F373533

General Info

Members Datasets Scaffolds Average Seq Length
265 187 530 198

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0361834|Ga0495580_0361834_174_827
Length 217
Sequence MAKTTTKRTPVRAERRANAPHGRSATVVRTTKETDIRLTLGLDGRGRYEVSTGVPFLDHMLELFARHGFFDLTVAAKGDLHVDHHHTVEDVGLVLGQAVREALGDKAGIRRFGEATVPLDEALVQTVVDLSGRPFFVYDVTIKQQKIGQFDVELIHDFLLALVNQAGMNLHVRMLSGRNPHHVVEATFKGLARALDAAVQRDARLAGVLSTKGTLTG

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
151 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
161 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
164 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
165 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
176 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
184 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
185 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 1.89
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0361834 3300046472 Bacteria 982
2 Ga0068869_100204085 3300005334 Bacteria 1560
3 Ga0068869_100213070 3300005334 Bacteria 1528
4 Ga0070666_10321512 3300005335 Bacteria 1104
5 Ga0070689_100078794 3300005340 Bacteria 2583
6 Ga0070689_100136382 3300005340 Bacteria 1971
7 Ga0070689_100162281 3300005340 Bacteria 1807
8 Ga0070689_100378009 3300005340 Bacteria 1193
9 Ga0070687_100009211 3300005343 Bacteria 4222
10 Ga0070675_100601204 3300005354 Bacteria 997
11 Ga0070688_100217573 3300005365 Bacteria 1344
12 Ga0070709_10075857 3300005434 Unclassified 2182
13 Ga0070714_100440075 3300005435 Bacteria 1237
14 Ga0070714_100572925 3300005435 Bacteria 1082
15 Ga0070713_100002392 3300005436 Bacteria 12239
16 Ga0070713_100338893 3300005436 Bacteria 1393
17 Ga0070710_10016536 3300005437 Bacteria 3757
18 Ga0070701_10137676 3300005438 Bacteria 1393
19 Ga0070708_100016344 3300005445 Bacteria 6157
20 Ga0070708_100110425 3300005445 Bacteria 2527
21 Ga0070708_100116620 3300005445 Unclassified 2459
22 Ga0070706_100003124 3300005467 Bacteria 16380
23 Ga0070706_100093645 3300005467 Bacteria 2788
24 Ga0070707_100030683 3300005468 Bacteria 5119
25 Ga0070707_100161944 3300005468 Bacteria 2180
26 Ga0070698_100017151 3300005471 Bacteria 7635
27 Ga0070699_100015583 3300005518 Bacteria 6530
28 Ga0070679_100014023 3300005530 Bacteria 7684
29 Ga0070679_100872102 3300005530 Bacteria 843
30 Ga0070697_100014183 3300005536 Bacteria 6259
31 Ga0070697_100017249 3300005536 Bacteria 5677
32 Ga0070697_100438592 3300005536 Bacteria 1136
33 Ga0068853_100031663 3300005539 Bacteria 4475
34 Ga0070665_100023368 3300005548 Bacteria 6223
35 Ga0070665_100665927 3300005548 Bacteria 1054
36 Ga0068855_100110362 3300005563 Bacteria 3158
37 Ga0068855_100331077 3300005563 Bacteria 1681
38 Ga0068855_100353391 3300005563 Bacteria 1618
39 Ga0068857_100075091 3300005577 Bacteria 3013
40 Ga0068859_100018925 3300005617 Bacteria 6918
41 Ga0068863_100145937 3300005841 Bacteria 2263
42 Ga0068860_100233684 3300005843 Bacteria 1787
43 Ga0068860_100351797 3300005843 Bacteria 1450
