F374419

General Info

Members Datasets Scaffolds Average Seq Length
266 214 265 249

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221603|2644028870
Length 294
Sequence VSYTIAALILLSVLMSTLFVVDQRQYAIVFALGEVKKVINEPGLHFKLPPPFQNVLFLDKRILTLDTPEADRFITAEKKNILVDAYIKWRIIEPRLYFVSFTGDERRAQDRMSQIVKAALNEEITKRTVREVISGERGKVMAAIQEKVAAEAKQIGVAIVDVRLKRVDYVEQINNSVYDRMKAERVRVANELRSTGAAESEKIRADADRQRTVILAEAYREAEGIRGDGDAKATQIYGQAFGQNPEFFKFYRSLEAYRSSFKNRSDIMVLDPNSEFFKYFKNTGPGATAAPAKK

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
89 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
90 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
111 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
175 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.01
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0.75
Rhizoplane 2.26
Rhizosphere 86.09
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001362 3300002987 Bacteria 10201
2 JGI25160J50197_1000586 3300003354 Bacteria 20466
3 Ga0007417J51691_1025634 3300003544 Bacteria 7536
4 Ga0007410J51695_1029218 3300003574 Bacteria 8717
5 Ga0007409J51694_1014187 3300003575 Bacteria 16595
6 Ga0007416J51690_1015392 3300003577 Bacteria 16759
7 Ga0032354_1032081 3300003693 Bacteria 10360
8 Ga0055537_1000143 3300003773 Bacteria 53762
9 Ga0055524_1000161 3300003775 Bacteria 77623
10 Ga0055524_1022553 3300003775 Bacteria 2053
11 Ga0055534_1000712 3300003784 Bacteria 16284
12 Ga0055528_1000430 3300003790 Bacteria 33765
13 Ga0065165_1000268 3300005262 Bacteria 89520
14 Ga0070682_100005581 3300005337 Bacteria 7010
15 Ga0070660_100002374 3300005339 Bacteria 12932
16 Ga0070689_100144151 3300005340 Bacteria 1917
17 Ga0070659_100010061 3300005366 Bacteria 6964
18 Ga0070705_100258964 3300005440 Bacteria 1226
19 Ga0070694_100020496 3300005444 Bacteria 4215
20 Ga0070662_100069651 3300005457 Bacteria 2590
21 Ga0068853_100122432 3300005539 Bacteria 2322
22 Ga0070672_100103585 3300005543 Bacteria 2311
23 Ga0070695_100037962 3300005545 Bacteria 3037
24 Ga0070696_100093540 3300005546 Bacteria 2144
25 Ga0070696_100183200 3300005546 Bacteria 1555
26 Ga0070704_100400216 3300005549 Bacteria 1171
27 Ga0068857_100350687 3300005577 Bacteria 1367
28 Ga0068856_100309039 3300005614 Bacteria 1598
29 Ga0070702_100173836 3300005615 Bacteria 1403
30 Ga0068859_100185245 3300005617 Bacteria 2165
31 Ga0068864_100031579 3300005618 Bacteria 4495
32 Ga0068861_100042195 3300005719 Bacteria 3418
33 Ga0068858_100077323 3300005842 Bacteria 3092
34 Ga0070715_10023944 3300006163 Bacteria 2399
35 Ga0075428_100028747 3300006844 Bacteria 6151
36 Ga0075428_100467512 3300006844 Bacteria 1350
37 Ga0075430_100014009 3300006846 Bacteria 6835
38 Ga0075430_100043370 3300006846 Bacteria 3801
39 Ga0075431_100033211 3300006847 Bacteria 5318
40 Ga0075434_100000936 3300006871 Bacteria 23454
41 Ga0068865_100030828 3300006881 Bacteria 3570
42 Ga0075436_100003439 3300006914 Bacteria 10852
43 Ga0097620_100185252 3300006931 Bacteria 2165
44 Ga0099826_10000001 3300006948 Bacteria 1155201
45 Ga0075435_100004702 3300007076 Bacteria 9420
46 Ga0075435_100027839 3300007076 Bacteria 4426
47 Ga0105249_10057644 3300009553 Bacteria 3559
48 Ga0157371_10000001 3300013102 Bacteria 1162285
49 Ga0182008_10000317 3300014497 Bacteria 37953
50 Ga0157377_10041570 3300014745 Bacteria 2551
51 Ga0157376_10255679 3300014969 Bacteria 1638
52 Ga0182006_1000002 3300015261 Bacteria 887990
53 Ga0182007_10000045 3300015262 Bacteria 106028
54 Ga0182005_1000002 3300015265 Bacteria 908499
55 Ga0163161_10015672 3300017792 Bacteria 5286
56 Ga0213872_10000026 3300021361 Bacteria 149852
57 Ga0213872_10001209 3300021361 Bacteria 17516
58 Ga0209565_1000009 3300025263 Bacteria 751701
59 Ga0209565_1002736 3300025263 Bacteria 6128
60 Ga0209673_1000019 3300025273 Bacteria 449094
61 Ga0209130_1000143 3300025284 Bacteria 114072
62 Ga0209675_1000028 3300025291 Bacteria 281253
63 Ga0209564_1000058 3300025295 Bacteria 332955
64 Ga0209256_1000005 3300025299 Bacteria 1315082
