 Ga0265338_10054501 Ga0265338_100545011 191
103 3300045051 Ga0451576_0594041 Ga0451576_0594041_268_846 191
104 3300049741 Ga0501079_0603139 Ga0501079_0603139_190_768 191
105 3300005339 Ga0070660_100074656 Ga0070660_1000746564 192
106 3300005355 Ga0070671_100224278 Ga0070671_1002242783 192
107 3300005365 Ga0070688_100176315 Ga0070688_1001763152 192
108 3300005444 Ga0070694_100389945 Ga0070694_1003899452 192
109 3300005459 Ga0068867_100418632 Ga0068867_1004186322 192
110 3300006173 Ga0070716_100481995 Ga0070716_1004819952 192
111 3300013308 Ga0157375_10370080 Ga0157375_103700802 192
112 3300026023 Ga0207677_10360652 Ga0207677_103606522 192
113 3300027695 Ga0209966_1038189 Ga0209966_10381892 192
114 3300005295 Ga0065707_10049920 Ga0065707_100499201 193
115 3300005329 Ga0070683_100000382 Ga0070683_10000038211 193
116 3300005456 Ga0070678_100051808 Ga0070678_1000518082 193
117 3300005535 Ga0070684_100009496 Ga0070684_1000094969 193
118 3300005549 Ga0070704_100245801 Ga0070704_1002458012 193
119 3300005564 Ga0070664_100561347 Ga0070664_1005613472 193
120 3300005616 Ga0068852_100005499 Ga0068852_1000054998 193
121 3300006175 Ga0070712_100010204 Ga0070712_1000102046 193
122 3300009174 Ga0105241_10015774 Ga0105241_100157746 193
123 3300013307 Ga0157372_10139874 Ga0157372_101398744 193
124 3300014968 Ga0157379_10268012 Ga0157379_102680123 193
125 3300025915 Ga0207693_10019593 Ga0207693_100195936 193
126 3300025944 Ga0207661_10045822 Ga0207661_100458222 193
127 3300025945 Ga0207679_10527511 Ga0207679_105275112 193
128 3300026121 Ga0207683_10029389 Ga0207683_100293893 193
129 3300026142 Ga0207698_10008290 Ga0207698_100082909 193
130 3300035119 Ga0373956_0203018 Ga0373956_0203018_131_712 193
131 3300035172 Ga0373955_0041859 Ga0373955_0041859_555_1136 193
132 3300036401 Ga0373937_1097684 Ga0373937_1097684_53_634 193
133 3300042001 Ga0439441_082868 Ga0439441_082868_10_591 193
134 3300045051 Ga0451576_0382605 Ga0451576_0382605_797_1378 193
135 3300046454 Ga0495592_0101204 Ga0495592_0101204_1076_1657 193
136 3300046474 Ga0495605_0244682 Ga0495605_0244682_168_752 193
137 3300046517 Ga0495630_0612826 Ga0495630_0612826_187_768 193
138 3300046535 Ga0495586_0274045 Ga0495586_0274045_56_637 193
139 3300046535 Ga0495586_0321666 Ga0495586_0321666_154_735 193
140 3300046678 Ga0495599_0091223 Ga0495599_0091223_1291_1872 193
141 3300046678 Ga0495599_0280081 Ga0495599_0280081_197_778 193
142 3300046683 Ga0495658_0365119 Ga0495658_0365119_53_634 193
143 3300046689 Ga0495613_0056524 Ga0495613_0056524_1091_1672 193
144 3300047319 Ga0495674_0235825 Ga0495674_0235825_740_1321 193
145 3300047319 Ga0495674_0430233 Ga0495674_0430233_397_978 193
146 3300047444 Ga0495675_0177680 Ga0495675_0177680_77_658 193
147 3300049571 Ga0501034_0001601 Ga0501034_0001601_135_716 193
148 3300053083 Ga0495655_0005334 Ga0495655_0005334_424_1008 193
149 3300059426 Ga0590077_004545 Ga0590077_004545_1256_1840 193
150 3300006914 Ga0075436_100116430 Ga0075436_1001164303 194
151 3300025941 Ga0207711_10558593 Ga0207711_105585931 194
152 3300035117 Ga0373953_0111538 Ga0373953_0111538_181_765 194
153 3300035172 Ga0373955_0238629 Ga0373955_0238629_325_909 194
154 3300035724 Ga0373933_0152790 Ga0373933_0152790_94_678 194
155 3300041453 Ga0451797_1078276 Ga0451797_1078276_64_675 194
156 3300046531 Ga0495665_0085995 Ga0495665_0085995_58_642 194
157 3300046558 Ga0495633_0059428 Ga0495633_0059428_551_1135 194
158 3300047471 Ga0495684_0335654 Ga0495684_0335654_23_607 194
159 3300050513 nmdc:mga0rr50_1087940_c1 nmdc:mga0rr50_1087940_c1_11_598 194
160 3300006914 Ga0075436_100577342 Ga0075436_1005773422 195
161 3300025933 Ga0207706_10228707 Ga0207706_102287072 195
162 3300039437 Ga0436365_1718584 Ga0436365_1718584_91_678 195
163 3300005365 Ga0070688_100842688 Ga0070688_1008426881 196
164 3300005842 Ga0068858_100362222 Ga0068858_1003622222 196
165 3300009094 Ga0111539_10196992 Ga0111539_101969922 196