44 Ga0068862_100384887 3300005844 Bacteria 1309
45 Ga0070717_10000313 3300006028 Bacteria 31882
46 Ga0070717_10001979 3300006028 Bacteria 14323
47 Ga0070717_10003072 3300006028 Bacteria 11902
48 Ga0070717_10284255 3300006028 Bacteria 1468
49 Ga0070715_10038996 3300006163 Bacteria 1976
50 Ga0070712_101095615 3300006175 Bacteria 691
51 Ga0075430_100038193 3300006846 Bacteria 4069
52 Ga0075434_100139433 3300006871 Bacteria 2444
53 Ga0075429_100021542 3300006880 Bacteria 5587
54 Ga0075429_100049648 3300006880 Bacteria 3649
55 Ga0075436_100048078 3300006914 Bacteria 2944
56 Ga0097620_100018925 3300006931 Bacteria 6918
57 Ga0075435_100242356 3300007076 Bacteria 1534
58 Ga0105240_10471477 3300009093 Unclassified 1401
59 Ga0111539_10191022 3300009094 Bacteria 2389
60 Ga0111539_10220828 3300009094 Bacteria 2207
61 Ga0105245_10134004 3300009098 Bacteria 2326
62 Ga0105237_10736091 3300009545 Bacteria 992
63 Ga0105238_10001318 3300009551 Bacteria 24876
64 Ga0099796_10011472 3300010159 Bacteria 2473
65 Ga0157369_10213206 3300013105 Bacteria 2023
66 Ga0157372_10000341 3300013307 Bacteria 51448
67 Ga0157372_10001334 3300013307 Bacteria 26668
68 Ga0157372_11175540 3300013307 Bacteria 887
69 Ga0163163_11311231 3300014325 Bacteria 786
70 Ga0206353_11425203 3300020082 Bacteria 763
71 Ga0213874_10053795 3300021377 Bacteria 1243
72 Ga0207692_10074479 3300025898 Unclassified 1799
73 Ga0207685_10154525 3300025905 Bacteria 1042
74 Ga0207643_10114094 3300025908 Bacteria 1594
75 Ga0207705_10167055 3300025909 Bacteria 1655
76 Ga0207684_10031388 3300025910 Bacteria 4519
77 Ga0207684_10202178 3300025910 Bacteria 1714
78 Ga0207707_10523622 3300025912 Bacteria 1009
79 Ga0207695_10109829 3300025913 Bacteria 2739
80 Ga0207660_10541546 3300025917 Bacteria 946
81 Ga0207662_10020295 3300025918 Bacteria 3790
82 Ga0207662_10194476 3300025918 Bacteria 1310
83 Ga0207652_10132361 3300025921 Bacteria 2225
84 Ga0207646_10023919 3300025922 Bacteria 5605
85 Ga0207646_10158170 3300025922 Bacteria 2044
86 Ga0207646_10251143 3300025922 Unclassified 1598
87 Ga0207694_10056674 3300025924 Bacteria 3044
88 Ga0207659_10064246 3300025926 Bacteria 2655
89 Ga0207687_10081844 3300025927 Bacteria 2334
90 Ga0207664_10010942 3300025929 Bacteria 6425
91 Ga0207664_10184886 3300025929 Bacteria 1791
92 Ga0207664_10500693 3300025929 Unclassified 1088
93 Ga0207664_10880663 3300025929 Bacteria 804
94 Ga0207670_10005596 3300025936 Bacteria 6907
95 Ga0207670_10159199 3300025936 Bacteria 1684
96 Ga0207689_10192108 3300025942 Bacteria 1685
97 Ga0207667_10329921 3300025949 Bacteria 1558
98 Ga0207667_10552306 3300025949 Bacteria 1165
99 Ga0207667_10603268 3300025949 Bacteria 1107
100 Ga0207639_10030839 3300026041 Bacteria 3935
101 Ga0207702_10555594 3300026078 Bacteria 1123
102 Ga0207641_10010968 3300026088 Bacteria 7427
103 Ga0207641_10326033 3300026088 Bacteria 1457
104 Ga0207676_10163606 3300026095 Bacteria 1931
105 Ga0207674_10224794 3300026116 Bacteria 1825