65 Ga0209256_1000093 3300025299 Bacteria 209318
66 Ga0207426_1006108 3300025302 Bacteria 5306
67 Ga0207685_10001328 3300025905 Bacteria 5099
68 Ga0207645_10069715 3300025907 Bacteria 2249
69 Ga0207657_10012336 3300025919 Bacteria 8441
70 Ga0207649_10006902 3300025920 Bacteria 6170
71 Ga0207681_10001529 3300025923 Bacteria 14909
72 Ga0207690_10005630 3300025932 Bacteria 7405
73 Ga0207706_10098027 3300025933 Bacteria 2578
74 Ga0207709_10019155 3300025935 Bacteria 3843
75 Ga0207665_10153856 3300025939 Bacteria 1649
76 Ga0207691_10079627 3300025940 Bacteria 2948
77 Ga0207689_10015873 3300025942 Bacteria 6379
78 Ga0207679_10069250 3300025945 Bacteria 2654
79 Ga0207712_10031240 3300025961 Bacteria 3585
80 Ga0207668_10007147 3300025972 Bacteria 6631
81 Ga0207708_10052250 3300026075 Bacteria 3113
82 Ga0207702_10213258 3300026078 Bacteria 1796
83 Ga0207648_10005045 3300026089 Bacteria 13391
84 Ga0207676_10020457 3300026095 Bacteria 4843
85 Ga0207674_10199129 3300026116 Bacteria 1953
86 Ga0207683_10165337 3300026121 Bacteria 2002
87 Ga0209969_1006496 3300027360 Bacteria 1647
88 Ga0210000_1001697 3300027462 Bacteria 3110
89 Ga0210000_1003021 3300027462 Bacteria 2409
90 Ga0209999_1012483 3300027543 Bacteria 1539
91 Ga0209970_1005165 3300027614 Bacteria 2158
92 Ga0209282_1000001 3300027666 Bacteria 2450367
93 Ga0209966_1008565 3300027695 Bacteria 1818
94 Ga0207428_10128317 3300027907 Bacteria 1942
95 Ga0207428_10220314 3300027907 Bacteria 1422
96 Ga0268265_10000922 3300028380 Bacteria 27196
97 Ga0316177_1040320 3300030731 Bacteria 2657
98 Ga0316180_1123256 3300030736 Bacteria 1399
99 Ga0316182_1070422 3300030745 Bacteria 2491
100 Ga0265332_10042566 3300031238 Bacteria 1963
101 Ga0307509_10000053 3300031507 Bacteria 164364
102 Ga0307405_10313573 3300031731 Bacteria 1195
103 Ga0307407_10297939 3300031903 Bacteria 1123
104 Ga0316583_10003375 3300032133 Bacteria 5621
105 Ga0373926_0000140 3300035083 Bacteria 15332
106 Ga0373923_0017355 3300035111 Bacteria 2752
107 Ga0373954_0015310 3300035118 Bacteria 3428
108 Ga0373943_0098314 3300035170 Bacteria 1526
109 Ga0373924_0002475 3300035410 Bacteria 6209
110 Ga0373935_0033492 3300035692 Bacteria 3197
111 Ga0373927_0015166 3300035695 Bacteria 5094
112 Ga0373947_0132301 3300035725 Bacteria 1593
113 Ga0373925_0034902 3300037068 Bacteria 3708
114 Ga0395899_0000028 3300037312 Bacteria 334378
115 Ga0395899_0001707 3300037312 Bacteria 18303
116 Ga0395905_0007433 3300037471 Bacteria 10892
117 Ga0395905_0007515 3300037471 Bacteria 10840
118 Ga0395901_0227921 3300038443 Bacteria 1946
119 Ga0436361_0010308 3300039447 Bacteria 3599
120 Ga0436361_0172259 3300039447 Bacteria 62010
121 Ga0436361_0580718 3300039447 Bacteria 1255
122 Ga0436361_0974268 3300039447 Bacteria 66829
123 Ga0439441_010998 3300042001 Bacteria 1529
124 Ga0450923_021916 3300042125 Bacteria 1249
125 Ga0450898_006579 3300042134 Bacteria 1788
126 Ga0439444_0001435 3300042437 Bacteria 3096
127 Ga0439460_0019526 3300042461 Bacteria 1836
128 Ga0451577_0000457 3300042876 Bacteria 71078
129 Ga0451577_0042807 3300042876 Bacteria 4059
130 Ga0451577_0061082 3300042876 Bacteria 3360
131 Ga0451577_0212606 3300042876 Bacteria 1747
132 Ga0466972_0000041 3300044658 Bacteria 132242
133 Ga0453683_0075608 3300044673 Bacteria 2108
134 Ga0466965_0135349 3300044683 Bacteria 1280
135 Ga0466966_0005931 3300044684 Bacteria 8064
136 Ga0453684_0000005 3300044712 Bacteria 1431632
137 Ga0453684_0024020 3300044712 Bacteria 8934
138 Ga0466970_0002386 3300044765 Bacteria 9076
139 Ga0466959_0057305 3300045049 Bacteria 2841
140 Ga0451576_0000765 3300045051 Bacteria 63455
141 Ga0451576_0001449 3300045051 Bacteria 40328
142 Ga0451576_0001512 3300045051 Bacteria 39177
143 Ga0451576_0043520 3300045051 Bacteria 4737
144 Ga0451576_0078073 3300045051 Bacteria 3446
145 Ga0495627_000055 3300046453 Bacteria 149482
146 Ga0495603_0002854 3300046455 Bacteria 10207
147 Ga0495650_0000048 3300046471 Bacteria 334427