166 3300009147 Ga0114129_11070836 Ga0114129_110708362 196
167 3300009177 Ga0105248_10159108 Ga0105248_101591083 196
168 3300025936 Ga0207670_10806097 Ga0207670_108060971 196
169 3300027360 Ga0209969_1017318 Ga0209969_10173181 196
170 3300027543 Ga0209999_1021437 Ga0209999_10214371 196
171 3300027617 Ga0210002_1002279 Ga0210002_10022793 196
172 3300027665 Ga0209983_1004861 Ga0209983_10048614 196
173 3300027717 Ga0209998_10005096 Ga0209998_100050963 196
174 3300027876 Ga0209974_10000142 Ga0209974_1000014216 196
175 3300048909 Ga0496106_0195978 Ga0496106_0195978_467_1060 196
176 3300050515 nmdc:mga0a205_789194_c1 nmdc:mga0a205_789194_c1_105_698 196
177 3300046683 Ga0495658_0072603 Ga0495658_0072603_823_1416 197
178 3300050513 nmdc:mga0rr50_97478_c1 nmdc:mga0rr50_97478_c1_303_899 197
179 3300006173 Ga0070716_100059575 Ga0070716_1000595753 198
180 3300006358 Ga0068871_100624108 Ga0068871_1006241081 198
181 3300006844 Ga0075428_100007567 Ga0075428_10000756711 198
182 3300006852 Ga0075433_10298953 Ga0075433_102989532 198
183 3300006914 Ga0075436_100273587 Ga0075436_1002735871 198
184 3300009147 Ga0114129_10004890 Ga0114129_1000489016 198
185 3300013306 Ga0163162_10629688 Ga0163162_106296881 198
186 3300025933 Ga0207706_10929441 Ga0207706_109294412 198
187 3300025939 Ga0207665_10207028 Ga0207665_102070281 198
188 3300050507 nmdc:mga05p37_7283_c1 nmdc:mga05p37_7283_c1_11765_12367 198
189 3300050514 nmdc:mga08x19_189762_c1 nmdc:mga08x19_189762_c1_127_726 198
190 3300050515 nmdc:mga0a205_7352_c1 nmdc:mga0a205_7352_c1_627_1229 198
191 3300046683 Ga0495658_0126512 Ga0495658_0126512_519_1121 199
192 3300050511 nmdc:mga08y16_141332_c1 nmdc:mga08y16_141332_c1_1606_2232 199
193 3300031995 Ga0307409_100981893 Ga0307409_1009818931 200
194 3300047319 Ga0495674_0046840 Ga0495674_0046840_2275_2898 200
195 3300049572 Ga0501036_0028518 Ga0501036_0028518_638_1246 200
196 3300049573 Ga0501037_0008355 Ga0501037_0008355_4940_5554 200
197 3300049575 Ga0501039_0023982 Ga0501039_0023982_984_1592 200
198 3300049579 Ga0501043_0112901 Ga0501043_0112901_771_1379 200
199 3300049580 Ga0501046_0011740 Ga0501046_0011740_3423_4031 200
200 3300049587 Ga0501071_0020175 Ga0501071_0020175_333_941 200
201 3300049590 Ga0501074_0058737 Ga0501074_0058737_1931_2539 200
202 3300049591 Ga0501075_0004808 Ga0501075_0004808_5478_6086 200
203 3300049592 Ga0501076_0106105 Ga0501076_0106105_585_1193 200
204 3300049593 Ga0501077_0004391 Ga0501077_0004391_6655_7263 200
205 3300049742 Ga0501080_0090950 Ga0501080_0090950_399_1007 200
206 3300049743 Ga0501081_0065768 Ga0501081_0065768_170_778 200
207 3300049822 Ga0501035_0693215 Ga0501035_0693215_170_778 200
208 3300049824 Ga0501045_0016144 Ga0501045_0016144_3174_3782 200
209 3300050508 nmdc:mga09592_32983_c1 nmdc:mga09592_32983_c1_563_1195 200
210 3300061734 Ga0530510_0007458 Ga0530510_0007458_1579_2187 200
211 3300049744 Ga0501083_0260020 Ga0501083_0260020_77_682 201
212 3300050507 nmdc:mga05p37_891059_c1 nmdc:mga05p37_891059_c1_179_823 201
213 3300005354 Ga0070675_100178213 Ga0070675_1001782133 202
214 3300005434 Ga0070709_10242978 Ga0070709_102429782 202
215 3300005530 Ga0070679_100015170 Ga0070679_1000151708 202
216 3300006237 Ga0097621_100037273 Ga0097621_1000372735 202
217 3300009176 Ga0105242_10135317 Ga0105242_101353172 202
218 3300013100 Ga0157373_10038085 Ga0157373_100380851 202
219 3300013104 Ga0157370_10094034 Ga0157370_100940345 202
220 3300013105 Ga0157369_10183287 Ga0157369_101832874 202
221 3300013307 Ga0157372_10091430 Ga0157372_100914304 202
222 3300017792 Ga0163161_10050645 Ga0163161_100506453 202
223 3300025921 Ga0207652_10045157 Ga0207652_100451572 202
224 3300048903 Ga0496100_0093314 Ga0496100_0093314_575_1186 202
225 3300048905 Ga0496102_0164735 Ga0496102_0164735_1061_1672 202
226 3300048907 Ga0496104_0010128 Ga0496104_0010128_1243_1854 202
227 3300048909 Ga0496106_0253847 Ga0496106_0253847_287_898 202