106 Ga0207675_100066153 3300026118 Bacteria 3378
107 Ga0207675_100154711 3300026118 Bacteria 2184
108 Ga0207675_100888237 3300026118 Bacteria 907
109 Ga0207683_10004988 3300026121 Bacteria 11405
110 Ga0207683_10102822 3300026121 Bacteria 2552
111 Ga0207683_10726419 3300026121 Bacteria 921
112 Ga0207698_10343883 3300026142 Bacteria 1406
113 Ga0268266_10006445 3300028379 Bacteria 10746
114 Ga0268265_10649459 3300028380 Bacteria 1014
115 Ga0268264_10151677 3300028381 Bacteria 2078
116 Ga0265326_10040799 3300028558 Bacteria 1318
117 Ga0265319_1000064 3300028563 Bacteria 85497
118 Ga0265318_10001182 3300028577 Bacteria 16110
119 Ga0307515_10031157 3300028794 Bacteria 8905
120 Ga0307515_10276115 3300028794 Bacteria 1394
121 Ga0265338_10023221 3300028800 Bacteria 6385
122 Ga0265338_10116193 3300028800 Bacteria 2144
123 Ga0265338_10514079 3300028800 Bacteria 842
124 Ga0265338_10596804 3300028800 Bacteria 769
125 Ga0265762_1002199 3300030760 Bacteria 3533
126 Ga0265762_1023943 3300030760 Bacteria 1133
127 Ga0265765_1001197 3300030879 Bacteria 2339
128 Ga0265330_10001121 3300031235 Bacteria 16089
129 Ga0265330_10036783 3300031235 Bacteria 2181
130 Ga0265332_10000075 3300031238 Bacteria 84887
131 Ga0265332_10025371 3300031238 Bacteria 2604
132 Ga0265328_10003169 3300031239 Bacteria 7307
133 Ga0265320_10000077 3300031240 Bacteria 84445
134 Ga0265325_10056785 3300031241 Unclassified 1998
135 Ga0265329_10000012 3300031242 Bacteria 70717
136 Ga0265340_10000450 3300031247 Bacteria 22219
137 Ga0265339_10005270 3300031249 Bacteria 8623
138 Ga0265339_10100511 3300031249 Bacteria 1506
139 Ga0265331_10000836 3300031250 Bacteria 25111
140 Ga0265316_10005349 3300031344 Bacteria 12504
141 Ga0265316_10015592 3300031344 Bacteria 6636
142 Ga0265316_10015903 3300031344 Bacteria 6550
143 Ga0265316_10134087 3300031344 Bacteria 1864
144 Ga0307513_10000989 3300031456 Bacteria 41072
145 Ga0307509_10000040 3300031507 Bacteria 184460
146 Ga0307509_10002692 3300031507 Bacteria 28368
147 Ga0307509_10031171 3300031507 Bacteria 5890
148 Ga0307509_10118616 3300031507 Bacteria 2629
149 Ga0265313_10000105 3300031595 Bacteria 84446
150 Ga0307508_10020252 3300031616 Bacteria 6041
151 Ga0307508_10067131 3300031616 Bacteria 3156
152 Ga0265314_10000223 3300031711 Bacteria 84419
153 Ga0265314_10011367 3300031711 Bacteria 7357
154 Ga0265314_10019749 3300031711 Bacteria 5212
155 Ga0265342_10000129 3300031712 Bacteria 84384
156 Ga0265342_10055082 3300031712 Bacteria 2362
157 Ga0316576_10176498 3300031727 Bacteria 1612
158 Ga0307516_10019956 3300031730 Bacteria 6929
159 Ga0307406_10100443 3300031901 Bacteria 1969
160 Ga0307416_100989751 3300032002 Bacteria 944
161 Ga0307416_102102125 3300032002 Bacteria 667
162 Ga0316212_1007062 3300033547 Bacteria 1625
163 Ga0373949_0000103 3300035090 Bacteria 31484
164 Ga0373952_0148186 3300035092 Bacteria 657
165 Ga0373936_0000015 3300035113 Bacteria 200263
166 Ga0373941_0009959 3300035115 Bacteria 2411
167 Ga0373954_0117561 3300035118 Bacteria 1289