148 Ga0495580_0109227 3300046472 Bacteria 1920
149 Ga0495605_0034316 3300046474 Bacteria 2569
150 Ga0495584_0000059 3300046491 Bacteria 79769
151 Ga0495585_0023992 3300046492 Bacteria 3498
152 Ga0495606_0014274 3300046507 Bacteria 6212
153 Ga0495608_0075404 3300046511 Bacteria 2198
154 Ga0495630_0150064 3300046517 Bacteria 1773
155 Ga0495643_0014658 3300046522 Bacteria 4658
156 Ga0495644_0016163 3300046523 Bacteria 2858
157 Ga0495648_0021771 3300046524 Bacteria 4433
158 Ga0495666_0007479 3300046526 Bacteria 5469
159 Ga0495642_0003057 3300046528 Bacteria 6652
160 Ga0495654_0161471 3300046530 Bacteria 983
161 Ga0495586_0001461 3300046535 Bacteria 13022
162 Ga0495587_0076725 3300046536 Bacteria 1941
163 Ga0495609_0030298 3300046538 Bacteria 2462
164 Ga0495621_0024789 3300046539 Bacteria 2007
165 Ga0495597_0008338 3300046542 Bacteria 5193
166 Ga0495597_0013139 3300046542 Bacteria 3974
167 Ga0495622_0041368 3300046557 Bacteria 2143
168 Ga0495622_0061339 3300046557 Bacteria 1741
169 Ga0495633_0001564 3300046558 Bacteria 17548
170 Ga0495667_0048829 3300046559 Bacteria 2794
171 Ga0495668_0000368 3300046616 Bacteria 59517
172 Ga0495668_0060508 3300046616 Bacteria 2089
173 Ga0495611_0087298 3300046648 Bacteria 1439
174 Ga0495661_0004425 3300046665 Bacteria 10142
175 Ga0495588_0010931 3300046674 Bacteria 4245
176 Ga0495647_0000095 3300046681 Bacteria 22161
177 Ga0495658_0003570 3300046683 Bacteria 7701
178 Ga0495589_0014761 3300046794 Bacteria 4020
179 Ga0495660_0018909 3300046810 Bacteria 3954
180 Ga0495687_018477 3300047443 Bacteria 3446
181 Ga0495687_033274 3300047443 Bacteria 2340
182 Ga0495673_0007641 3300047469 Bacteria 6179
183 Ga0495681_0020593 3300047470 Bacteria 3576
184 Ga0495686_0015833 3300047472 Bacteria 5131
185 Ga0496101_0304887 3300048904 Bacteria 1248
186 Ga0496102_0162846 3300048905 Bacteria 2098
187 Ga0496104_0033534 3300048907 Bacteria 4785
188 Ga0496109_0020990 3300048912 Bacteria 5774
189 Ga0496110_0004073 3300048913 Bacteria 11279
190 Ga0496111_0084442 3300048914 Bacteria 2321
191 Ga0496116_0016366 3300048919 Bacteria 5803
192 Ga0496117_0000001 3300048920 Bacteria 2526244
193 Ga0496118_0000078 3300048921 Bacteria 190946
194 Ga0496121_0007420 3300048924 Bacteria 13248
195 Ga0496121_0273144 3300048924 Bacteria 1160
196 Ga0496122_0002104 3300048925 Bacteria 29499
197 Ga0496123_0016054 3300048926 Bacteria 6104
198 Ga0496124_0184176 3300048927 Bacteria 1604
199 Ga0496125_0002948 3300048928 Bacteria 21405
200 Ga0496125_0010500 3300048928 Bacteria 9365
201 Ga0495678_005240 3300049459 Bacteria 7225
202 Ga0501298_018334 3300049521 Bacteria 1286
203 Ga0501316_004553 3300049532 Bacteria 1396
204 Ga0501031_0047400 3300049568 Bacteria 2802
205 Ga0501032_0007881 3300049569 Bacteria 7758
206 Ga0501032_0038576 3300049569 Bacteria 3253
207 Ga0501036_0001404 3300049572 Bacteria 18493
208 Ga0501036_0059755 3300049572 Bacteria 3230
209 Ga0501037_0139433 3300049573 Bacteria 1736
210 Ga0501038_0001562 3300049574 Bacteria 21192
211 Ga0501038_0004735 3300049574 Bacteria 12657
212 Ga0501039_0000297 3300049575 Bacteria 35336
213 Ga0501039_0040606 3300049575 Bacteria 3591
214 Ga0501040_0000297 3300049576 Bacteria 28970
215 Ga0501040_0016386 3300049576 Bacteria 4906
216 Ga0501040_0108529 3300049576 Bacteria 1940
217 Ga0501041_0000085 3300049577 Bacteria 37102
218 Ga0501041_0158383 3300049577 Bacteria 1415
219 Ga0501041_0206643 3300049577 Bacteria 1231
220 Ga0501042_0009822 3300049578 Bacteria 6391
221 Ga0501042_0017501 3300049578 Bacteria 4943
222 Ga0501043_0328596 3300049579 Bacteria 1165
223 Ga0501046_0002094 3300049580 Bacteria 18912
224 Ga0501048_0000187 3300049582 Bacteria 39685
225 Ga0501048_0027420 3300049582 Bacteria 4139
226 Ga0501068_0012564 3300049584 Bacteria 4805
227 Ga0501070_0046079 3300049586 Bacteria 3626
228 Ga0501071_0003859 3300049587 Bacteria 9439
229 Ga0501071_0016972 3300049587 Bacteria 5011
230 Ga0501072_0001694 3300049588 Bacteria 16426
231 Ga0501072_0021876 3300049588 Bacteria 4960