228 3300048910 Ga0496107_0043147 Ga0496107_0043147_2180_2791 202
229 3300048917 Ga0496114_0000328 Ga0496114_0000328_13191_13802 202
230 3300049761 Ga0501264_018265 Ga0501264_018265_47_661 202
231 3300005331 Ga0070670_100240337 Ga0070670_1002403372 205
232 3300025940 Ga0207691_10003793 Ga0207691_100037932 205
233 3300026088 Ga0207641_10998377 Ga0207641_109983772 205
234 3300046683 Ga0495658_0039427 Ga0495658_0039427_899_1549 205
235 3300005330 Ga0070690_100794219 Ga0070690_1007942191 207
236 3300005334 Ga0068869_100041656 Ga0068869_1000416564 207
237 3300005340 Ga0070689_100135765 Ga0070689_1001357652 207
238 3300005354 Ga0070675_100070841 Ga0070675_1000708413 207
239 3300005459 Ga0068867_100191447 Ga0068867_1001914472 207
240 3300005546 Ga0070696_100741040 Ga0070696_1007410401 207
241 3300005548 Ga0070665_100287186 Ga0070665_1002871862 207
242 3300005617 Ga0068859_100028533 Ga0068859_1000285335 207
243 3300005718 Ga0068866_10090699 Ga0068866_100906993 207
244 3300005719 Ga0068861_100225832 Ga0068861_1002258323 207
245 3300005841 Ga0068863_100104171 Ga0068863_1001041712 207
246 3300006237 Ga0097621_100080936 Ga0097621_1000809364 207
247 3300006358 Ga0068871_100020067 Ga0068871_1000200676 207
248 3300006881 Ga0068865_100658620 Ga0068865_1006586201 207
249 3300006931 Ga0097620_100028534 Ga0097620_1000285346 207
250 3300009098 Ga0105245_10282574 Ga0105245_102825743 207
251 3300009176 Ga0105242_10320742 Ga0105242_103207422 207
252 3300009177 Ga0105248_10014635 Ga0105248_100146355 207
253 3300013297 Ga0157378_11063189 Ga0157378_110631892 207
254 3300013306 Ga0163162_10022972 Ga0163162_100229725 207
255 3300014325 Ga0163163_10455080 Ga0163163_104550802 207
256 3300014968 Ga0157379_10171487 Ga0157379_101714872 207
257 3300025899 Ga0207642_10036751 Ga0207642_100367512 207
258 3300025926 Ga0207659_10070619 Ga0207659_100706192 207
259 3300025927 Ga0207687_10126861 Ga0207687_101268614 207
260 3300025941 Ga0207711_10005309 Ga0207711_100053095 207
261 3300025942 Ga0207689_10028715 Ga0207689_100287155 207
262 3300026023 Ga0207677_10244897 Ga0207677_102448972 207
263 3300026088 Ga0207641_10105079 Ga0207641_101050794 207
264 3300026089 Ga0207648_10034437 Ga0207648_100344375 207
265 3300026118 Ga0207675_100060826 Ga0207675_1000608263 207
266 3300028381 Ga0268264_10145395 Ga0268264_101453953 207
267 3300037068 Ga0373925_0312554 Ga0373925_0312554_54_680 207
268 3300003323 rootH1_10189211 rootH1_101892118 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

16

191

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.977 14 190
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9752 13 191
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9744 14 190
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.965 14 190
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9543 13 191
ID Description Score Start End Superfamily
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9837 20 190 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9803 13 190 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9732 13 193 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9475 13 193 1.10.340.30
af_A0A1D6E6V3_212_372_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9414 36 192 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A1F5ANT2-F1-model_v4 DNA-3-methyladenine glycosylase 0.9992 25 192 GO:0006284
GO:0008725
GO:0046872
AF-A0A7X7PQJ5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9983 11 197 GO:0006284
GO:0008725
GO:0046872
AF-A0A2V9PNG7-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9982 27 166 GO:0006284
GO:0008725
GO:0046872
AF-A0A7V1PWT8-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9974 13 170 GO:0006284
GO:0008725
GO:0046872
AF-A0A357VPW6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9972 39 196 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.83 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map