168 Ga0373954_0368567 3300035118 Bacteria 710
169 Ga0373943_0248834 3300035170 Bacteria 998
170 Ga0373955_0003914 3300035172 Bacteria 6567
171 Ga0373924_0092332 3300035410 Bacteria 1296
172 Ga0373935_0457692 3300035692 Bacteria 922
173 Ga0373927_0653915 3300035695 Bacteria 695
174 Ga0373947_0030784 3300035725 Bacteria 3155
175 Ga0373947_0042779 3300035725 Bacteria 2704
176 Ga0373937_0019961 3300036401 Bacteria 6002
177 Ga0373925_0057418 3300037068 Bacteria 2916
178 Ga0373925_0198405 3300037068 Bacteria 1595
179 Ga0395899_0449482 3300037312 Bacteria 844
180 Ga0395900_0130426 3300037418 Bacteria 2576
181 Ga0395898_0062643 3300037466 Bacteria 3612
182 Ga0395901_0049745 3300038443 Bacteria 4355
183 Ga0395901_0781034 3300038443 Bacteria 946
184 Ga0436365_0671802 3300039437 Bacteria 6260
185 Ga0436365_0886966 3300039437 Bacteria 3656
186 Ga0436361_0159046 3300039447 Bacteria 1013
187 Ga0436361_1162322 3300039447 Bacteria 1450
188 Ga0436363_1185532 3300039450 Bacteria 1301
189 Ga0436362_1284749 3300039453 Bacteria 757
190 Ga0451787_580797 3300041441 Bacteria 838
191 Ga0451789_1008284 3300041443 Bacteria 765
192 Ga0466972_0117814 3300044658 Bacteria 1253
193 Ga0453683_0198082 3300044673 Bacteria 1275
194 Ga0466961_0459800 3300044693 Bacteria 770
195 Ga0453684_0052381 3300044712 Bacteria 5338
196 Ga0466959_0213635 3300045049 Bacteria 1340
197 Ga0451576_0000453 3300045051 Bacteria 93077
198 Ga0466967_0306837 3300045976 Bacteria 1528
199 Ga0495629_0156604 3300046459 Bacteria 1583
200 Ga0495638_0112595 3300046460 Bacteria 1615
201 Ga0495651_0084230 3300046462 Bacteria 2396
202 Ga0495664_0229027 3300046477 Bacteria 1125
203 Ga0495594_0237653 3300046499 Bacteria 1038
204 Ga0495628_0336877 3300046516 Bacteria 1111
205 Ga0495666_0030238 3300046526 Bacteria 2660
206 Ga0495642_0156976 3300046528 Bacteria 985
207 Ga0495599_0051087 3300046678 Bacteria 2591
208 Ga0495649_0065897 3300046694 Bacteria 1944
209 Ga0495604_0116126 3300047317 Bacteria 1944
210 Ga0495604_0385892 3300047317 Bacteria 924
211 Ga0495602_0114704 3300048088 Unclassified 2181
212 Ga0495602_0173802 3300048088 Bacteria 1669
213 Ga0495602_0422943 3300048088 Bacteria 946
214 Ga0496108_0803550 3300048911 Bacteria 811
215 Ga0496112_0134003 3300048915 Bacteria 2448
216 Ga0496114_0075470 3300048917 Bacteria 2840
217 Ga0501297_006065 3300049520 Bacteria 1282
218 Ga0501299_006260 3300049522 Bacteria 1862
219 Ga0501036_0421211 3300049572 Bacteria 1113
220 Ga0501046_0440446 3300049580 Bacteria 938
221 Ga0501047_0021670 3300049581 Bacteria 6170
222 Ga0501047_0045576 3300049581 Bacteria 4240
223 Ga0501067_0042012 3300049583 Bacteria 2539
224 Ga0501069_0045916 3300049585 Bacteria 2421
225 Ga0501070_0018482 3300049586 Bacteria 5849
226 Ga0501070_0148618 3300049586 Bacteria 1933
227 Ga0501071_0018859 3300049587 Bacteria 4784
228 Ga0501077_0464134 3300049593 Bacteria 811
229 Ga0501217_019443 3300049661 Bacteria 1586
230 Ga0501230_004898 3300049667 Bacteria 1869
231 Ga0501233_005251 3300049668 Bacteria 2400