232 Ga0501074_0025684 3300049590 Bacteria 4275
233 Ga0501075_0000011 3300049591 Bacteria 83082
234 Ga0501075_0015854 3300049591 Bacteria 5420
235 Ga0501076_0001246 3300049592 Bacteria 16956
236 Ga0501076_0002279 3300049592 Bacteria 13128
237 Ga0501077_0000952 3300049593 Bacteria 17446
238 Ga0501077_0016663 3300049593 Bacteria 4632
239 Ga0501240_014641 3300049673 Bacteria 1105
240 Ga0501249_008536 3300049679 Bacteria 2125
241 Ga0501079_0000021 3300049741 Bacteria 63849
242 Ga0501079_0005841 3300049741 Bacteria 9203
243 Ga0501080_0018789 3300049742 Bacteria 6399
244 Ga0501080_0186170 3300049742 Bacteria 1909
245 Ga0501081_0000752 3300049743 Bacteria 18951
246 Ga0501081_0005515 3300049743 Bacteria 8168
247 Ga0501035_0074485 3300049822 Bacteria 3003
248 Ga0501035_0096189 3300049822 Bacteria 2602
249 Ga0501045_0000054 3300049824 Bacteria 51274
250 nmdc:mga09592_165258_c1 3300050508 Bacteria 1913
251 nmdc:mga09592_393818_c1 3300050508 Bacteria 1198
252 nmdc:mga0qj67_1278_c1 3300050509 Bacteria 17641
253 nmdc:mga0qj67_14261_c1 3300050509 Bacteria 6006
254 nmdc:mga06r32_105484_c1 3300050510 Bacteria 2769
255 nmdc:mga08y16_444053_c1 3300050511 Bacteria 1324
256 nmdc:mga0n895_2056_c1 3300050512 Bacteria 15489
257 nmdc:mga0rr50_12511_c1 3300050513 Bacteria 5490
258 nmdc:mga0rr50_4466_c1 3300050513 Bacteria 8236
259 nmdc:mga08x19_252_c1 3300050514 Bacteria 40716
260 nmdc:mga0a205_22323_c1 3300050515 Bacteria 5993
261 Ga0501084_0061652 3300054114 Bacteria 3140
262 Ga0587077_007752 3300059493 Bacteria 1576
263 Ga0587090_003658 3300059510 Bacteria 1803
264 Ga0530510_0000493 3300061734 Bacteria 25166
265 Ga0530510_0001885 3300061734 Bacteria 14316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049679 Ga0501249_008536 Ga0501249_008536_1168_2064 217
2 3300046810 Ga0495660_0018909 Ga0495660_0018909_277_1131 218
3 3300047470 Ga0495681_0020593 Ga0495681_0020593_1073_1927 218
4 3300037312 Ga0395899_0001707 Ga0395899_0001707_12522_13430 219
5 3300037471 Ga0395905_0007433 Ga0395905_0007433_7298_8206 219
6 3300038443 Ga0395901_0227921 Ga0395901_0227921_882_1790 219
7 3300046522 Ga0495643_0014658 Ga0495643_0014658_2190_3071 219
8 3300046528 Ga0495642_0003057 Ga0495642_0003057_4415_5296 219
9 3300046542 Ga0495597_0013139 Ga0495597_0013139_295_1209 219
10 3300046665 Ga0495661_0004425 Ga0495661_0004425_1371_2252 219
11 3300047443 Ga0495687_033274 Ga0495687_033274_583_1464 219
12 3300042876 Ga0451577_0212606 Ga0451577_0212606_383_1261 220
13 3300045051 Ga0451576_0000765 Ga0451576_0000765_24571_25443 220
14 3300045051 Ga0451576_0043520 Ga0451576_0043520_1261_2133 220
15 3300030745 Ga0316182_1070422 Ga0316182_10704222 221
16 3300046524 Ga0495648_0021771 Ga0495648_0021771_2892_3791 221
17 3300014969 Ga0157376_10255679 Ga0157376_102556792 222
18 3300046539 Ga0495621_0024789 Ga0495621_0024789_830_1714 222
19 3300048905 Ga0496102_0162846 Ga0496102_0162846_577_1461 222
20 3300048907 Ga0496104_0033534 Ga0496104_0033534_2761_3645 222
21 3300048912 Ga0496109_0020990 Ga0496109_0020990_2322_3206 222
22 3300048913 Ga0496110_0004073 Ga0496110_0004073_3634_4518 222
23 3300049568 Ga0501031_0047400 Ga0501031_0047400_296_1183 222
24 3300049569 Ga0501032_0038576 Ga0501032_0038576_713_1600 222
25 3300049572 Ga0501036_0001404 Ga0501036_0001404_7848_8735 222
26 3300049574 Ga0501038_0001562 Ga0501038_0001562_3509_4396 222
27 3300049575 Ga0501039_0000297 Ga0501039_0000297_9921_10808 222
28 3300049576 Ga0501040_0000297 Ga0501040_0000297_10730_11617 222
29 3300049577 Ga0501041_0000085 Ga0501041_0000085_15962_16849 222
30 3300049578 Ga0501042_0009822 Ga0501042_0009822_2800_3687 222
31 3300049580 Ga0501046_0002094 Ga0501046_0002094_2430_3317 222
32 3300049582 Ga0501048_0000187 Ga0501048_0000187_9445_10332 222
33 3300049584 Ga0501068_0012564 Ga0501068_0012564_2911_3798 222
34 3300049586 Ga0501070_0046079 Ga0501070_0046079_1588_2475 222
35 3300049587 Ga0501071_0003859 Ga0501071_0003859_7911_8798 222
36 3300049588 Ga0501072_0001694 Ga0501072_0001694_434_1321 222
37 3300049590 Ga0501074_0025684 Ga0501074_0025684_422_1309 222
38 3300049591 Ga0501075_0000011 Ga0501075_0000011_69733_70620 222
39 3300049592 Ga0501076_0002279 Ga0501076_0002279_9877_10764 222
40 3300049593 Ga0501077_0000952 Ga0501077_0000952_15858_16745 222
41 3300049741 Ga0501079_0000021 Ga0501079_0000021_62252_63139 222
42 3300049743 Ga0501081_0000752 Ga0501081_0000752_17354_18241 222
43 3300049822 Ga0501035_0074485 Ga0501035_0074485_1301_2188 222
44 3300049824 Ga0501045_0000054 Ga0501045_0000054_22961_23848 222
45 3300061734 Ga0530510_0001885 Ga0530510_0001885_1111_1998 222
46 3300044765 Ga0466970_0002386 Ga0466970_0002386_7636_8532 223
47 3300045049 Ga0466959_0057305 Ga0466959_0057305_1006_1902 223
48 3300005337 Ga0070682_100005581 Ga0070682_1000055812 224
49 3300005546 Ga0070696_100093540 Ga0070696_1000935402 224
50 3300031238 Ga0265332_10042566 Ga0265332_100425662 224
51 3300047443 Ga0495687_018477 Ga0495687_018477_1770_2654 224
52 3300021361 Ga0213872_10001209 Ga0213872_1000120911 225
53 3300030731 Ga0316177_1040320 Ga0316177_10403201 225
54 3300030736 Ga0316180_1123256 Ga0316180_11232562 225
55 3300039447 Ga0436361_0974268 Ga0436361_0974268_16230_17114 225
56 3300046471 Ga0495650_0000048 Ga0495650_0000048_195320_196195 225
57 3300049459 Ga0495678_005240 Ga0495678_005240_3750_4625 225
58 3300035083 Ga0373926_0000140 Ga0373926_0000140_9961_10821 226
59 3300035111 Ga0373923_0017355 Ga0373923_0017355_1097_1957 226
60 3300035170 Ga0373943_0098314 Ga0373943_0098314_57_917 226
61 3300035692 Ga0373935_0033492 Ga0373935_0033492_1001_1861 226
62 3300035695 Ga0373927_0015166 Ga0373927_0015166_140_1000 226
63 3300035725 Ga0373947_0132301 Ga0373947_0132301_57_917 226
64 3300037068 Ga0373925_0034902 Ga0373925_0034902_698_1558 226
65 3300042876 Ga0451577_0061082 Ga0451577_0061082_1253_2140 226
66 3300045051 Ga0451576_0001512 Ga0451576_0001512_29946_30833 226
67 3300046455 Ga0495603_0002854 Ga0495603_0002854_6998_7858 226
68 3300046472 Ga0495580_0109227 Ga0495580_0109227_825_1685 226
69 3300046517 Ga0495630_0150064 Ga0495630_0150064_861_1721 226
70 3300046526 Ga0495666_0007479 Ga0495666_0007479_4391_5251 226
71 3300046535 Ga0495586_0001461 Ga0495586_0001461_2245_3105 226
72 3300046674 Ga0495588_0010931 Ga0495588_0010931_957_1817 226
73 3300046681 Ga0495647_0000095 Ga0495647_0000095_16769_17629 226
74 3300046683 Ga0495658_0003570 Ga0495658_0003570_1255_2115 226
75 3300005339 Ga0070660_100002374 Ga0070660_1000023746 227
76 3300005366 Ga0070659_100010061 Ga0070659_1000100617 227
77 3300025919 Ga0207657_10012336 Ga0207657_100123363 227
78 3300025920 Ga0207649_10006902 Ga0207649_100069027 227
79 3300025932 Ga0207690_10005630 Ga0207690_100056308 227
80 3300025939 Ga0207665_10153856 Ga0207665_101538562 227
81 3300025945 Ga0207679_10069250 Ga0207679_100692503 227
82 3300044683 Ga0466965_0135349 Ga0466965_0135349_265_1155 227
83 3300046492 Ga0495585_0023992 Ga0495585_0023992_871_1746 227
84 3300046542 Ga0495597_0008338 Ga0495597_0008338_1708_2583 227
85 3300048928 Ga0496125_0002948 Ga0496125_0002948_15294_16184 227
86 3300005444 Ga0070694_100020496 Ga0070694_1000204964 228
87 3300005539 Ga0068853_100122432 Ga0068853_1001224323 228
88 3300005545 Ga0070695_100037962 Ga0070695_1000379622 228
89 3300005618 Ga0068864_100031579 Ga0068864_1000315792 228
90 3300005842 Ga0068858_100077323 Ga0068858_1000773233 228
91 3300006871 Ga0075434_100000936 Ga0075434_10000093617 228
92 3300006914 Ga0075436_100003439 Ga0075436_1000034395 228
93 3300007076 Ga0075435_100004702 Ga0075435_10000470210 228
94 3300026095 Ga0207676_10020457 Ga0207676_100204572 228
95 3300027907 Ga0207428_10220314 Ga0207428_102203142 228
96 3300035118 Ga0373954_0015310 Ga0373954_0015310_541_1407 228
97 3300037312 Ga0395899_0000028 Ga0395899_0000028_255194_256063 228
98 3300042437 Ga0439444_0001435 Ga0439444_0001435_1611_2495 228
99 3300046511 Ga0495608_0075404 Ga0495608_0075404_657_1523 228