232 Ga0501236_004655 3300049670 Bacteria 1635
233 Ga0501225_0003150 3300049705 Bacteria 5039
234 Ga0501229_002519 3300049706 Bacteria 2161
235 Ga0501044_0027479 3300049823 Bacteria 6012
236 Ga0501044_0124836 3300049823 Bacteria 2572
237 Ga0501204_007667 3300049850 Bacteria 1217
238 nmdc:mga05p37_329741_c1 3300050507 Bacteria 1803
239 nmdc:mga09592_176655_c1 3300050508 Bacteria 1847
240 nmdc:mga09592_386812_c1 3300050508 Bacteria 1209
241 nmdc:mga09592_42367_c1 3300050508 Bacteria 3828
242 nmdc:mga08y16_45928_c1 3300050511 Bacteria 4575
243 nmdc:mga0n895_630021_c1 3300050512 Bacteria 1073
244 nmdc:mga08x19_157033_c1 3300050514 Bacteria 1543
245 nmdc:mga08x19_29755_c1 3300050514 Bacteria 3427
246 Ga0500635_0003091 3300053080 Bacteria 4163
247 Ga0500566_0000256 3300053094 Bacteria 28676
248 Ga0500566_0006798 3300053094 Bacteria 6776
249 Ga0500566_0046301 3300053094 Bacteria 2500
250 Ga0500640_000124 3300053095 Bacteria 14563
251 Ga0500554_001415 3300053102 Bacteria 4641
252 Ga0500572_009960 3300053111 Bacteria 2260
253 Ga0500595_000015 3300053119 Bacteria 224592
254 Ga0500614_000331 3300053123 Bacteria 12243
255 Ga0500642_0019219 3300053130 Bacteria 2660
256 Ga0500642_0197759 3300053130 Bacteria 936
257 Ga0500559_0012920 3300053136 Bacteria 3542
258 Ga0500568_0025728 3300053139 Bacteria 2478
259 Ga0500568_0030220 3300053139 Bacteria 2244
260 Ga0500603_002881 3300053150 Bacteria 3728
261 Ga0500630_119496 3300053159 Bacteria 1170
262 Ga0500639_272921 3300053163 Bacteria 658
263 Ga0500636_0172882 3300053177 Bacteria 1167
264 Ga0501084_0060936 3300054114 Bacteria 3159
265 Ga0501084_0433191 3300054114 Bacteria 1112
266 Ga0495580_0361834
267 Ga0068869_100204085
268 Ga0068869_100213070
269 Ga0070666_10321512
270 Ga0070689_100078794
271 Ga0070689_100136382
272 Ga0070689_100162281
273 Ga0070689_100378009
274 Ga0070687_100009211
275 Ga0070675_100601204
276 Ga0070688_100217573
277 Ga0070709_10075857
278 Ga0070714_100440075
279 Ga0070714_100572925
280 Ga0070713_100002392
281 Ga0070713_100338893
282 Ga0070710_10016536
283 Ga0070701_10137676
284 Ga0070708_100016344
285 Ga0070708_100110425
286 Ga0070708_100116620
287 Ga0070706_100003124
288 Ga0070706_100093645
289 Ga0070707_100030683
290 Ga0070707_100161944
291 Ga0070698_100017151
292 Ga0070699_100015583
293 Ga0070679_100014023
294 Ga0070679_100872102
295 Ga0070697_100014183
296 Ga0070697_100017249
297 Ga0070697_100438592
298 Ga0068853_100031663
299 Ga0070665_100023368
300 Ga0070665_100665927
301 Ga0068855_100110362
302 Ga0068855_100331077
303 Ga0068855_100353391
304 Ga0068857_100075091
305 Ga0068859_100018925
306 Ga0068863_100145937
307 Ga0068860_100233684
308 Ga0068860_100351797
309 Ga0068862_100384887
310 Ga0070717_10000313
311 Ga0070717_10001979
312 Ga0070717_10003072
313 Ga0070717_10284255
314 Ga0070715_10038996
315 Ga0070712_101095615
316 Ga0075430_100038193
317 Ga0075434_100139433
318 Ga0075429_100021542
319 Ga0075429_100049648
320 Ga0075436_100048078