100 3300046559 Ga0495667_0048829 Ga0495667_0048829_1467_2333 228
101 3300050511 nmdc:mga08y16_444053_c1 nmdc:mga08y16_444053_c1_67_951 228
102 3300050512 nmdc:mga0n895_2056_c1 nmdc:mga0n895_2056_c1_14246_15130 228
103 3300050513 nmdc:mga0rr50_12511_c1 nmdc:mga0rr50_12511_c1_1932_2816 228
104 3300050514 nmdc:mga08x19_252_c1 nmdc:mga08x19_252_c1_29163_30047 228
105 3300050515 nmdc:mga0a205_22323_c1 nmdc:mga0a205_22323_c1_113_997 228
106 3300049576 Ga0501040_0108529 Ga0501040_0108529_97_984 229
107 3300049673 Ga0501240_014641 Ga0501240_014641_161_1060 229
108 3300050508 nmdc:mga09592_165258_c1 nmdc:mga09592_165258_c1_759_1628 229
109 3300059510 Ga0587090_003658 Ga0587090_003658_236_1144 229
110 3300045051 Ga0451576_0078073 Ga0451576_0078073_461_1339 230
111 3300046491 Ga0495584_0000059 Ga0495584_0000059_71445_72320 230
112 3300046507 Ga0495606_0014274 Ga0495606_0014274_2109_2984 230
113 3300044684 Ga0466966_0005931 Ga0466966_0005931_92_1000 231
114 3300046453 Ga0495627_000055 Ga0495627_000055_70005_70898 231
115 3300059493 Ga0587077_007752 Ga0587077_007752_303_1211 231
116 3300021361 Ga0213872_10000026 Ga0213872_10000026107 232
117 3300031507 Ga0307509_10000053 Ga0307509_1000005385 232
118 3300039447 Ga0436361_0172259 Ga0436361_0172259_51245_52159 232
119 3300042876 Ga0451577_0000457 Ga0451577_0000457_55765_56643 232
120 3300042876 Ga0451577_0042807 Ga0451577_0042807_2103_2981 232
121 3300044673 Ga0453683_0075608 Ga0453683_0075608_823_1701 232
122 3300044712 Ga0453684_0000005 Ga0453684_0000005_19808_20686 232
123 3300044712 Ga0453684_0024020 Ga0453684_0024020_3542_4420 232
124 3300045051 Ga0451576_0001449 Ga0451576_0001449_19668_20546 232
125 3300048927 Ga0496124_0184176 Ga0496124_0184176_605_1498 232
126 3300042134 Ga0450898_006579 Ga0450898_006579_679_1554 233
127 3300049532 Ga0501316_004553 Ga0501316_004553_182_1060 233
128 iso_pu_bacteria 2643221603 2644028870 233
129 3300005614 Ga0068856_100309039 Ga0068856_1003090392 234
130 3300006163 Ga0070715_10023944 Ga0070715_100239443 234
131 3300007076 Ga0075435_100027839 Ga0075435_1000278395 234
132 3300025905 Ga0207685_10001328 Ga0207685_100013283 234
133 3300026078 Ga0207702_10213258 Ga0207702_102132582 234
134 3300027462 Ga0210000_1001697 Ga0210000_10016973 234
135 3300031903 Ga0307407_10297939 Ga0307407_102979392 234
136 3300046536 Ga0495587_0076725 Ga0495587_0076725_808_1692 234
137 3300049569 Ga0501032_0007881 Ga0501032_0007881_3922_4812 234
138 3300049574 Ga0501038_0004735 Ga0501038_0004735_2253_3143 234
139 3300049575 Ga0501039_0040606 Ga0501039_0040606_2035_2925 234
140 3300049822 Ga0501035_0096189 Ga0501035_0096189_1113_2003 234
141 3300050513 nmdc:mga0rr50_4466_c1 nmdc:mga0rr50_4466_c1_2157_3041 234
142 3300005340 Ga0070689_100144151 Ga0070689_1001441513 235
143 3300005440 Ga0070705_100258964 Ga0070705_1002589641 235
144 3300005457 Ga0070662_100069651 Ga0070662_1000696512 235
145 3300005543 Ga0070672_100103585 Ga0070672_1001035853 235
146 3300005546 Ga0070696_100183200 Ga0070696_1001832003 235
147 3300005549 Ga0070704_100400216 Ga0070704_1004002162 235
148 3300005577 Ga0068857_100350687 Ga0068857_1003506872 235
149 3300005615 Ga0070702_100173836 Ga0070702_1001738363 235
150 3300005617 Ga0068859_100185245 Ga0068859_1001852453 235
151 3300005719 Ga0068861_100042195 Ga0068861_1000421952 235
152 3300006844 Ga0075428_100028747 Ga0075428_1000287473 235
153 3300006844 Ga0075428_100467512 Ga0075428_1004675122 235
154 3300006846 Ga0075430_100014009 Ga0075430_1000140097 235
155 3300006846 Ga0075430_100043370 Ga0075430_1000433701 235
156 3300006847 Ga0075431_100033211 Ga0075431_1000332116 235
157 3300006881 Ga0068865_100030828 Ga0068865_1000308282 235
158 3300006931 Ga0097620_100185252 Ga0097620_1001852523 235
159 3300009553 Ga0105249_10057644 Ga0105249_100576443 235
160 3300014745 Ga0157377_10041570 Ga0157377_100415702 235
161 3300025907 Ga0207645_10069715 Ga0207645_100697152 235
162 3300025923 Ga0207681_10001529 Ga0207681_100015298 235
163 3300025933 Ga0207706_10098027 Ga0207706_100980273 235
164 3300025935 Ga0207709_10019155 Ga0207709_100191553 235
165 3300025940 Ga0207691_10079627 Ga0207691_100796273 235
166 3300025942 Ga0207689_10015873 Ga0207689_100158736 235
167 3300025961 Ga0207712_10031240 Ga0207712_100312403 235
168 3300025972 Ga0207668_10007147 Ga0207668_100071478 235
169 3300026075 Ga0207708_10052250 Ga0207708_100522502 235
170 3300026089 Ga0207648_10005045 Ga0207648_1000504510 235
171 3300026116 Ga0207674_10199129 Ga0207674_101991292 235
172 3300026121 Ga0207683_10165337 Ga0207683_101653373 235
173 3300027360 Ga0209969_1006496 Ga0209969_10064962 235
174 3300027462 Ga0210000_1003021 Ga0210000_10030214 235
175 3300027543 Ga0209999_1012483 Ga0209999_10124832 235
176 3300027614 Ga0209970_1005165 Ga0209970_10051653 235
177 3300027907 Ga0207428_10128317 Ga0207428_101283172 235
178 3300028380 Ga0268265_10000922 Ga0268265_100009228 235
179 3300031731 Ga0307405_10313573 Ga0307405_103135732 235
180 3300032133 Ga0316583_10003375 Ga0316583_100033755 235
181 3300035410 Ga0373924_0002475 Ga0373924_0002475_261_1157 235
182 3300042001 Ga0439441_010998 Ga0439441_010998_110_994 235
183 3300042125 Ga0450923_021916 Ga0450923_021916_259_1146 235
184 3300042461 Ga0439460_0019526 Ga0439460_0019526_148_1035 235
185 3300044658 Ga0466972_0000041 Ga0466972_0000041_102904_103791 235
186 3300046530 Ga0495654_0161471 Ga0495654_0161471_86_973 235
187 3300049521 Ga0501298_018334 Ga0501298_018334_362_1249 235
188 3300049572 Ga0501036_0059755 Ga0501036_0059755_617_1504 235
189 3300049573 Ga0501037_0139433 Ga0501037_0139433_689_1573 235
190 3300049576 Ga0501040_0016386 Ga0501040_0016386_3154_4041 235
191 3300049577 Ga0501041_0158383 Ga0501041_0158383_327_1211 235
192 3300049577 Ga0501041_0206643 Ga0501041_0206643_198_1085 235
193 3300049578 Ga0501042_0017501 Ga0501042_0017501_3003_3890 235
194 3300049579 Ga0501043_0328596 Ga0501043_0328596_220_1107 235
195 3300049582 Ga0501048_0027420 Ga0501048_0027420_1179_2066 235
196 3300049587 Ga0501071_0016972 Ga0501071_0016972_2389_3276 235
197 3300049588 Ga0501072_0021876 Ga0501072_0021876_1078_1965 235
198 3300049591 Ga0501075_0015854 Ga0501075_0015854_4310_5197 235
199 3300049592 Ga0501076_0001246 Ga0501076_0001246_5055_5942 235
200 3300049593 Ga0501077_0016663 Ga0501077_0016663_2223_3110 235
201 3300049741 Ga0501079_0005841 Ga0501079_0005841_3408_4295 235
202 3300049742 Ga0501080_0018789 Ga0501080_0018789_1101_1988 235
203 3300049742 Ga0501080_0186170 Ga0501080_0186170_855_1739 235
204 3300049743 Ga0501081_0005515 Ga0501081_0005515_4773_5660 235
205 3300050508 nmdc:mga09592_393818_c1 nmdc:mga09592_393818_c1_117_1004 235
206 3300050509 nmdc:mga0qj67_1278_c1 nmdc:mga0qj67_1278_c1_10185_11069 235
207 3300050509 nmdc:mga0qj67_14261_c1 nmdc:mga0qj67_14261_c1_1780_2667 235
208 3300050510 nmdc:mga06r32_105484_c1 nmdc:mga06r32_105484_c1_117_1004 235
209 3300054114 Ga0501084_0061652 Ga0501084_0061652_1454_2341 235
210 3300061734 Ga0530510_0000493 Ga0530510_0000493_9491_10378 235
211 3300003544 Ga0007417J51691_1025634 Ga0007417J51691_10256345 236
212 3300003574 Ga0007410J51695_1029218 Ga0007410J51695_10292186 236
213 3300003575 Ga0007409J51694_1014187 Ga0007409J51694_101418713 236
214 3300003577 Ga0007416J51690_1015392 Ga0007416J51690_101539213 236
215 3300003693 Ga0032354_1032081 Ga0032354_10320817 236
216 3300003775 Ga0055524_1000161 Ga0055524_100016134 236
217 3300006948 Ga0099826_10000001 Ga0099826_100000011028 236
218 3300013102 Ga0157371_10000001 Ga0157371_10000001173 236
219 3300014497 Ga0182008_10000317 Ga0182008_100003171 236
220 3300015261 Ga0182006_1000002 Ga0182006_1000002319 236
221 3300015262 Ga0182007_10000045 Ga0182007_1000004532 236
222 3300015265 Ga0182005_1000002 Ga0182005_1000002771 236
223 3300017792 Ga0163161_10015672 Ga0163161_100156724 236
224 3300025263 Ga0209565_1002736 Ga0209565_10027366 236
225 3300025299 Ga0209256_1000005 Ga0209256_1000005591 236
226 3300027666 Ga0209282_1000001 Ga0209282_10000012152 236