321 Ga0097620_100018925
322 Ga0075435_100242356
323 Ga0105240_10471477
324 Ga0111539_10191022
325 Ga0111539_10220828
326 Ga0105245_10134004
327 Ga0105237_10736091
328 Ga0105238_10001318
329 Ga0099796_10011472
330 Ga0157369_10213206
331 Ga0157372_10000341
332 Ga0157372_10001334
333 Ga0157372_11175540
334 Ga0163163_11311231
335 Ga0206353_11425203
336 Ga0213874_10053795
337 Ga0207692_10074479
338 Ga0207685_10154525
339 Ga0207643_10114094
340 Ga0207705_10167055
341 Ga0207684_10031388
342 Ga0207684_10202178
343 Ga0207707_10523622
344 Ga0207695_10109829
345 Ga0207660_10541546
346 Ga0207662_10020295
347 Ga0207662_10194476
348 Ga0207652_10132361
349 Ga0207646_10023919
350 Ga0207646_10158170
351 Ga0207646_10251143
352 Ga0207694_10056674
353 Ga0207659_10064246
354 Ga0207687_10081844
355 Ga0207664_10010942
356 Ga0207664_10184886
357 Ga0207664_10500693
358 Ga0207664_10880663
359 Ga0207670_10005596
360 Ga0207670_10159199
361 Ga0207689_10192108
362 Ga0207667_10329921
363 Ga0207667_10552306
364 Ga0207667_10603268
365 Ga0207639_10030839
366 Ga0207702_10555594
367 Ga0207641_10010968
368 Ga0207641_10326033
369 Ga0207676_10163606
370 Ga0207674_10224794
371 Ga0207675_100066153
372 Ga0207675_100154711
373 Ga0207675_100888237
374 Ga0207683_10004988
375 Ga0207683_10102822
376 Ga0207683_10726419
377 Ga0207698_10343883
378 Ga0268266_10006445
379 Ga0268265_10649459
380 Ga0268264_10151677
381 Ga0265326_10040799
382 Ga0265319_1000064
383 Ga0265318_10001182
384 Ga0307515_10031157
385 Ga0307515_10276115
386 Ga0265338_10023221
387 Ga0265338_10116193
388 Ga0265338_10514079
389 Ga0265338_10596804
390 Ga0265762_1002199
391 Ga0265762_1023943
392 Ga0265765_1001197
393 Ga0265330_10001121
394 Ga0265330_10036783
395 Ga0265332_10000075
396 Ga0265332_10025371
397 Ga0265328_10003169
398 Ga0265320_10000077
399 Ga0265325_10056785
400 Ga0265329_10000012
401 Ga0265340_10000450
402 Ga0265339_10005270
403 Ga0265339_10100511
404 Ga0265331_10000836
405 Ga0265316_10005349
406 Ga0265316_10015592
407 Ga0265316_10015903
408 Ga0265316_10134087
409 Ga0307513_10000989
410 Ga0307509_10000040
411 Ga0307509_10002692
412 Ga0307509_10031171
413 Ga0307509_10118616
414 Ga0265313_10000105
415 Ga0307508_10020252
416 Ga0307508_10067131
417 Ga0265314_10000223
418 Ga0265314_10011367
419 Ga0265314_10019749
420 Ga0265342_10000129
421 Ga0265342_10055082
422 Ga0316576_10176498
423 Ga0307516_10019956
424 Ga0307406_10100443
425 Ga0307416_100989751
426 Ga0307416_102102125
427 Ga0316212_1007062
428 Ga0373949_0000103
429 Ga0373952_0148186
430 Ga0373936_0000015
431 Ga0373941_0009959
432 Ga0373954_0117561
433 Ga0373954_0368567
434 Ga0373943_0248834
435 Ga0373955_0003914
436 Ga0373924_0092332
437 Ga0373935_0457692
438 Ga0373927_0653915
439 Ga0373947_0030784
440 Ga0373947_0042779
441 Ga0373937_0019961
442 Ga0373925_0057418
443 Ga0373925_0198405
444 Ga0395899_0449482
445 Ga0395900_0130426
446 Ga0395898_0062643
447 Ga0395901_0049745
448 Ga0395901_0781034
449 Ga0436365_0671802
450 Ga0436365_0886966
451 Ga0436361_0159046
452 Ga0436361_1162322
453 Ga0436363_1185532
454 Ga0436362_1284749
455 Ga0451787_580797
456 Ga0451789_1008284
457 Ga0466972_0117814
458 Ga0453683_0198082
459 Ga0466961_0459800
460 Ga0453684_0052381
461 Ga0466959_0213635
462 Ga0451576_0000453
463 Ga0466967_0306837
464 Ga0495629_0156604
465 Ga0495638_0112595
466 Ga0495651_0084230
467 Ga0495664_0229027
468 Ga0495594_0237653
469 Ga0495628_0336877
470 Ga0495666_0030238
471 Ga0495642_0156976
472 Ga0495599_0051087
473 Ga0495649_0065897
474 Ga0495604_0116126
475 Ga0495604_0385892
476 Ga0495602_0114704
477 Ga0495602_0173802
478 Ga0495602_0422943
479 Ga0496108_0803550
480 Ga0496112_0134003
481 Ga0496114_0075470
482 Ga0501297_006065
483 Ga0501299_006260
484 Ga0501036_0421211
485 Ga0501046_0440446
486 Ga0501047_0021670
487 Ga0501047_0045576
488 Ga0501067_0042012
489 Ga0501069_0045916
490 Ga0501070_0018482
491 Ga0501070_0148618
492 Ga0501071_0018859
493 Ga0501077_0464134
494 Ga0501217_019443
495 Ga0501230_004898
496 Ga0501233_005251
497 Ga0501236_004655
498 Ga0501225_0003150
499 Ga0501229_002519
500 Ga0501044_0027479
501 Ga0501044_0124836
502 Ga0501204_007667
503 nmdc:mga05p37_329741_c1
504 nmdc:mga09592_176655_c1
505 nmdc:mga09592_386812_c1
506 nmdc:mga09592_42367_c1
507 nmdc:mga08y16_45928_c1
508 nmdc:mga0n895_630021_c1
509 nmdc:mga08x19_157033_c1
510 nmdc:mga08x19_29755_c1
511 Ga0500635_0003091
512 Ga0500566_0000256
513 Ga0500566_0006798
514 Ga0500566_0046301
515 Ga0500640_000124
516 Ga0500554_001415
517 Ga0500572_009960
518 Ga0500595_000015
519 Ga0500614_000331
520 Ga0500642_0019219
521 Ga0500642_0197759
522 Ga0500559_0012920
523 Ga0500568_0025728
524 Ga0500568_0030220
525 Ga0500603_002881
526 Ga0500630_119496
527 Ga0500639_272921
528 Ga0500636_0172882
529 Ga0501084_0060936
530 Ga0501084_0433191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

52

195

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9833 3 185
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9825 1 185
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9808 1 187
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9781 2 183
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9756 1 187
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9876 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9818 1 89 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9708 91 179 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9707 91 185 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9606 91 185 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A831LDB2-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9985 1 66 GO:0000105
GO:0004424
AF-A0A533Z642-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9983 2 88 GO:0000105
GO:0004424
AF-A0A2V9LRY2-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9966 1 91 GO:0000105
GO:0004424
AF-A8V5R9-F1-model_v4 Imidazoleglycerolphosphate dehydratase 0.996 3 91 GO:0000105
GO:0004424
AF-A0A658JM05-F1-model_v4 deleted 0.995 1 74

Map