227 3300027695 Ga0209966_1008565 Ga0209966_10085652 236
228 3300037471 Ga0395905_0007515 Ga0395905_0007515_6812_7708 236
229 3300046474 Ga0495605_0034316 Ga0495605_0034316_1331_2206 236
230 3300046523 Ga0495644_0016163 Ga0495644_0016163_1888_2763 236
231 3300046538 Ga0495609_0030298 Ga0495609_0030298_661_1536 236
232 3300046557 Ga0495622_0041368 Ga0495622_0041368_1224_2111 236
233 3300046557 Ga0495622_0061339 Ga0495622_0061339_683_1558 236
234 3300046558 Ga0495633_0001564 Ga0495633_0001564_8137_9024 236
235 3300046616 Ga0495668_0000368 Ga0495668_0000368_9342_10217 236
236 3300046616 Ga0495668_0060508 Ga0495668_0060508_697_1572 236
237 3300046648 Ga0495611_0087298 Ga0495611_0087298_32_907 236
238 3300046794 Ga0495589_0014761 Ga0495589_0014761_1549_2424 236
239 3300047469 Ga0495673_0007641 Ga0495673_0007641_4352_5227 236
240 3300047472 Ga0495686_0015833 Ga0495686_0015833_2545_3420 236
241 3300048914 Ga0496111_0084442 Ga0496111_0084442_25_912 236
242 3300048919 Ga0496116_0016366 Ga0496116_0016366_3210_4097 236
243 3300048920 Ga0496117_0000001 Ga0496117_0000001_1715238_1716125 236
244 3300048921 Ga0496118_0000078 Ga0496118_0000078_24350_25237 236
245 3300048924 Ga0496121_0007420 Ga0496121_0007420_1301_2188 236
246 3300048924 Ga0496121_0273144 Ga0496121_0273144_227_1120 236
247 3300048925 Ga0496122_0002104 Ga0496122_0002104_16585_17472 236
248 3300048926 Ga0496123_0016054 Ga0496123_0016054_3725_4612 236
249 3300048928 Ga0496125_0010500 Ga0496125_0010500_5188_6075 236
250 3300002987 JGI25159J45721_1001362 JGI25159J45721_10013629 237
251 3300003354 JGI25160J50197_1000586 JGI25160J50197_10005867 237
252 3300003773 Ga0055537_1000143 Ga0055537_100014312 237
253 3300003775 Ga0055524_1022553 Ga0055524_10225532 237
254 3300003784 Ga0055534_1000712 Ga0055534_10007125 237
255 3300003790 Ga0055528_1000430 Ga0055528_10004303 237
256 3300005262 Ga0065165_1000268 Ga0065165_100026857 237
257 3300025263 Ga0209565_1000009 Ga0209565_1000009129 237
258 3300025273 Ga0209673_1000019 Ga0209673_1000019253 237
259 3300025284 Ga0209130_1000143 Ga0209130_100014369 237
260 3300025291 Ga0209675_1000028 Ga0209675_1000028103 237
261 3300025295 Ga0209564_1000058 Ga0209564_1000058191 237
262 3300025299 Ga0209256_1000093 Ga0209256_1000093156 237
263 3300025302 Ga0207426_1006108 Ga0207426_10061082 237
264 3300039447 Ga0436361_0010308 Ga0436361_0010308_63_953 237
265 3300039447 Ga0436361_0580718 Ga0436361_0580718_295_1209 237
266 3300048904 Ga0496101_0304887 Ga0496101_0304887_150_1025 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

19

209

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.7353 62 163
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.7011 65 99
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.6828 65 160
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.6822 62 160
1win-assembly1.cif.gz_A solution structure of the band 7 domain of the mouse flotillin 2 protein 0.6735 63 168
ID Description Score Start End Superfamily
af_P9WPR9_23_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.7898 20 173 3.30.479.30
af_Q8K4G9_162_272_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.7757 62 160 3.30.479.30
af_Q9VGD7_116_226_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.7711 63 160 3.30.479.30
af_Q14254_45_161_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.7613 62 161 3.30.479.30
af_Q8T4B6_101_212_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.7611 62 160 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A3M6H177-F1-model_v4 SPFH domain-containing protein 0.9293 13 95 GO:0016020
AF-A0A498EJW3-F1-model_v4 deleted 0.8953 30 161
AF-A0A6L7TRZ5-F1-model_v4 Protease modulator HflC 0.8946 1 122 GO:0006508
GO:0008233
GO:0016020
AF-A0A2M8V6C4-F1-model_v4 deleted 0.891 1 65
AF-A0A7V4DGG1-F1-model_v4 Protease modulator HflC 0.8904 2 98 GO:0006508
GO:0008233
GO:0016020

Feature Viewer

pLDDT pTM Quality
73.39 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map